F475321
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 688 | 280 | 687 | 333 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10007091|Ga0157369_100070914 |
| Length | 384 |
| Sequence | LFWTIIFKASESGQTSSDHQRAERVTRPAGFCYHPLSMKRTGENVVRIEAEALRRLADRIGGPMGEAFQRALDLMFECRGRVVVTGMGKSGIIARKIAATLSSIGTPALYLHPVEAIHGDLGMVVSGDVVVALSASGETEEILRLLANIKRLRVPLITMTCDEIFGASPLSVEPHGVDGDSRELAAPQKLSTLAAAAEVALDCSIDKEACSLGLAPTASTTAMLALGDALAVALSEKRGFKEEDFANLHPGGKLGKRLARVESLMHSGDAVPRVAPTAKMPDVIYEMSRKKLGMTAVVEGDKLLGVVSDGDLRRLLEQRGKDVLDLTAAECMTRDPKTIAGTEFAATALSIMEEKKITALVVVGNGAKLEGIVHLHDLWGTEMV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 113 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 176 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 180 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 183 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 184 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 185 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 187 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 188 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 189 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 192 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 193 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 196 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 200 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 201 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 202 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 208 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 215 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 216 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 218 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 219 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 222 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 223 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 224 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 225 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 226 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 227 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 230 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 231 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 232 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 260 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 261 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 262 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 263 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 266 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 267 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 268 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 269 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 270 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 275 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.13 |
| Metatranscriptomes | 0.73 |
| Isolates | 0.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.29 |
| Nodule | 0 |
| Rhizoplane | 4.07 |
| Rhizosphere | 93.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1002230 | 3300001976 | Bacteria | 2587 |
| 2 | JGI24743J22301_10007511 | 3300001991 | Bacteria | 1892 |
| 3 | JGI24751J29686_10012545 | 3300002459 | Bacteria | 1747 |
| 4 | rootH1_10087392 | 3300003316 | Bacteria | 4244 |
| 5 | rootH2_10017798 | 3300003320 | Bacteria | 14280 |
| 6 | rootL2_10074167 | 3300003322 | Bacteria | 3966 |
| 7 | rootL2_10180054 | 3300003322 | Bacteria | 2710 |
| 8 | Ga0058862_10076746 | 3300004803 | Bacteria | 2674 |
| 9 | Ga0065715_10151838 | 3300005293 | Bacteria | 1706 |
| 10 | Ga0070658_10088467 | 3300005327 | Bacteria | 2550 |
| 11 | Ga0070676_10103438 | 3300005328 | Bacteria | 1763 |
| 12 | Ga0070676_10129380 | 3300005328 | Bacteria | 1594 |
| 13 | Ga0070683_100001626 | 3300005329 | Bacteria | 17385 |
| 14 | Ga0070683_100067321 | 3300005329 | Bacteria | 3336 |
| 15 | Ga0070683_100163742 | 3300005329 | Bacteria | 2110 |
| 16 | Ga0070683_100228700 | 3300005329 | Bacteria | 1768 |
| 17 | Ga0070690_100042191 | 3300005330 | Bacteria | 2889 |
| 18 | Ga0070690_100106958 | 3300005330 | Bacteria | 1861 |
| 19 | Ga0070670_100052443 | 3300005331 | Bacteria | 3503 |
| 20 | Ga0070670_100098527 | 3300005331 | Bacteria | 2515 |
| 21 | Ga0070670_100110019 | 3300005331 | Bacteria | 2374 |
| 22 | Ga0068869_100001857 | 3300005334 | Bacteria | 12700 |
| 23 | Ga0068869_100002009 | 3300005334 | Bacteria | 12223 |
| 24 | Ga0068869_100103680 | 3300005334 | Bacteria | 2155 |
| 25 | Ga0070666_10000112 | 3300005335 | Bacteria | 55997 |
| 26 | Ga0070666_10013203 | 3300005335 | Bacteria | 5236 |
| 27 | Ga0070666_10194478 | 3300005335 | Bacteria | 1426 |
| 28 | Ga0070680_100037547 | 3300005336 | Bacteria | 3914 |
| 29 | Ga0070680_100107442 | 3300005336 | Bacteria | 2321 |
| 30 | Ga0070680_100204746 | 3300005336 | Bacteria | 1664 |
| 31 | Ga0070682_100020328 | 3300005337 | Bacteria | 3906 |
| 32 | Ga0070682_100034220 | 3300005337 | Bacteria | 3093 |
| 33 | Ga0070682_100060727 | 3300005337 | Bacteria | 2391 |
| 34 | Ga0068868_100008985 | 3300005338 | Bacteria | 7171 |
| 35 | Ga0068868_100014278 | 3300005338 | Bacteria | 5851 |
| 36 | Ga0068868_100043917 | 3300005338 | Bacteria | 3492 |
| 37 | Ga0070660_100002367 | 3300005339 | Bacteria | 12955 |
| 38 | Ga0070660_100177063 | 3300005339 | Bacteria | 1725 |
| 39 | Ga0070691_10018185 | 3300005341 | Bacteria | 3239 |
| 40 | Ga0070687_100004698 | 3300005343 | Bacteria | 5463 |
| 41 | Ga0070687_100033238 | 3300005343 | Bacteria | 2544 |
| 42 | Ga0070661_100041173 | 3300005344 | Bacteria | 3371 |
| 43 | Ga0070661_100060461 | 3300005344 | Bacteria | 2780 |
| 44 | Ga0070675_100193240 | 3300005354 | Bacteria | 1764 |
| 45 | Ga0070671_100145196 | 3300005355 | Bacteria | 2002 |
| 46 | Ga0070674_100036897 | 3300005356 | Bacteria | 3285 |
| 47 | Ga0070688_100000649 | 3300005365 | Bacteria | 17263 |
| 48 | Ga0070688_100254182 | 3300005365 | Unclassified | 1252 |
| 49 | Ga0070659_100002024 | 3300005366 | Bacteria | 14493 |
| 50 | Ga0070659_100110688 | 3300005366 | Bacteria | 2217 |
| 51 | Ga0070659_100155171 | 3300005366 | Unclassified | 1869 |
| 52 | Ga0070667_100017599 | 3300005367 | Bacteria | 5921 |
| 53 | Ga0070709_10012407 | 3300005434 | Bacteria | 4770 |
| 54 | Ga0070709_10034826 | 3300005434 | Bacteria | 3056 |
| 55 | Ga0070714_100031796 | 3300005435 | Bacteria | 4405 |
| 56 | Ga0070714_100053079 | 3300005435 | Bacteria | 3459 |
| 57 | Ga0070714_100059609 | 3300005435 | Bacteria | 3273 |
| 58 | Ga0070714_100105981 | 3300005435 | Bacteria | 2483 |
| 59 | Ga0070714_100413684 | 3300005435 | Bacteria | 1276 |
| 60 | Ga0070714_100414440 | 3300005435 | Bacteria | 1275 |
| 61 | Ga0070714_100450386 | 3300005435 | Bacteria | 1223 |
| 62 | Ga0070713_100005746 | 3300005436 | Bacteria | 8521 |
| 63 | Ga0070713_100007565 | 3300005436 | Bacteria | 7636 |
| 64 | Ga0070713_100011239 | 3300005436 | Bacteria | 6511 |
| 65 | Ga0070713_100036748 | 3300005436 | Bacteria | 3955 |
| 66 | Ga0070713_100046707 | 3300005436 | Bacteria | 3554 |
| 67 | Ga0070713_100061504 | 3300005436 | Unclassified | 3141 |
| 68 | Ga0070713_100083172 | 3300005436 | Unclassified | 2736 |
| 69 | Ga0070713_100340513 | 3300005436 | Bacteria | 1389 |
| 70 | Ga0070710_10025077 | 3300005437 | Bacteria | 3154 |
| 71 | Ga0070710_10035306 | 3300005437 | Bacteria | 2725 |
| 72 | Ga0070710_10160127 | 3300005437 | Bacteria | 1395 |
| 73 | Ga0070701_10005375 | 3300005438 | Bacteria | 5284 |
| 74 | Ga0070711_100008817 | 3300005439 | Bacteria | 6188 |
| 75 | Ga0070711_100013799 | 3300005439 | Bacteria | 5082 |
| 76 | Ga0070711_100022031 | 3300005439 | Bacteria | 4125 |
| 77 | Ga0070711_100127600 | 3300005439 | Bacteria | 1890 |
| 78 | Ga0070711_100227844 | 3300005439 | Bacteria | 1452 |
| 79 | Ga0070700_100034036 | 3300005441 | Bacteria | 3074 |
| 80 | Ga0070708_100004387 | 3300005445 | Bacteria | 11082 |
| 81 | Ga0070708_100034749 | 3300005445 | Bacteria | 4387 |
| 82 | Ga0070708_100044873 | 3300005445 | Bacteria | 3890 |
| 83 | Ga0070708_100060491 | 3300005445 | Bacteria | 3381 |
| 84 | Ga0070708_100085848 | 3300005445 | Bacteria | 2857 |
| 85 | Ga0070663_100022418 | 3300005455 | Bacteria | 4222 |
| 86 | Ga0070678_100020672 | 3300005456 | Bacteria | 4324 |
| 87 | Ga0070678_100044700 | 3300005456 | Bacteria | 3164 |
| 88 | Ga0070678_100111458 | 3300005456 | Bacteria | 2141 |
| 89 | Ga0070678_100131764 | 3300005456 | Bacteria | 1987 |
| 90 | Ga0070662_100035203 | 3300005457 | Bacteria | 3535 |
| 91 | Ga0070681_10016054 | 3300005458 | Bacteria | 7464 |
| 92 | Ga0070681_10056317 | 3300005458 | Bacteria | 3913 |
| 93 | Ga0070681_10111751 | 3300005458 | Unclassified | 2671 |
| 94 | Ga0070681_10187229 | 3300005458 | Bacteria | 1990 |
| 95 | Ga0070681_10211351 | 3300005458 | Bacteria | 1856 |
| 96 | Ga0070681_10212467 | 3300005458 | Bacteria | 1851 |
| 97 | Ga0070681_10228072 | 3300005458 | Bacteria | 1777 |
| 98 | Ga0068867_100015408 | 3300005459 | Bacteria | 5421 |
| 99 | Ga0068867_100038327 | 3300005459 | Bacteria | 3489 |
| 100 | Ga0068867_100098863 | 3300005459 | Bacteria | 2225 |
| 101 | Ga0070685_10088377 | 3300005466 | Unclassified | 1871 |
| 102 | Ga0070706_100004518 | 3300005467 | Bacteria | 13398 |
| 103 | Ga0070706_100007965 | 3300005467 | Bacteria | 9892 |
| 104 | Ga0070706_100041991 | 3300005467 | Bacteria | 4224 |
| 105 | Ga0070706_100151444 | 3300005467 | Unclassified | 2165 |
| 106 | Ga0070706_100307884 | 3300005467 | Bacteria | 1478 |
| 107 | Ga0070707_100010330 | 3300005468 | Bacteria | 8690 |
| 108 | Ga0070707_100013103 | 3300005468 | Bacteria | 7750 |
| 109 | Ga0070707_100076256 | 3300005468 | Bacteria | 3234 |
| 110 | Ga0070698_100000039 | 3300005471 | Bacteria | 91348 |
| 111 | Ga0070698_100042796 | 3300005471 | Bacteria | 4646 |
| 112 | Ga0070699_100096724 | 3300005518 | Bacteria | 2586 |
| 113 | Ga0070679_100002354 | 3300005530 | Bacteria | 17120 |
| 114 | Ga0070679_100006248 | 3300005530 | Bacteria | 11099 |
| 115 | Ga0070679_100031817 | 3300005530 | Bacteria | 5216 |
| 116 | Ga0070679_100182384 | 3300005530 | Bacteria | 2071 |
| 117 | Ga0070684_100007055 | 3300005535 | Bacteria | 8732 |
| 118 | Ga0070684_100025259 | 3300005535 | Bacteria | 4992 |
| 119 | Ga0070684_100026321 | 3300005535 | Bacteria | 4899 |
| 120 | Ga0070684_100256762 | 3300005535 | Bacteria | 1598 |
| 121 | Ga0070684_100312043 | 3300005535 | Bacteria | 1444 |
| 122 | Ga0070697_100040698 | 3300005536 | Bacteria | 3761 |
| 123 | Ga0070697_100067209 | 3300005536 | Bacteria | 2932 |
| 124 | Ga0070697_100228610 | 3300005536 | Unclassified | 1586 |
| 125 | Ga0068853_100006954 | 3300005539 | Bacteria | 9036 |
| 126 | Ga0068853_100093357 | 3300005539 | Bacteria | 2649 |
| 127 | Ga0068853_100113996 | 3300005539 | Bacteria | 2404 |
| 128 | Ga0068853_100157184 | 3300005539 | Bacteria | 2049 |
| 129 | Ga0070672_100061334 | 3300005543 | Bacteria | 2964 |
| 130 | Ga0070696_100079366 | 3300005546 | Bacteria | 2322 |
| 131 | Ga0070696_100134052 | 3300005546 | Bacteria | 1805 |
| 132 | Ga0070665_100119943 | 3300005548 | Unclassified | 2632 |
| 133 | Ga0070665_100154251 | 3300005548 | Bacteria | 2299 |
| 134 | Ga0070665_100443517 | 3300005548 | Bacteria | 1307 |
| 135 | Ga0068855_100000782 | 3300005563 | Bacteria | 39281 |
| 136 | Ga0068855_100003547 | 3300005563 | Bacteria | 19079 |
| 137 | Ga0068855_100004362 | 3300005563 | Bacteria | 17294 |
| 138 | Ga0068855_100018769 | 3300005563 | Bacteria | 8314 |
| 139 | Ga0068855_100047589 | 3300005563 | Bacteria | 5066 |
| 140 | Ga0068855_100222868 | 3300005563 | Bacteria | 2114 |
| 141 | Ga0070664_100001991 | 3300005564 | Bacteria | 16379 |
| 142 | Ga0070664_100010095 | 3300005564 | Bacteria | 7655 |
| 143 | Ga0068857_100000775 | 3300005577 | Bacteria | 23800 |
| 144 | Ga0068857_100001392 | 3300005577 | Bacteria | 19079 |
| 145 | Ga0068857_100198356 | 3300005577 | Bacteria | 1829 |
| 146 | Ga0068857_100258835 | 3300005577 | Unclassified | 1597 |
| 147 | Ga0068857_100418012 | 3300005577 | Unclassified | 1250 |
| 148 | Ga0068854_100002592 | 3300005578 | Bacteria | 11198 |
| 149 | Ga0068854_100090550 | 3300005578 | Bacteria | 2275 |
| 150 | Ga0068854_100095898 | 3300005578 | Bacteria | 2215 |
| 151 | Ga0068854_100127888 | 3300005578 | Bacteria | 1937 |
| 152 | Ga0068854_100174988 | 3300005578 | Unclassified | 1672 |
| 153 | Ga0068856_100000437 | 3300005614 | Bacteria | 45849 |
| 154 | Ga0068856_100005024 | 3300005614 | Bacteria | 13099 |
| 155 | Ga0068856_100005815 | 3300005614 | Bacteria | 12156 |
| 156 | Ga0068856_100083869 | 3300005614 | Bacteria | 3165 |
| 157 | Ga0068856_100104260 | 3300005614 | Bacteria | 2829 |
| 158 | Ga0068856_100179631 | 3300005614 | Unclassified | 2129 |
| 159 | Ga0068856_100331633 | 3300005614 | Unclassified | 1539 |
| 160 | Ga0070702_100021445 | 3300005615 | Bacteria | 3399 |
| 161 | Ga0068852_100005128 | 3300005616 | Bacteria | 9334 |
| 162 | Ga0068852_100012290 | 3300005616 | Bacteria | 6493 |
| 163 | Ga0068852_100189228 | 3300005616 | Bacteria | 1941 |
| 164 | Ga0068852_100378513 | 3300005616 | Bacteria | 1388 |
| 165 | Ga0068852_100394460 | 3300005616 | Bacteria | 1360 |
| 166 | Ga0068852_100403705 | 3300005616 | Unclassified | 1345 |
| 167 | Ga0068859_100000018 | 3300005617 | Bacteria | 248813 |
| 168 | Ga0068859_100000298 | 3300005617 | Bacteria | 49363 |
| 169 | Ga0068859_100018200 | 3300005617 | Bacteria | 7062 |
| 170 | Ga0068859_100251227 | 3300005617 | Bacteria | 1859 |
| 171 | Ga0068864_100002195 | 3300005618 | Bacteria | 16100 |
| 172 | Ga0068864_100002226 | 3300005618 | Bacteria | 16023 |
| 173 | Ga0068864_100026453 | 3300005618 | Bacteria | 4893 |
| 174 | Ga0068864_100035311 | 3300005618 | Bacteria | 4256 |
| 175 | Ga0068864_100038489 | 3300005618 | Bacteria | 4085 |
| 176 | Ga0068864_100135313 | 3300005618 | Bacteria | 2218 |
| 177 | Ga0068861_100067746 | 3300005719 | Unclassified | 2756 |
| 178 | Ga0068861_100075095 | 3300005719 | Bacteria | 2631 |
| 179 | Ga0068861_100404971 | 3300005719 | Bacteria | 1212 |
| 180 | Ga0068861_100515472 | 3300005719 | Bacteria | 1083 |
| 181 | Ga0068851_10078344 | 3300005834 | Bacteria | 1722 |
| 182 | Ga0068851_10094974 | 3300005834 | Bacteria | 1575 |
| 183 | Ga0068870_10000211 | 3300005840 | Bacteria | 21074 |
| 184 | Ga0068870_10108856 | 3300005840 | Bacteria | 1578 |
| 185 | Ga0068863_100005189 | 3300005841 | Bacteria | 12849 |
| 186 | Ga0068863_100101577 | 3300005841 | Bacteria | 2734 |
| 187 | Ga0068858_100000728 | 3300005842 | Bacteria | 34411 |
| 188 | Ga0068858_100002919 | 3300005842 | Bacteria | 17201 |
| 189 | Ga0068858_100010844 | 3300005842 | Bacteria | 8616 |
| 190 | Ga0068858_100028909 | 3300005842 | Bacteria | 5147 |
| 191 | Ga0068858_100072311 | 3300005842 | Bacteria | 3200 |
| 192 | Ga0068860_100031286 | 3300005843 | Bacteria | 5116 |
| 193 | Ga0068860_100048179 | 3300005843 | Bacteria | 4062 |
| 194 | Ga0068860_100141659 | 3300005843 | Bacteria | 2311 |
| 195 | Ga0068860_100156457 | 3300005843 | Bacteria | 2197 |
| 196 | Ga0068862_100413965 | 3300005844 | Bacteria | 1263 |
| 197 | Ga0070717_10002780 | 3300006028 | Bacteria | 12385 |
| 198 | Ga0070717_10012555 | 3300006028 | Bacteria | 6463 |
| 199 | Ga0070717_10351968 | 3300006028 | Bacteria | 1317 |
| 200 | Ga0070715_10125253 | 3300006163 | Bacteria | 1230 |
| 201 | Ga0070716_100000412 | 3300006173 | Bacteria | 17590 |
| 202 | Ga0070712_100003917 | 3300006175 | Bacteria | 9168 |
| 203 | Ga0070712_100007097 | 3300006175 | Bacteria | 6988 |
| 204 | Ga0070712_100014269 | 3300006175 | Bacteria | 5101 |
| 205 | Ga0070712_100099225 | 3300006175 | Bacteria | 2149 |
| 206 | Ga0070712_100111988 | 3300006175 | Bacteria | 2038 |
| 207 | Ga0075366_10008292 | 3300006195 | Bacteria | 5772 |
| 208 | Ga0097621_100000472 | 3300006237 | Bacteria | 28201 |
| 209 | Ga0097621_100005119 | 3300006237 | Bacteria | 9211 |
| 210 | Ga0097621_100021084 | 3300006237 | Bacteria | 5033 |
| 211 | Ga0097621_100161643 | 3300006237 | Bacteria | 1925 |
| 212 | Ga0097621_100179945 | 3300006237 | Bacteria | 1827 |
| 213 | Ga0097621_100188313 | 3300006237 | Bacteria | 1786 |
| 214 | Ga0068871_100000084 | 3300006358 | Bacteria | 53380 |
| 215 | Ga0068871_100027840 | 3300006358 | Bacteria | 4426 |
| 216 | Ga0068871_100067580 | 3300006358 | Bacteria | 2933 |
| 217 | Ga0068871_100103111 | 3300006358 | Bacteria | 2392 |
| 218 | Ga0068871_100130163 | 3300006358 | Bacteria | 2133 |
| 219 | Ga0068871_100236235 | 3300006358 | Unclassified | 1588 |
| 220 | Ga0075428_100002512 | 3300006844 | Bacteria | 19933 |
| 221 | Ga0075433_10017089 | 3300006852 | Bacteria | 5999 |
| 222 | Ga0075433_10201290 | 3300006852 | Bacteria | 1770 |
| 223 | Ga0075434_100000303 | 3300006871 | Bacteria | 34918 |
| 224 | Ga0075434_100006848 | 3300006871 | Bacteria | 10493 |
| 225 | Ga0075434_100010660 | 3300006871 | Bacteria | 8629 |
| 226 | Ga0075434_100013728 | 3300006871 | Bacteria | 7723 |
| 227 | Ga0075434_100567561 | 3300006871 | Bacteria | 1154 |
| 228 | Ga0068865_100020735 | 3300006881 | Bacteria | 4266 |
| 229 | Ga0068865_100030842 | 3300006881 | Bacteria | 3569 |
| 230 | Ga0068865_100059521 | 3300006881 | Bacteria | 2672 |
| 231 | Ga0068865_100107252 | 3300006881 | Bacteria | 2054 |
| 232 | Ga0068865_100254777 | 3300006881 | Bacteria | 1387 |
| 233 | Ga0075436_100001773 | 3300006914 | Bacteria | 14792 |
| 234 | Ga0075436_100012670 | 3300006914 | Bacteria | 5778 |
| 235 | Ga0075436_100022740 | 3300006914 | Unclassified | 4307 |
| 236 | Ga0075436_100086953 | 3300006914 | Bacteria | 2171 |
| 237 | Ga0097620_100000018 | 3300006931 | Bacteria | 248813 |
| 238 | Ga0097620_100000298 | 3300006931 | Bacteria | 49363 |
| 239 | Ga0097620_100018202 | 3300006931 | Bacteria | 7062 |
| 240 | Ga0097620_100251243 | 3300006931 | Bacteria | 1859 |
| 241 | Ga0075435_100001940 | 3300007076 | Bacteria | 13479 |
| 242 | Ga0075435_100041806 | 3300007076 | Bacteria | 3665 |
| 243 | Ga0105240_10005889 | 3300009093 | Bacteria | 18155 |
| 244 | Ga0105240_10019633 | 3300009093 | Bacteria | 9026 |
| 245 | Ga0105240_10039462 | 3300009093 | Bacteria | 6047 |
| 246 | Ga0105240_10125612 | 3300009093 | Bacteria | 3083 |
| 247 | Ga0105240_10138712 | 3300009093 | Bacteria | 2909 |
| 248 | Ga0105240_10306446 | 3300009093 | Bacteria | 1815 |
| 249 | Ga0111539_10209782 | 3300009094 | Bacteria | 2270 |
| 250 | Ga0105245_10003176 | 3300009098 | Bacteria | 14685 |
| 251 | Ga0105245_10005120 | 3300009098 | Bacteria | 11520 |
| 252 | Ga0105245_10020679 | 3300009098 | Bacteria | 5770 |
| 253 | Ga0105245_10199370 | 3300009098 | Bacteria | 1921 |
| 254 | Ga0105247_10005382 | 3300009101 | Bacteria | 8065 |
| 255 | Ga0105247_10036051 | 3300009101 | Bacteria | 3016 |
| 256 | Ga0105241_10001966 | 3300009174 | Bacteria | 15555 |
| 257 | Ga0105241_10040079 | 3300009174 | Bacteria | 3535 |
| 258 | Ga0105241_10127828 | 3300009174 | Bacteria | 2054 |
| 259 | Ga0105241_10212161 | 3300009174 | Bacteria | 1623 |
| 260 | Ga0105248_10029115 | 3300009177 | Bacteria | 6158 |
| 261 | Ga0105248_10035966 | 3300009177 | Bacteria | 5539 |
| 262 | Ga0105248_10079009 | 3300009177 | Unclassified | 3697 |
| 263 | Ga0105248_10174681 | 3300009177 | Bacteria | 2422 |
| 264 | Ga0105237_10002252 | 3300009545 | Bacteria | 24014 |
| 265 | Ga0105237_10003222 | 3300009545 | Bacteria | 19554 |
| 266 | Ga0105237_10027686 | 3300009545 | Bacteria | 5780 |
| 267 | Ga0105237_10058217 | 3300009545 | Bacteria | 3868 |
| 268 | Ga0105237_10378172 | 3300009545 | Unclassified | 1421 |
| 269 | Ga0105238_10012484 | 3300009551 | Bacteria | 8569 |
| 270 | Ga0105238_10037575 | 3300009551 | Bacteria | 4922 |
| 271 | Ga0105249_10005930 | 3300009553 | Bacteria | 10585 |
| 272 | Ga0105249_10092022 | 3300009553 | Bacteria | 2838 |
| 273 | Ga0105249_10282203 | 3300009553 | Bacteria | 1659 |
| 274 | Ga0105249_10504310 | 3300009553 | Bacteria | 1255 |
| 275 | Ga0105239_10002453 | 3300010375 | Bacteria | 23633 |
| 276 | Ga0105239_10071172 | 3300010375 | Bacteria | 3821 |
| 277 | Ga0105239_10097035 | 3300010375 | Bacteria | 3257 |
| 278 | Ga0105239_10225797 | 3300010375 | Unclassified | 2101 |
| 279 | Ga0105239_10557092 | 3300010375 | Bacteria | 1306 |
| 280 | Ga0105246_10063497 | 3300011119 | Bacteria | 2576 |
| 281 | Ga0105246_10100654 | 3300011119 | Bacteria | 2103 |
| 282 | Ga0105246_10199382 | 3300011119 | Bacteria | 1555 |
| 283 | Ga0157373_10005980 | 3300013100 | Bacteria | 9103 |
| 284 | Ga0157373_10053729 | 3300013100 | Bacteria | 2864 |
| 285 | Ga0157373_10077039 | 3300013100 | Bacteria | 2352 |
| 286 | Ga0157373_10221392 | 3300013100 | Bacteria | 1335 |
| 287 | Ga0157370_10114950 | 3300013104 | Bacteria | 2514 |
| 288 | Ga0157370_10141257 | 3300013104 | Unclassified | 2243 |
| 289 | Ga0157370_10150084 | 3300013104 | Unclassified | 2169 |
| 290 | Ga0157370_10210610 | 3300013104 | Bacteria | 1801 |
| 291 | Ga0157369_10000297 | 3300013105 | Bacteria | 66398 |
| 292 | Ga0157369_10004291 | 3300013105 | Bacteria | 16859 |
| 293 | Ga0157369_10007091 | 3300013105 | Bacteria | 12928 |
| 294 | Ga0157369_10015876 | 3300013105 | Bacteria | 8480 |
| 295 | Ga0157369_10066644 | 3300013105 | Bacteria | 3873 |
| 296 | Ga0157374_10000357 | 3300013296 | Bacteria | 42343 |
| 297 | Ga0157374_10001545 | 3300013296 | Bacteria | 19407 |
| 298 | Ga0157374_10001620 | 3300013296 | Bacteria | 18879 |
| 299 | Ga0157374_10001876 | 3300013296 | Bacteria | 17667 |
| 300 | Ga0157374_10075968 | 3300013296 | Bacteria | 3175 |
| 301 | Ga0157374_10167999 | 3300013296 | Bacteria | 2139 |
| 302 | Ga0157378_10000133 | 3300013297 | Bacteria | 70888 |
| 303 | Ga0157378_10000970 | 3300013297 | Bacteria | 26291 |
| 304 | Ga0157378_10009203 | 3300013297 | Bacteria | 8602 |
| 305 | Ga0157378_10018115 | 3300013297 | Bacteria | 6184 |
| 306 | Ga0157378_10037172 | 3300013297 | Bacteria | 4312 |
| 307 | Ga0157378_10046849 | 3300013297 | Bacteria | 3842 |
| 308 | Ga0163162_10001107 | 3300013306 | Bacteria | 24993 |
| 309 | Ga0163162_10009985 | 3300013306 | Bacteria | 9231 |
| 310 | Ga0163162_10036746 | 3300013306 | Bacteria | 4884 |
| 311 | Ga0157372_10000544 | 3300013307 | Bacteria | 41533 |
| 312 | Ga0157372_10000749 | 3300013307 | Bacteria | 35224 |
| 313 | Ga0157372_10002337 | 3300013307 | Bacteria | 20534 |
| 314 | Ga0157372_10053060 | 3300013307 | Bacteria | 4517 |
| 315 | Ga0157372_10111813 | 3300013307 | Bacteria | 3129 |
| 316 | Ga0157372_10208841 | 3300013307 | Bacteria | 2262 |
| 317 | Ga0157372_10243572 | 3300013307 | Bacteria | 2086 |
| 318 | Ga0157372_10358666 | 3300013307 | Bacteria | 1699 |
| 319 | Ga0157372_10589640 | 3300013307 | Bacteria | 1296 |
| 320 | Ga0157375_10147731 | 3300013308 | Bacteria | 2483 |
| 321 | Ga0157375_10390409 | 3300013308 | Bacteria | 1559 |
| 322 | Ga0163163_10041486 | 3300014325 | Bacteria | 4500 |
| 323 | Ga0163163_10118100 | 3300014325 | Bacteria | 2684 |
| 324 | Ga0163163_10310268 | 3300014325 | Bacteria | 1630 |
| 325 | Ga0157380_10086862 | 3300014326 | Bacteria | 2571 |
| 326 | Ga0157380_10187513 | 3300014326 | Bacteria | 1823 |
| 327 | Ga0182008_10021047 | 3300014497 | Bacteria | 3353 |
| 328 | Ga0157377_10000704 | 3300014745 | Bacteria | 13786 |
| 329 | Ga0157379_10036033 | 3300014968 | Bacteria | 4412 |
| 330 | Ga0157379_10148276 | 3300014968 | Bacteria | 2116 |
| 331 | Ga0157379_10248894 | 3300014968 | Bacteria | 1613 |
| 332 | Ga0157376_10002166 | 3300014969 | Bacteria | 13231 |
| 333 | Ga0157376_10023839 | 3300014969 | Bacteria | 4797 |
| 334 | Ga0157376_10084238 | 3300014969 | Bacteria | 2737 |
| 335 | Ga0157376_10339339 | 3300014969 | Bacteria | 1434 |
| 336 | Ga0182007_10007804 | 3300015262 | Bacteria | 4450 |
| 337 | Ga0163161_10010962 | 3300017792 | Bacteria | 6281 |
| 338 | Ga0228598_1007166 | 3300024227 | Bacteria | 2281 |
| 339 | Ga0207656_10064673 | 3300025321 | Bacteria | 1613 |
| 340 | Ga0207682_10026377 | 3300025893 | Bacteria | 2310 |
| 341 | Ga0207692_10088723 | 3300025898 | Bacteria | 1672 |
| 342 | Ga0207710_10004125 | 3300025900 | Bacteria | 6380 |
| 343 | Ga0207688_10009395 | 3300025901 | Bacteria | 5326 |
| 344 | Ga0207688_10032133 | 3300025901 | Bacteria | 2900 |
| 345 | Ga0207680_10000193 | 3300025903 | Bacteria | 29312 |
| 346 | Ga0207680_10035685 | 3300025903 | Bacteria | 2857 |
| 347 | Ga0207647_10001725 | 3300025904 | Bacteria | 16767 |
| 348 | Ga0207647_10095040 | 3300025904 | Bacteria | 1775 |
| 349 | Ga0207699_10014129 | 3300025906 | Bacteria | 4106 |
| 350 | Ga0207699_10030809 | 3300025906 | Bacteria | 3005 |
| 351 | Ga0207699_10160356 | 3300025906 | Bacteria | 1496 |
| 352 | Ga0207699_10199802 | 3300025906 | Bacteria | 1354 |
| 353 | Ga0207699_10201656 | 3300025906 | Unclassified | 1348 |
| 354 | Ga0207645_10000104 | 3300025907 | Bacteria | 62309 |
| 355 | Ga0207643_10000512 | 3300025908 | Bacteria | 24816 |
| 356 | Ga0207643_10006921 | 3300025908 | Bacteria | 6080 |
| 357 | Ga0207684_10000457 | 3300025910 | Bacteria | 53335 |
| 358 | Ga0207684_10054018 | 3300025910 | Bacteria | 3408 |
| 359 | Ga0207654_10001980 | 3300025911 | Bacteria | 10581 |
| 360 | Ga0207654_10018281 | 3300025911 | Bacteria | 3676 |
| 361 | Ga0207654_10130020 | 3300025911 | Bacteria | 1592 |
| 362 | Ga0207654_10160948 | 3300025911 | Bacteria | 1450 |
| 363 | Ga0207707_10001372 | 3300025912 | Bacteria | 22585 |
| 364 | Ga0207707_10012202 | 3300025912 | Bacteria | 7470 |
| 365 | Ga0207707_10063186 | 3300025912 | Bacteria | 3222 |
| 366 | Ga0207695_10070288 | 3300025913 | Bacteria | 3579 |
| 367 | Ga0207695_10070744 | 3300025913 | Bacteria | 3565 |
| 368 | Ga0207695_10093475 | 3300025913 | Unclassified | 3016 |
| 369 | Ga0207695_10162121 | 3300025913 | Bacteria | 2167 |
| 370 | Ga0207695_10199351 | 3300025913 | Bacteria | 1916 |
| 371 | Ga0207695_10214937 | 3300025913 | Bacteria | 1832 |
| 372 | Ga0207695_10262885 | 3300025913 | Bacteria | 1623 |
| 373 | Ga0207671_10001799 | 3300025914 | Bacteria | 23966 |
| 374 | Ga0207671_10009175 | 3300025914 | Bacteria | 8298 |
| 375 | Ga0207671_10025778 | 3300025914 | Bacteria | 4412 |
| 376 | Ga0207671_10042066 | 3300025914 | Bacteria | 3382 |
| 377 | Ga0207671_10112587 | 3300025914 | Bacteria | 2072 |
| 378 | Ga0207693_10001454 | 3300025915 | Bacteria | 20960 |
| 379 | Ga0207693_10007586 | 3300025915 | Bacteria | 8914 |
| 380 | Ga0207693_10012077 | 3300025915 | Bacteria | 6983 |
| 381 | Ga0207693_10034746 | 3300025915 | Bacteria | 3976 |
| 382 | Ga0207693_10090013 | 3300025915 | Bacteria | 2405 |
| 383 | Ga0207693_10262333 | 3300025915 | Bacteria | 1354 |
| 384 | Ga0207663_10023888 | 3300025916 | Bacteria | 3515 |
| 385 | Ga0207663_10079133 | 3300025916 | Bacteria | 2145 |
| 386 | Ga0207660_10050806 | 3300025917 | Bacteria | 2945 |
| 387 | Ga0207660_10190271 | 3300025917 | Bacteria | 1598 |
| 388 | Ga0207660_10333916 | 3300025917 | Bacteria | 1212 |
| 389 | Ga0207662_10028514 | 3300025918 | Bacteria | 3228 |
| 390 | Ga0207657_10002030 | 3300025919 | Bacteria | 21872 |
| 391 | Ga0207649_10000149 | 3300025920 | Bacteria | 57837 |
| 392 | Ga0207652_10000098 | 3300025921 | Bacteria | 94858 |
| 393 | Ga0207652_10014836 | 3300025921 | Bacteria | 6317 |
| 394 | Ga0207646_10013710 | 3300025922 | Bacteria | 7740 |
| 395 | Ga0207646_10148211 | 3300025922 | Bacteria | 2115 |
| 396 | Ga0207646_10191675 | 3300025922 | Bacteria | 1846 |
| 397 | Ga0207646_10284928 | 3300025922 | Unclassified | 1493 |
| 398 | Ga0207681_10006994 | 3300025923 | Bacteria | 6924 |
| 399 | Ga0207694_10057084 | 3300025924 | Unclassified | 3034 |
| 400 | Ga0207694_10113525 | 3300025924 | Bacteria | 2157 |
| 401 | Ga0207650_10000442 | 3300025925 | Bacteria | 35606 |
| 402 | Ga0207650_10032174 | 3300025925 | Bacteria | 3794 |
| 403 | Ga0207650_10037358 | 3300025925 | Bacteria | 3539 |
| 404 | Ga0207659_10006779 | 3300025926 | Bacteria | 7040 |
| 405 | Ga0207687_10001854 | 3300025927 | Bacteria | 14548 |
| 406 | Ga0207700_10004348 | 3300025928 | Bacteria | 8337 |
| 407 | Ga0207700_10005883 | 3300025928 | Bacteria | 7374 |
| 408 | Ga0207700_10007126 | 3300025928 | Bacteria | 6813 |
| 409 | Ga0207700_10028787 | 3300025928 | Bacteria | 3913 |
| 410 | Ga0207664_10001649 | 3300025929 | Bacteria | 14702 |
| 411 | Ga0207664_10010810 | 3300025929 | Bacteria | 6460 |
| 412 | Ga0207664_10028600 | 3300025929 | Bacteria | 4238 |
| 413 | Ga0207664_10084133 | 3300025929 | Bacteria | 2594 |
| 414 | Ga0207664_10235851 | 3300025929 | Bacteria | 1592 |
| 415 | Ga0207644_10276281 | 3300025931 | Bacteria | 1348 |
| 416 | Ga0207706_10000651 | 3300025933 | Bacteria | 36655 |
| 417 | Ga0207706_10014413 | 3300025933 | Bacteria | 7164 |
| 418 | Ga0207686_10081199 | 3300025934 | Bacteria | 2116 |
| 419 | Ga0207709_10182258 | 3300025935 | Unclassified | 1484 |
| 420 | Ga0207669_10053883 | 3300025937 | Bacteria | 2426 |
| 421 | Ga0207704_10005806 | 3300025938 | Bacteria | 5709 |
| 422 | Ga0207704_10025863 | 3300025938 | Bacteria | 3210 |
| 423 | Ga0207704_10139319 | 3300025938 | Bacteria | 1694 |
| 424 | Ga0207704_10222833 | 3300025938 | Bacteria | 1397 |
| 425 | Ga0207704_10256779 | 3300025938 | Bacteria | 1315 |
| 426 | Ga0207665_10000884 | 3300025939 | Bacteria | 20220 |
| 427 | Ga0207665_10032359 | 3300025939 | Bacteria | 3462 |
| 428 | Ga0207691_10000312 | 3300025940 | Bacteria | 48438 |
| 429 | Ga0207691_10006924 | 3300025940 | Bacteria | 10933 |
| 430 | Ga0207691_10015832 | 3300025940 | Bacteria | 7168 |
| 431 | Ga0207711_10002489 | 3300025941 | Bacteria | 16445 |
| 432 | Ga0207711_10073624 | 3300025941 | Bacteria | 2969 |
| 433 | Ga0207689_10000706 | 3300025942 | Bacteria | 32003 |
| 434 | Ga0207689_10003386 | 3300025942 | Bacteria | 14566 |
| 435 | Ga0207689_10003649 | 3300025942 | Bacteria | 14045 |
| 436 | Ga0207689_10048022 | 3300025942 | Bacteria | 3521 |
| 437 | Ga0207661_10000213 | 3300025944 | Bacteria | 37493 |
| 438 | Ga0207661_10012169 | 3300025944 | Bacteria | 6248 |
| 439 | Ga0207661_10065711 | 3300025944 | Bacteria | 2945 |
| 440 | Ga0207661_10255183 | 3300025944 | Bacteria | 1560 |
| 441 | Ga0207661_10272824 | 3300025944 | Bacteria | 1510 |
| 442 | Ga0207679_10000080 | 3300025945 | Bacteria | 84997 |
| 443 | Ga0207679_10037097 | 3300025945 | Bacteria | 3462 |
| 444 | Ga0207679_10157560 | 3300025945 | Bacteria | 1856 |
| 445 | Ga0207667_10000475 | 3300025949 | Bacteria | 53512 |
| 446 | Ga0207667_10001648 | 3300025949 | Bacteria | 28133 |
| 447 | Ga0207667_10011648 | 3300025949 | Bacteria | 10207 |
| 448 | Ga0207667_10067837 | 3300025949 | Unclassified | 3715 |
| 449 | Ga0207667_10108728 | 3300025949 | Bacteria | 2860 |
| 450 | Ga0207651_10000653 | 3300025960 | Bacteria | 14741 |
| 451 | Ga0207651_10251174 | 3300025960 | Bacteria | 1447 |
| 452 | Ga0207712_10026102 | 3300025961 | Bacteria | 3889 |
| 453 | Ga0207712_10027693 | 3300025961 | Bacteria | 3785 |
| 454 | Ga0207712_10143522 | 3300025961 | Bacteria | 1835 |
| 455 | Ga0207640_10007162 | 3300025981 | Bacteria | 6146 |
| 456 | Ga0207640_10044860 | 3300025981 | Bacteria | 2835 |
| 457 | Ga0207640_10124342 | 3300025981 | Bacteria | 1854 |
| 458 | Ga0207640_10299638 | 3300025981 | Bacteria | 1271 |
| 459 | Ga0207658_10228740 | 3300025986 | Bacteria | 1569 |
| 460 | Ga0207677_10000965 | 3300026023 | Bacteria | 15939 |
| 461 | Ga0207677_10001580 | 3300026023 | Bacteria | 12065 |
| 462 | Ga0207677_10004544 | 3300026023 | Bacteria | 7462 |
| 463 | Ga0207677_10006822 | 3300026023 | Bacteria | 6272 |
| 464 | Ga0207677_10179879 | 3300026023 | Unclassified | 1662 |
| 465 | Ga0207677_10206307 | 3300026023 | Bacteria | 1566 |
| 466 | Ga0207703_10001934 | 3300026035 | Bacteria | 18342 |
| 467 | Ga0207703_10003058 | 3300026035 | Bacteria | 14148 |
| 468 | Ga0207703_10004846 | 3300026035 | Bacteria | 10948 |
| 469 | Ga0207703_10005756 | 3300026035 | Bacteria | 9931 |
| 470 | Ga0207703_10014844 | 3300026035 | Bacteria | 6079 |
| 471 | Ga0207703_10043426 | 3300026035 | Bacteria | 3608 |
| 472 | Ga0207639_10040501 | 3300026041 | Bacteria | 3477 |
| 473 | Ga0207639_10089042 | 3300026041 | Unclassified | 2465 |
| 474 | Ga0207639_10093972 | 3300026041 | Bacteria | 2406 |
| 475 | Ga0207678_10000687 | 3300026067 | Bacteria | 30966 |
| 476 | Ga0207708_10006721 | 3300026075 | Bacteria | 8509 |
| 477 | Ga0207708_10026128 | 3300026075 | Bacteria | 4417 |
| 478 | Ga0207702_10005732 | 3300026078 | Bacteria | 10822 |
| 479 | Ga0207702_10011714 | 3300026078 | Bacteria | 7305 |
| 480 | Ga0207702_10027898 | 3300026078 | Bacteria | 4691 |
| 481 | Ga0207702_10047228 | 3300026078 | Bacteria | 3627 |
| 482 | Ga0207702_10447264 | 3300026078 | Bacteria | 1253 |
| 483 | Ga0207641_10000015 | 3300026088 | Bacteria | 321332 |
| 484 | Ga0207641_10000432 | 3300026088 | Bacteria | 48190 |
| 485 | Ga0207641_10008617 | 3300026088 | Bacteria | 8417 |
| 486 | Ga0207641_10123736 | 3300026088 | Bacteria | 2312 |
| 487 | Ga0207648_10001706 | 3300026089 | Bacteria | 24036 |
| 488 | Ga0207648_10066522 | 3300026089 | Bacteria | 3143 |
| 489 | Ga0207648_10078093 | 3300026089 | Bacteria | 2887 |
| 490 | Ga0207676_10000586 | 3300026095 | Bacteria | 29950 |
| 491 | Ga0207676_10002258 | 3300026095 | Bacteria | 13840 |
| 492 | Ga0207676_10474770 | 3300026095 | Bacteria | 1183 |
| 493 | Ga0207674_10000165 | 3300026116 | Bacteria | 79381 |
| 494 | Ga0207674_10001107 | 3300026116 | Bacteria | 35021 |
| 495 | Ga0207674_10015293 | 3300026116 | Bacteria | 8436 |
| 496 | Ga0207675_100068498 | 3300026118 | Bacteria | 3316 |
| 497 | Ga0207675_100077216 | 3300026118 | Bacteria | 3120 |
| 498 | Ga0207675_100169987 | 3300026118 | Bacteria | 2083 |
| 499 | Ga0207675_100513610 | 3300026118 | Unclassified | 1194 |
| 500 | Ga0207683_10004384 | 3300026121 | Bacteria | 12193 |
| 501 | Ga0207683_10016959 | 3300026121 | Bacteria | 6199 |
| 502 | Ga0207698_10009978 | 3300026142 | Bacteria | 6078 |
| 503 | Ga0207698_10105318 | 3300026142 | Bacteria | 2350 |
| 504 | Ga0268265_10005678 | 3300028380 | Bacteria | 8521 |
| 505 | Ga0268264_10005599 | 3300028381 | Bacteria | 10646 |
| 506 | Ga0268264_10009685 | 3300028381 | Bacteria | 7982 |
| 507 | Ga0268264_10032967 | 3300028381 | Bacteria | 4252 |
| 508 | Ga0268264_10063071 | 3300028381 | Bacteria | 3114 |
| 509 | Ga0268264_10125444 | 3300028381 | Bacteria | 2268 |
| 510 | Ga0307515_10000031 | 3300028794 | Bacteria | 358648 |
| 511 | Ga0307515_10000133 | 3300028794 | Bacteria | 176091 |
| 512 | Ga0265338_10052948 | 3300028800 | Bacteria | 3636 |
| 513 | Ga0265762_1003446 | 3300030760 | Bacteria | 2834 |
| 514 | Ga0265760_10007449 | 3300031090 | Bacteria | 3129 |
| 515 | Ga0265760_10008099 | 3300031090 | Bacteria | 3002 |
| 516 | Ga0265760_10016441 | 3300031090 | Bacteria | 2123 |
| 517 | Ga0265325_10001387 | 3300031241 | Bacteria | 17099 |
| 518 | Ga0265325_10027690 | 3300031241 | Bacteria | 3061 |
| 519 | Ga0265339_10004017 | 3300031249 | Bacteria | 10174 |
| 520 | Ga0265339_10016016 | 3300031249 | Bacteria | 4479 |
| 521 | Ga0265331_10014653 | 3300031250 | Bacteria | 4166 |
| 522 | Ga0265316_10006073 | 3300031344 | Bacteria | 11591 |
| 523 | Ga0265316_10011504 | 3300031344 | Bacteria | 7973 |
| 524 | Ga0265316_10015996 | 3300031344 | Bacteria | 6528 |
| 525 | Ga0307509_10044659 | 3300031507 | Bacteria | 4786 |
| 526 | Ga0307408_100022706 | 3300031548 | Bacteria | 4266 |
| 527 | Ga0265313_10005589 | 3300031595 | Bacteria | 9196 |
| 528 | Ga0307508_10004635 | 3300031616 | Bacteria | 13350 |
| 529 | Ga0307514_10019165 | 3300031649 | Bacteria | 5601 |
| 530 | Ga0316575_10008094 | 3300031665 | Bacteria | 3822 |
| 531 | Ga0316579_10003282 | 3300031691 | Bacteria | 6280 |
| 532 | Ga0265314_10001960 | 3300031711 | Bacteria | 21893 |
| 533 | Ga0265314_10005810 | 3300031711 | Bacteria | 11052 |
| 534 | Ga0265314_10138090 | 3300031711 | Bacteria | 1511 |
| 535 | Ga0316576_10031932 | 3300031727 | Bacteria | 3740 |
| 536 | Ga0316578_10099723 | 3300031728 | Unclassified | 1740 |
| 537 | Ga0316577_10123048 | 3300031733 | Unclassified | 1458 |
| 538 | Ga0307410_10024366 | 3300031852 | Bacteria | 3779 |
| 539 | Ga0307407_10061268 | 3300031903 | Bacteria | 2199 |
| 540 | Ga0307409_100000699 | 3300031995 | Bacteria | 14940 |
| 541 | Ga0307416_100023449 | 3300032002 | Bacteria | 4479 |
| 542 | Ga0307411_10003407 | 3300032005 | Bacteria | 7371 |
| 543 | Ga0307411_10011260 | 3300032005 | Bacteria | 4817 |
| 544 | Ga0316583_10021225 | 3300032133 | Unclassified | 2328 |
| 545 | Ga0316585_10005751 | 3300032137 | Bacteria | 3510 |
| 546 | Ga0307510_10004925 | 3300033180 | Bacteria | 15802 |
| 547 | Ga0373934_0027441 | 3300035086 | Bacteria | 2213 |
| 548 | Ga0373936_0085152 | 3300035113 | Bacteria | 1320 |
| 549 | Ga0373956_0007195 | 3300035119 | Bacteria | 4483 |
| 550 | Ga0373956_0025356 | 3300035119 | Bacteria | 2562 |
| 551 | Ga0373943_0082046 | 3300035170 | Bacteria | 1655 |
| 552 | Ga0373943_0211543 | 3300035170 | Bacteria | 1077 |
| 553 | Ga0373955_0023631 | 3300035172 | Bacteria | 3133 |
| 554 | Ga0316574_0082453 | 3300035398 | Unclassified | 2043 |
| 555 | Ga0373931_0033111 | 3300035691 | Bacteria | 2677 |
| 556 | Ga0373931_0091653 | 3300035691 | Bacteria | 1694 |
| 557 | Ga0373935_0005093 | 3300035692 | Bacteria | 7746 |
| 558 | Ga0373927_0043324 | 3300035695 | Bacteria | 2914 |
| 559 | Ga0373927_0162460 | 3300035695 | Bacteria | 1463 |
| 560 | Ga0373927_0227235 | 3300035695 | Bacteria | 1226 |
| 561 | Ga0373933_0000545 | 3300035724 | Bacteria | 23433 |
| 562 | Ga0373947_0227224 | 3300035725 | Unclassified | 1228 |
| 563 | Ga0373937_0000074 | 3300036401 | Bacteria | 91289 |
| 564 | Ga0373937_0000827 | 3300036401 | Bacteria | 26530 |
| 565 | Ga0373937_0013056 | 3300036401 | Bacteria | 7316 |
| 566 | Ga0373937_0128313 | 3300036401 | Bacteria | 2367 |
| 567 | Ga0373937_0180135 | 3300036401 | Bacteria | 1984 |
| 568 | Ga0373937_0388890 | 3300036401 | Bacteria | 1323 |
| 569 | Ga0316582_0061461 | 3300036647 | Unclassified | 2409 |
| 570 | Ga0316582_0096846 | 3300036647 | Bacteria | 1949 |
| 571 | Ga0316584_0044986 | 3300036712 | Unclassified | 3293 |
| 572 | Ga0373925_0003807 | 3300037068 | Bacteria | 11585 |
| 573 | Ga0373925_0079754 | 3300037068 | Bacteria | 2487 |
| 574 | Ga0395899_0002500 | 3300037312 | Bacteria | 14918 |
| 575 | Ga0395899_0071908 | 3300037312 | Bacteria | 2531 |
| 576 | Ga0395900_0006705 | 3300037418 | Bacteria | 11964 |
| 577 | Ga0395900_0041142 | 3300037418 | Bacteria | 4765 |
| 578 | Ga0395898_0001101 | 3300037466 | Bacteria | 41709 |
| 579 | Ga0395901_0022924 | 3300038443 | Bacteria | 6400 |
| 580 | Ga0400489_01028 | 3300039093 | Bacteria | 1027 |
| 581 | Ga0436365_0595099 | 3300039437 | Bacteria | 1447 |
| 582 | Ga0439445_0007815 | 3300042004 | Bacteria | 2491 |
| 583 | Ga0451577_0022384 | 3300042876 | Bacteria | 5770 |
| 584 | Ga0451577_0155216 | 3300042876 | Bacteria | 2060 |
| 585 | Ga0451577_0202955 | 3300042876 | Bacteria | 1790 |
| 586 | Ga0466963_0222045 | 3300044694 | Unclassified | 1323 |
| 587 | Ga0453684_0007454 | 3300044712 | Bacteria | 20093 |
| 588 | Ga0466957_0022232 | 3300044842 | Bacteria | 3739 |
| 589 | Ga0466957_0225036 | 3300044842 | Unclassified | 1240 |
| 590 | Ga0466959_0004141 | 3300045049 | Bacteria | 9660 |
| 591 | Ga0466959_0104947 | 3300045049 | Bacteria | 2021 |
| 592 | Ga0451576_0003645 | 3300045051 | Bacteria | 20903 |
| 593 | Ga0451576_0015526 | 3300045051 | Bacteria | 8431 |
| 594 | Ga0451576_0059225 | 3300045051 | Bacteria | 3999 |
| 595 | Ga0451576_0161748 | 3300045051 | Bacteria | 2337 |
| 596 | Ga0451576_0170572 | 3300045051 | Unclassified | 2271 |
| 597 | Ga0466958_0020168 | 3300045836 | Bacteria | 3886 |
| 598 | Ga0466967_0032255 | 3300045976 | Unclassified | 4421 |
| 599 | Ga0466967_0045037 | 3300045976 | Bacteria | 3832 |
| 600 | Ga0466967_0052110 | 3300045976 | Bacteria | 3590 |
| 601 | Ga0466967_0201009 | 3300045976 | Unclassified | 1887 |
| 602 | Ga0466967_0302039 | 3300045976 | Bacteria | 1540 |
| 603 | Ga0495651_0001464 | 3300046462 | Bacteria | 18261 |
| 604 | Ga0495651_0176196 | 3300046462 | Bacteria | 1518 |
| 605 | Ga0495653_0045441 | 3300046463 | Bacteria | 3405 |
| 606 | Ga0495580_0000223 | 3300046472 | Bacteria | 44018 |
| 607 | Ga0495580_0002222 | 3300046472 | Bacteria | 16974 |
| 608 | Ga0495580_0012137 | 3300046472 | Bacteria | 6626 |
| 609 | Ga0495580_0037632 | 3300046472 | Bacteria | 3470 |
| 610 | Ga0495580_0037850 | 3300046472 | Bacteria | 3459 |
| 611 | Ga0495580_0043029 | 3300046472 | Bacteria | 3215 |
| 612 | Ga0495580_0085538 | 3300046472 | Bacteria | 2196 |
| 613 | Ga0495582_0010349 | 3300046473 | Bacteria | 5132 |
| 614 | Ga0495594_0072602 | 3300046499 | Bacteria | 1915 |
| 615 | Ga0495606_0037411 | 3300046507 | Bacteria | 3297 |
| 616 | Ga0495608_0106130 | 3300046511 | Bacteria | 1808 |
| 617 | Ga0495652_0135735 | 3300046529 | Bacteria | 1941 |
| 618 | Ga0495665_0008695 | 3300046531 | Bacteria | 5512 |
| 619 | Ga0495586_0082604 | 3300046535 | Bacteria | 1767 |
| 620 | Ga0495587_0000113 | 3300046536 | Bacteria | 61684 |
| 621 | Ga0495645_0013197 | 3300046543 | Bacteria | 5842 |
| 622 | Ga0495667_0095675 | 3300046559 | Unclassified | 1923 |
| 623 | Ga0495667_0117257 | 3300046559 | Bacteria | 1720 |
| 624 | Ga0495634_0112444 | 3300046642 | Bacteria | 1750 |
| 625 | Ga0495625_0064441 | 3300046660 | Bacteria | 2585 |
| 626 | Ga0495599_0336704 | 3300046678 | Bacteria | 906 |
| 627 | Ga0495623_0064847 | 3300046679 | Bacteria | 2285 |
| 628 | Ga0495647_0006947 | 3300046681 | Bacteria | 3771 |
| 629 | Ga0495658_0034724 | 3300046683 | Bacteria | 2769 |
| 630 | Ga0495669_0038467 | 3300046684 | Bacteria | 2119 |
| 631 | Ga0495669_0135431 | 3300046684 | Bacteria | 1161 |
| 632 | Ga0495669_0150902 | 3300046684 | Bacteria | 1100 |
| 633 | Ga0495649_0004267 | 3300046694 | Bacteria | 9378 |
| 634 | Ga0495604_0021951 | 3300047317 | Bacteria | 5095 |
| 635 | Ga0495680_0079534 | 3300047322 | Bacteria | 2479 |
| 636 | Ga0495675_0000317 | 3300047444 | Bacteria | 34404 |
| 637 | Ga0495686_0000473 | 3300047472 | Bacteria | 59965 |
| 638 | Ga0495602_0000069 | 3300048088 | Bacteria | 101160 |
| 639 | Ga0495602_0107559 | 3300048088 | Unclassified | 2273 |
| 640 | Ga0496100_0069823 | 3300048903 | Bacteria | 2341 |
| 641 | Ga0496102_0074118 | 3300048905 | Bacteria | 3129 |
| 642 | Ga0496102_0075100 | 3300048905 | Bacteria | 3107 |
| 643 | Ga0496102_0145760 | 3300048905 | Bacteria | 2222 |
| 644 | Ga0496102_0241491 | 3300048905 | Bacteria | 1703 |
| 645 | Ga0496103_0005215 | 3300048906 | Bacteria | 7808 |
| 646 | Ga0496104_0109708 | 3300048907 | Bacteria | 2645 |
| 647 | Ga0496105_0013709 | 3300048908 | Bacteria | 6436 |
| 648 | Ga0496105_0060775 | 3300048908 | Bacteria | 3118 |
| 649 | Ga0496108_0000228 | 3300048911 | Bacteria | 50279 |
| 650 | Ga0496109_0000362 | 3300048912 | Bacteria | 42175 |
| 651 | Ga0496110_0012685 | 3300048913 | Bacteria | 6935 |
| 652 | Ga0496110_0137359 | 3300048913 | Unclassified | 2209 |
| 653 | Ga0496111_0001468 | 3300048914 | Bacteria | 13488 |
| 654 | Ga0496111_0028145 | 3300048914 | Bacteria | 3981 |
| 655 | Ga0496111_0346327 | 3300048914 | Unclassified | 1100 |
| 656 | Ga0496112_0000034 | 3300048915 | Bacteria | 107237 |
| 657 | Ga0496112_0003539 | 3300048915 | Bacteria | 12966 |
| 658 | Ga0496112_0035814 | 3300048915 | Bacteria | 4837 |
| 659 | Ga0496112_0038831 | 3300048915 | Bacteria | 4651 |
| 660 | Ga0496112_0047241 | 3300048915 | Unclassified | 4223 |
| 661 | Ga0496112_0066889 | 3300048915 | Bacteria | 3546 |
| 662 | Ga0496112_0081759 | 3300048915 | Bacteria | 3195 |
| 663 | Ga0496112_0101844 | 3300048915 | Unclassified | 2842 |
| 664 | Ga0496113_0000391 | 3300048916 | Bacteria | 21186 |
| 665 | Ga0496113_0448522 | 3300048916 | Unclassified | 1036 |
| 666 | Ga0496115_0101896 | 3300048918 | Bacteria | 2354 |
| 667 | Ga0496115_0197690 | 3300048918 | Unclassified | 1661 |
| 668 | Ga0501034_0024828 | 3300049571 | Bacteria | 6098 |
| 669 | Ga0501038_0121881 | 3300049574 | Bacteria | 2149 |
| 670 | Ga0501076_0202829 | 3300049592 | Bacteria | 1620 |
| 671 | Ga0501044_0181513 | 3300049823 | Bacteria | 2071 |
| 672 | nmdc:mga0k408_7554_c1 | 3300050493 | Bacteria | 5806 |
| 673 | nmdc:mga0n895_15786_c1 | 3300050512 | Bacteria | 6904 |
| 674 | nmdc:mga0n895_3115_c1 | 3300050512 | Bacteria | 13216 |
| 675 | nmdc:mga0n895_327185_c1 | 3300050512 | Bacteria | 1553 |
| 676 | nmdc:mga0n895_6567_c1 | 3300050512 | Bacteria | 9899 |
| 677 | nmdc:mga0rr50_1398_c1 | 3300050513 | Bacteria | 13221 |
| 678 | nmdc:mga0rr50_511127_c1 | 3300050513 | Unclassified | 1022 |
| 679 | nmdc:mga08x19_17986_c1 | 3300050514 | Unclassified | 4329 |
| 680 | nmdc:mga08x19_185975_c1 | 3300050514 | Bacteria | 1420 |
| 681 | nmdc:mga08x19_46063_c1 | 3300050514 | Unclassified | 2788 |
| 682 | nmdc:mga08x19_5765_c1 | 3300050514 | Bacteria | 7323 |
| 683 | nmdc:mga08x19_9044_c1 | 3300050514 | Bacteria | 5946 |
| 684 | nmdc:mga0a205_1031_c1 | 3300050515 | Bacteria | 15759 |
| 685 | nmdc:mga0a205_493912_c1 | 3300050515 | Unclassified | 1081 |
| 686 | Ga0495601_0037734 | 3300053077 | Unclassified | 3020 |
| 687 | Ga0466962_0051791 | 3300061719 | Bacteria | 1963 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037312 | Ga0395899_0071908 | Ga0395899_0071908_1612_2514 | 268 |
| 2 | 3300046678 | Ga0495599_0336704 | Ga0495599_0336704_25_879 | 281 |
| 3 | 3300048915 | Ga0496112_0081759 | Ga0496112_0081759_41_910 | 283 |
| 4 | 3300005530 | Ga0070679_100002354 | Ga0070679_10000235412 | 284 |
| 5 | 3300025921 | Ga0207652_10000098 | Ga0207652_1000009876 | 284 |
| 6 | 3300037312 | Ga0395899_0002500 | Ga0395899_0002500_1857_2819 | 284 |
| 7 | 3300037418 | Ga0395900_0006705 | Ga0395900_0006705_8340_9302 | 284 |
| 8 | 3300037418 | Ga0395900_0041142 | Ga0395900_0041142_1116_2078 | 284 |
| 9 | 3300037466 | Ga0395898_0001101 | Ga0395898_0001101_10008_10970 | 284 |
| 10 | 3300038443 | Ga0395901_0022924 | Ga0395901_0022924_2635_3597 | 284 |
| 11 | 3300048918 | Ga0496115_0197690 | Ga0496115_0197690_38_907 | 285 |
| 12 | 3300037068 | Ga0373925_0079754 | Ga0373925_0079754_1571_2470 | 296 |
| 13 | 3300025938 | Ga0207704_10222833 | Ga0207704_102228331 | 302 |
| 14 | 3300035695 | Ga0373927_0162460 | Ga0373927_0162460_520_1443 | 304 |
| 15 | 3300005456 | Ga0070678_100111458 | Ga0070678_1001114581 | 305 |
| 16 | 3300025931 | Ga0207644_10276281 | Ga0207644_102762812 | 305 |
| 17 | 3300025940 | Ga0207691_10015832 | Ga0207691_100158323 | 305 |
| 18 | 3300006237 | Ga0097621_100005119 | Ga0097621_10000511911 | 306 |
| 19 | 3300006358 | Ga0068871_100027840 | Ga0068871_1000278402 | 306 |
| 20 | 3300013297 | Ga0157378_10037172 | Ga0157378_100371722 | 306 |
| 21 | 3300014969 | Ga0157376_10002166 | Ga0157376_100021661 | 306 |
| 22 | 3300005435 | Ga0070714_100105981 | Ga0070714_1001059812 | 307 |
| 23 | 3300005439 | Ga0070711_100127600 | Ga0070711_1001276001 | 307 |
| 24 | 3300005578 | Ga0068854_100090550 | Ga0068854_1000905503 | 307 |
| 25 | 3300006237 | Ga0097621_100188313 | Ga0097621_1001883132 | 307 |
| 26 | 3300006358 | Ga0068871_100130163 | Ga0068871_1001301632 | 307 |
| 27 | 3300009174 | Ga0105241_10040079 | Ga0105241_100400792 | 307 |
| 28 | 3300009545 | Ga0105237_10027686 | Ga0105237_100276864 | 307 |
| 29 | 3300010375 | Ga0105239_10557092 | Ga0105239_105570921 | 307 |
| 30 | 3300013104 | Ga0157370_10141257 | Ga0157370_101412572 | 307 |
| 31 | 3300013105 | Ga0157369_10066644 | Ga0157369_100666442 | 307 |
| 32 | 3300013296 | Ga0157374_10167999 | Ga0157374_101679992 | 307 |
| 33 | 3300013307 | Ga0157372_10208841 | Ga0157372_102088412 | 307 |
| 34 | 3300025911 | Ga0207654_10018281 | Ga0207654_100182812 | 307 |
| 35 | 3300025914 | Ga0207671_10042066 | Ga0207671_100420662 | 307 |
| 36 | 3300026078 | Ga0207702_10047228 | Ga0207702_100472282 | 307 |
| 37 | 3300048915 | Ga0496112_0066889 | Ga0496112_0066889_152_1132 | 307 |
| 38 | 3300031665 | Ga0316575_10008094 | Ga0316575_100080945 | 308 |
| 39 | 3300031691 | Ga0316579_10003282 | Ga0316579_100032825 | 308 |
| 40 | 3300031727 | Ga0316576_10031932 | Ga0316576_100319325 | 308 |
| 41 | 3300031728 | Ga0316578_10099723 | Ga0316578_100997231 | 308 |
| 42 | 3300032133 | Ga0316583_10021225 | Ga0316583_100212253 | 308 |
| 43 | 3300032137 | Ga0316585_10005751 | Ga0316585_100057514 | 308 |
| 44 | 3300035398 | Ga0316574_0082453 | Ga0316574_0082453_611_1588 | 308 |
| 45 | 3300036647 | Ga0316582_0061461 | Ga0316582_0061461_149_1126 | 308 |
| 46 | 3300036712 | Ga0316584_0044986 | Ga0316584_0044986_2173_3150 | 308 |
| 47 | 3300005530 | Ga0070679_100182384 | Ga0070679_1001823842 | 310 |
| 48 | 3300005546 | Ga0070696_100134052 | Ga0070696_1001340521 | 310 |
| 49 | 3300006871 | Ga0075434_100567561 | Ga0075434_1005675612 | 311 |
| 50 | 3300035695 | Ga0373927_0043324 | Ga0373927_0043324_713_1693 | 311 |
| 51 | 3300046472 | Ga0495580_0037850 | Ga0495580_0037850_1087_2067 | 311 |
| 52 | 3300050512 | nmdc:mga0n895_327185_c1 | nmdc:mga0n895_327185_c1_450_1415 | 311 |
| 53 | 3300003316 | rootH1_10087392 | rootH1_100873924 | 312 |
| 54 | 3300005467 | Ga0070706_100307884 | Ga0070706_1003078842 | 312 |
| 55 | 3300010375 | Ga0105239_10071172 | Ga0105239_100711723 | 312 |
| 56 | 3300046507 | Ga0495606_0037411 | Ga0495606_0037411_1236_2222 | 312 |
| 57 | 3300046642 | Ga0495634_0112444 | Ga0495634_0112444_300_1256 | 312 |
| 58 | 3300046694 | Ga0495649_0004267 | Ga0495649_0004267_5953_6939 | 312 |
| 59 | iso_pu_bacteria | 2919138771 | 2919139599 | 312 |
| 60 | 3300006852 | Ga0075433_10201290 | Ga0075433_102012901 | 313 |
| 61 | 3300009177 | Ga0105248_10029115 | Ga0105248_100291153 | 313 |
| 62 | 3300014325 | Ga0163163_10310268 | Ga0163163_103102682 | 313 |
| 63 | 3300025934 | Ga0207686_10081199 | Ga0207686_100811992 | 313 |
| 64 | 3300035113 | Ga0373936_0085152 | Ga0373936_0085152_253_1212 | 313 |
| 65 | 3300035170 | Ga0373943_0211543 | Ga0373943_0211543_100_1062 | 313 |
| 66 | 3300036401 | Ga0373937_0388890 | Ga0373937_0388890_225_1187 | 313 |
| 67 | 3300042876 | Ga0451577_0155216 | Ga0451577_0155216_611_1570 | 313 |
| 68 | 3300042876 | Ga0451577_0202955 | Ga0451577_0202955_52_1020 | 313 |
| 69 | 3300044712 | Ga0453684_0007454 | Ga0453684_0007454_5085_6083 | 313 |
| 70 | 3300045051 | Ga0451576_0003645 | Ga0451576_0003645_6756_7715 | 313 |
| 71 | 3300045051 | Ga0451576_0059225 | Ga0451576_0059225_1575_2543 | 313 |
| 72 | 3300045051 | Ga0451576_0170572 | Ga0451576_0170572_19_978 | 313 |
| 73 | 3300046535 | Ga0495586_0082604 | Ga0495586_0082604_516_1478 | 313 |
| 74 | 3300046683 | Ga0495658_0034724 | Ga0495658_0034724_621_1583 | 313 |
| 75 | 3300047322 | Ga0495680_0079534 | Ga0495680_0079534_1138_2100 | 313 |
| 76 | 3300003320 | rootH2_10017798 | rootH2_1001779811 | 314 |
| 77 | 3300005331 | Ga0070670_100098527 | Ga0070670_1000985271 | 314 |
| 78 | 3300005335 | Ga0070666_10000112 | Ga0070666_1000011211 | 314 |
| 79 | 3300005338 | Ga0068868_100008985 | Ga0068868_1000089852 | 314 |
| 80 | 3300005341 | Ga0070691_10018185 | Ga0070691_100181852 | 314 |
| 81 | 3300005365 | Ga0070688_100254182 | Ga0070688_1002541821 | 314 |
| 82 | 3300005367 | Ga0070667_100017599 | Ga0070667_1000175994 | 314 |
| 83 | 3300005466 | Ga0070685_10088377 | Ga0070685_100883771 | 314 |
| 84 | 3300005536 | Ga0070697_100040698 | Ga0070697_1000406984 | 314 |
| 85 | 3300005616 | Ga0068852_100005128 | Ga0068852_1000051282 | 314 |
| 86 | 3300005616 | Ga0068852_100394460 | Ga0068852_1003944602 | 314 |
| 87 | 3300005617 | Ga0068859_100000018 | Ga0068859_10000001855 | 314 |
| 88 | 3300005618 | Ga0068864_100002226 | Ga0068864_10000222613 | 314 |
| 89 | 3300005618 | Ga0068864_100026453 | Ga0068864_1000264536 | 314 |
| 90 | 3300005719 | Ga0068861_100404971 | Ga0068861_1004049711 | 314 |
| 91 | 3300005834 | Ga0068851_10078344 | Ga0068851_100783442 | 314 |
| 92 | 3300005834 | Ga0068851_10094974 | Ga0068851_100949742 | 314 |
| 93 | 3300005841 | Ga0068863_100005189 | Ga0068863_10000518911 | 314 |
| 94 | 3300005842 | Ga0068858_100002919 | Ga0068858_1000029192 | 314 |
| 95 | 3300006237 | Ga0097621_100179945 | Ga0097621_1001799452 | 314 |
| 96 | 3300006931 | Ga0097620_100000018 | Ga0097620_10000001855 | 314 |
| 97 | 3300009098 | Ga0105245_10199370 | Ga0105245_101993702 | 314 |
| 98 | 3300009101 | Ga0105247_10005382 | Ga0105247_100053822 | 314 |
| 99 | 3300009174 | Ga0105241_10001966 | Ga0105241_1000196614 | 314 |
| 100 | 3300009174 | Ga0105241_10127828 | Ga0105241_101278282 | 314 |
| 101 | 3300009545 | Ga0105237_10002252 | Ga0105237_1000225215 | 314 |
| 102 | 3300009545 | Ga0105237_10003222 | Ga0105237_100032223 | 314 |
| 103 | 3300009553 | Ga0105249_10005930 | Ga0105249_100059303 | 314 |
| 104 | 3300009553 | Ga0105249_10504310 | Ga0105249_105043102 | 314 |
| 105 | 3300010375 | Ga0105239_10097035 | Ga0105239_100970352 | 314 |
| 106 | 3300011119 | Ga0105246_10199382 | Ga0105246_101993822 | 314 |
| 107 | 3300013297 | Ga0157378_10018115 | Ga0157378_100181156 | 314 |
| 108 | 3300013306 | Ga0163162_10001107 | Ga0163162_1000110710 | 314 |
| 109 | 3300014968 | Ga0157379_10248894 | Ga0157379_102488942 | 314 |
| 110 | 3300025321 | Ga0207656_10064673 | Ga0207656_100646731 | 314 |
| 111 | 3300025900 | Ga0207710_10004125 | Ga0207710_100041252 | 314 |
| 112 | 3300025903 | Ga0207680_10000193 | Ga0207680_100001932 | 314 |
| 113 | 3300025911 | Ga0207654_10001980 | Ga0207654_1000198011 | 314 |
| 114 | 3300025911 | Ga0207654_10130020 | Ga0207654_101300201 | 314 |
| 115 | 3300025914 | Ga0207671_10001799 | Ga0207671_100017999 | 314 |
| 116 | 3300025914 | Ga0207671_10009175 | Ga0207671_100091751 | 314 |
| 117 | 3300025924 | Ga0207694_10113525 | Ga0207694_101135252 | 314 |
| 118 | 3300025935 | Ga0207709_10182258 | Ga0207709_101822581 | 314 |
| 119 | 3300025942 | Ga0207689_10003649 | Ga0207689_100036493 | 314 |
| 120 | 3300025961 | Ga0207712_10026102 | Ga0207712_100261023 | 314 |
| 121 | 3300026023 | Ga0207677_10004544 | Ga0207677_100045445 | 314 |
| 122 | 3300026023 | Ga0207677_10206307 | Ga0207677_102063072 | 314 |
| 123 | 3300026035 | Ga0207703_10001934 | Ga0207703_100019342 | 314 |
| 124 | 3300026035 | Ga0207703_10043426 | Ga0207703_100434263 | 314 |
| 125 | 3300026088 | Ga0207641_10000015 | Ga0207641_1000001550 | 314 |
| 126 | 3300026118 | Ga0207675_100169987 | Ga0207675_1001699872 | 314 |
| 127 | 3300026142 | Ga0207698_10009978 | Ga0207698_100099786 | 314 |
| 128 | 3300028381 | Ga0268264_10009685 | Ga0268264_100096854 | 314 |
| 129 | 3300028794 | Ga0307515_10000031 | Ga0307515_10000031213 | 314 |
| 130 | 3300031507 | Ga0307509_10044659 | Ga0307509_100446593 | 314 |
| 131 | 3300031616 | Ga0307508_10004635 | Ga0307508_1000463510 | 314 |
| 132 | 3300033180 | Ga0307510_10004925 | Ga0307510_100049257 | 314 |
| 133 | 3300042004 | Ga0439445_0007815 | Ga0439445_0007815_1422_2396 | 314 |
| 134 | 3300045051 | Ga0451576_0015526 | Ga0451576_0015526_6501_7469 | 314 |
| 135 | 3300045051 | Ga0451576_0161748 | Ga0451576_0161748_941_1909 | 314 |
| 136 | 3300046660 | Ga0495625_0064441 | Ga0495625_0064441_817_1782 | 314 |
| 137 | 3300049571 | Ga0501034_0024828 | Ga0501034_0024828_4363_5325 | 314 |
| 138 | 3300049574 | Ga0501038_0121881 | Ga0501038_0121881_420_1391 | 314 |
| 139 | 3300005328 | Ga0070676_10103438 | Ga0070676_101034382 | 315 |
| 140 | 3300005335 | Ga0070666_10194478 | Ga0070666_101944782 | 315 |
| 141 | 3300005366 | Ga0070659_100110688 | Ga0070659_1001106883 | 315 |
| 142 | 3300005439 | Ga0070711_100008817 | Ga0070711_1000088173 | 315 |
| 143 | 3300005441 | Ga0070700_100034036 | Ga0070700_1000340363 | 315 |
| 144 | 3300005445 | Ga0070708_100044873 | Ga0070708_1000448732 | 315 |
| 145 | 3300005456 | Ga0070678_100020672 | Ga0070678_1000206722 | 315 |
| 146 | 3300005459 | Ga0068867_100098863 | Ga0068867_1000988632 | 315 |
| 147 | 3300005539 | Ga0068853_100157184 | Ga0068853_1001571842 | 315 |
| 148 | 3300005548 | Ga0070665_100154251 | Ga0070665_1001542513 | 315 |
| 149 | 3300005617 | Ga0068859_100251227 | Ga0068859_1002512272 | 315 |
| 150 | 3300005618 | Ga0068864_100035311 | Ga0068864_1000353113 | 315 |
| 151 | 3300005719 | Ga0068861_100515472 | Ga0068861_1005154721 | 315 |
| 152 | 3300005840 | Ga0068870_10108856 | Ga0068870_101088562 | 315 |
| 153 | 3300005843 | Ga0068860_100048179 | Ga0068860_1000481793 | 315 |
| 154 | 3300005844 | Ga0068862_100413965 | Ga0068862_1004139652 | 315 |
| 155 | 3300006195 | Ga0075366_10008292 | Ga0075366_100082924 | 315 |
| 156 | 3300006871 | Ga0075434_100013728 | Ga0075434_1000137287 | 315 |
| 157 | 3300006881 | Ga0068865_100059521 | Ga0068865_1000595214 | 315 |
| 158 | 3300006914 | Ga0075436_100012670 | Ga0075436_1000126702 | 315 |
| 159 | 3300006931 | Ga0097620_100251243 | Ga0097620_1002512432 | 315 |
| 160 | 3300009094 | Ga0111539_10209782 | Ga0111539_102097824 | 315 |
| 161 | 3300013306 | Ga0163162_10036746 | Ga0163162_100367465 | 315 |
| 162 | 3300014326 | Ga0157380_10086862 | Ga0157380_100868622 | 315 |
| 163 | 3300025901 | Ga0207688_10009395 | Ga0207688_100093956 | 315 |
| 164 | 3300025908 | Ga0207643_10006921 | Ga0207643_100069212 | 315 |
| 165 | 3300025910 | Ga0207684_10054018 | Ga0207684_100540183 | 315 |
| 166 | 3300025933 | Ga0207706_10014413 | Ga0207706_100144137 | 315 |
| 167 | 3300025938 | Ga0207704_10256779 | Ga0207704_102567792 | 315 |
| 168 | 3300025940 | Ga0207691_10000312 | Ga0207691_1000031210 | 315 |
| 169 | 3300025942 | Ga0207689_10048022 | Ga0207689_100480225 | 315 |
| 170 | 3300025986 | Ga0207658_10228740 | Ga0207658_102287402 | 315 |
| 171 | 3300026075 | Ga0207708_10006721 | Ga0207708_100067212 | 315 |
| 172 | 3300026089 | Ga0207648_10078093 | Ga0207648_100780932 | 315 |
| 173 | 3300026095 | Ga0207676_10474770 | Ga0207676_104747701 | 315 |
| 174 | 3300026118 | Ga0207675_100077216 | Ga0207675_1000772164 | 315 |
| 175 | 3300026121 | Ga0207683_10016959 | Ga0207683_100169592 | 315 |
| 176 | 3300028381 | Ga0268264_10125444 | Ga0268264_101254443 | 315 |
| 177 | 3300028794 | Ga0307515_10000133 | Ga0307515_1000013387 | 315 |
| 178 | 3300031649 | Ga0307514_10019165 | Ga0307514_100191654 | 315 |
| 179 | 3300049592 | Ga0501076_0202829 | Ga0501076_0202829_321_1274 | 315 |
| 180 | 3300050493 | nmdc:mga0k408_7554_c1 | nmdc:mga0k408_7554_c1_2498_3475 | 315 |
| 181 | 3300005445 | Ga0070708_100004387 | Ga0070708_1000043877 | 316 |
| 182 | 3300005445 | Ga0070708_100060491 | Ga0070708_1000604912 | 316 |
| 183 | 3300005467 | Ga0070706_100004518 | Ga0070706_1000045187 | 316 |
| 184 | 3300005467 | Ga0070706_100007965 | Ga0070706_1000079653 | 316 |
| 185 | 3300005467 | Ga0070706_100151444 | Ga0070706_1001514442 | 316 |
| 186 | 3300005468 | Ga0070707_100010330 | Ga0070707_1000103308 | 316 |
| 187 | 3300005471 | Ga0070698_100000039 | Ga0070698_10000003911 | 316 |
| 188 | 3300005471 | Ga0070698_100042796 | Ga0070698_1000427963 | 316 |
| 189 | 3300005536 | Ga0070697_100067209 | Ga0070697_1000672092 | 316 |
| 190 | 3300006844 | Ga0075428_100002512 | Ga0075428_1000025125 | 316 |
| 191 | 3300025910 | Ga0207684_10000457 | Ga0207684_100004573 | 316 |
| 192 | 3300025922 | Ga0207646_10013710 | Ga0207646_100137105 | 316 |
| 193 | 3300031733 | Ga0316577_10123048 | Ga0316577_101230481 | 316 |
| 194 | 3300036647 | Ga0316582_0096846 | Ga0316582_0096846_434_1435 | 316 |
| 195 | 3300042876 | Ga0451577_0022384 | Ga0451577_0022384_2176_3144 | 316 |
| 196 | 3300046472 | Ga0495580_0012137 | Ga0495580_0012137_743_1702 | 316 |
| 197 | 3300046472 | Ga0495580_0037632 | Ga0495580_0037632_2323_3282 | 316 |
| 198 | 3300046473 | Ga0495582_0010349 | Ga0495582_0010349_1646_2605 | 316 |
| 199 | 3300046681 | Ga0495647_0006947 | Ga0495647_0006947_1099_2058 | 316 |
| 200 | 3300049823 | Ga0501044_0181513 | Ga0501044_0181513_233_1216 | 316 |
| 201 | 3300005435 | Ga0070714_100413684 | Ga0070714_1004136841 | 317 |
| 202 | 3300005436 | Ga0070713_100061504 | Ga0070713_1000615041 | 317 |
| 203 | 3300005445 | Ga0070708_100085848 | Ga0070708_1000858483 | 317 |
| 204 | 3300005518 | Ga0070699_100096724 | Ga0070699_1000967242 | 317 |
| 205 | 3300009093 | Ga0105240_10019633 | Ga0105240_100196339 | 317 |
| 206 | 3300025906 | Ga0207699_10201656 | Ga0207699_102016561 | 317 |
| 207 | 3300025922 | Ga0207646_10191675 | Ga0207646_101916752 | 317 |
| 208 | 3300031090 | Ga0265760_10007449 | Ga0265760_100074493 | 317 |
| 209 | 3300031090 | Ga0265760_10016441 | Ga0265760_100164412 | 317 |
| 210 | 3300031241 | Ga0265325_10001387 | Ga0265325_100013877 | 317 |
| 211 | 3300031241 | Ga0265325_10027690 | Ga0265325_100276903 | 317 |
| 212 | 3300031250 | Ga0265331_10014653 | Ga0265331_100146534 | 317 |
| 213 | 3300031344 | Ga0265316_10011504 | Ga0265316_100115046 | 317 |
| 214 | 3300031595 | Ga0265313_10005589 | Ga0265313_100055893 | 317 |
| 215 | 3300035119 | Ga0373956_0007195 | Ga0373956_0007195_812_1912 | 317 |
| 216 | 3300035172 | Ga0373955_0023631 | Ga0373955_0023631_1439_2539 | 317 |
| 217 | 3300035724 | Ga0373933_0000545 | Ga0373933_0000545_6617_7717 | 317 |
| 218 | 3300036401 | Ga0373937_0000074 | Ga0373937_0000074_63948_64958 | 317 |
| 219 | 3300039093 | Ga0400489_01028 | Ga0400489_01028_16_975 | 317 |
| 220 | 3300046462 | Ga0495651_0001464 | Ga0495651_0001464_14636_15646 | 317 |
| 221 | 3300046463 | Ga0495653_0045441 | Ga0495653_0045441_1430_2440 | 317 |
| 222 | 3300046511 | Ga0495608_0106130 | Ga0495608_0106130_228_1238 | 317 |
| 223 | 3300046536 | Ga0495587_0000113 | Ga0495587_0000113_4253_5263 | 317 |
| 224 | 3300047317 | Ga0495604_0021951 | Ga0495604_0021951_3211_4311 | 317 |
| 225 | 3300047444 | Ga0495675_0000317 | Ga0495675_0000317_6093_7103 | 317 |
| 226 | 3300047472 | Ga0495686_0000473 | Ga0495686_0000473_29691_30665 | 317 |
| 227 | 3300048088 | Ga0495602_0000069 | Ga0495602_0000069_33622_34722 | 317 |
| 228 | 3300053077 | Ga0495601_0037734 | Ga0495601_0037734_220_1209 | 317 |
| 229 | 3300005458 | Ga0070681_10212467 | Ga0070681_102124671 | 320 |
| 230 | 3300025917 | Ga0207660_10190271 | Ga0207660_101902712 | 320 |
| 231 | 3300044842 | Ga0466957_0022232 | Ga0466957_0022232_1492_2454 | 320 |
| 232 | 3300003322 | rootL2_10180054 | rootL2_101800541 | 321 |
| 233 | 3300005435 | Ga0070714_100059609 | Ga0070714_1000596093 | 321 |
| 234 | 3300005458 | Ga0070681_10187229 | Ga0070681_101872291 | 321 |
| 235 | 3300005548 | Ga0070665_100443517 | Ga0070665_1004435171 | 321 |
| 236 | 3300006914 | Ga0075436_100001773 | Ga0075436_1000017735 | 321 |
| 237 | 3300013307 | Ga0157372_10358666 | Ga0157372_103586661 | 321 |
| 238 | 3300013307 | Ga0157372_10589640 | Ga0157372_105896401 | 321 |
| 239 | 3300025926 | Ga0207659_10006779 | Ga0207659_100067796 | 321 |
| 240 | 3300025929 | Ga0207664_10084133 | Ga0207664_100841332 | 321 |
| 241 | 3300035725 | Ga0373947_0227224 | Ga0373947_0227224_100_1065 | 321 |
| 242 | 3300050514 | nmdc:mga08x19_5765_c1 | nmdc:mga08x19_5765_c1_645_1610 | 321 |
| 243 | 3300005293 | Ga0065715_10151838 | Ga0065715_101518382 | 322 |
| 244 | 3300005337 | Ga0070682_100060727 | Ga0070682_1000607273 | 322 |
| 245 | 3300005355 | Ga0070671_100145196 | Ga0070671_1001451962 | 322 |
| 246 | 3300005439 | Ga0070711_100013799 | Ga0070711_1000137993 | 322 |
| 247 | 3300005458 | Ga0070681_10111751 | Ga0070681_101117513 | 322 |
| 248 | 3300005535 | Ga0070684_100026321 | Ga0070684_1000263215 | 322 |
| 249 | 3300005577 | Ga0068857_100418012 | Ga0068857_1004180121 | 322 |
| 250 | 3300005614 | Ga0068856_100083869 | Ga0068856_1000838692 | 322 |
| 251 | 3300006163 | Ga0070715_10125253 | Ga0070715_101252531 | 322 |
| 252 | 3300006175 | Ga0070712_100099225 | Ga0070712_1000992253 | 322 |
| 253 | 3300009098 | Ga0105245_10003176 | Ga0105245_100031766 | 322 |
| 254 | 3300025915 | Ga0207693_10034746 | Ga0207693_100347463 | 322 |
| 255 | 3300025916 | Ga0207663_10023888 | Ga0207663_100238883 | 322 |
| 256 | 3300025927 | Ga0207687_10001854 | Ga0207687_100018548 | 322 |
| 257 | 3300025939 | Ga0207665_10032359 | Ga0207665_100323592 | 322 |
| 258 | 3300025944 | Ga0207661_10255183 | Ga0207661_102551831 | 322 |
| 259 | 3300025949 | Ga0207667_10067837 | Ga0207667_100678372 | 322 |
| 260 | 3300025981 | Ga0207640_10044860 | Ga0207640_100448604 | 322 |
| 261 | 3300035119 | Ga0373956_0025356 | Ga0373956_0025356_1145_2122 | 322 |
| 262 | 3300046529 | Ga0495652_0135735 | Ga0495652_0135735_72_1049 | 322 |
| 263 | 3300046559 | Ga0495667_0117257 | Ga0495667_0117257_608_1585 | 322 |
| 264 | 3300046684 | Ga0495669_0150902 | Ga0495669_0150902_73_1062 | 323 |
| 265 | 3300048088 | Ga0495602_0107559 | Ga0495602_0107559_537_1550 | 323 |
| 266 | 3300031344 | Ga0265316_10006073 | Ga0265316_1000607311 | 326 |
| 267 | 3300031711 | Ga0265314_10001960 | Ga0265314_1000196012 | 326 |
| 268 | 3300045976 | Ga0466967_0052110 | Ga0466967_0052110_1551_2531 | 326 |
| 269 | 3300005434 | Ga0070709_10012407 | Ga0070709_100124076 | 327 |
| 270 | 3300005437 | Ga0070710_10160127 | Ga0070710_101601271 | 327 |
| 271 | 3300005439 | Ga0070711_100227844 | Ga0070711_1002278442 | 327 |
| 272 | 3300006871 | Ga0075434_100000303 | Ga0075434_10000030325 | 327 |
| 273 | 3300006914 | Ga0075436_100022740 | Ga0075436_1000227403 | 327 |
| 274 | 3300007076 | Ga0075435_100001940 | Ga0075435_10000194012 | 327 |
| 275 | 3300025898 | Ga0207692_10088723 | Ga0207692_100887233 | 327 |
| 276 | 3300031548 | Ga0307408_100022706 | Ga0307408_1000227062 | 327 |
| 277 | 3300045049 | Ga0466959_0004141 | Ga0466959_0004141_2751_3734 | 327 |
| 278 | 3300045976 | Ga0466967_0032255 | Ga0466967_0032255_1105_2088 | 327 |
| 279 | 3300048905 | Ga0496102_0145760 | Ga0496102_0145760_700_1689 | 327 |
| 280 | 3300050512 | nmdc:mga0n895_3115_c1 | nmdc:mga0n895_3115_c1_11872_12885 | 327 |
| 281 | 3300050513 | nmdc:mga0rr50_1398_c1 | nmdc:mga0rr50_1398_c1_9796_10809 | 327 |
| 282 | 3300050514 | nmdc:mga08x19_17986_c1 | nmdc:mga08x19_17986_c1_2470_3483 | 327 |
| 283 | 3300004803 | Ga0058862_10076746 | Ga0058862_100767462 | 328 |
| 284 | 3300005329 | Ga0070683_100163742 | Ga0070683_1001637422 | 328 |
| 285 | 3300005336 | Ga0070680_100037547 | Ga0070680_1000375473 | 328 |
| 286 | 3300005337 | Ga0070682_100020328 | Ga0070682_1000203283 | 328 |
| 287 | 3300005458 | Ga0070681_10056317 | Ga0070681_100563173 | 328 |
| 288 | 3300005458 | Ga0070681_10211351 | Ga0070681_102113512 | 328 |
| 289 | 3300005530 | Ga0070679_100031817 | Ga0070679_1000318173 | 328 |
| 290 | 3300005563 | Ga0068855_100222868 | Ga0068855_1002228681 | 328 |
| 291 | 3300005578 | Ga0068854_100174988 | Ga0068854_1001749881 | 328 |
| 292 | 3300005614 | Ga0068856_100179631 | Ga0068856_1001796312 | 328 |
| 293 | 3300005614 | Ga0068856_100331633 | Ga0068856_1003316332 | 328 |
| 294 | 3300006871 | Ga0075434_100010660 | Ga0075434_1000106603 | 328 |
| 295 | 3300006914 | Ga0075436_100086953 | Ga0075436_1000869532 | 328 |
| 296 | 3300007076 | Ga0075435_100041806 | Ga0075435_1000418064 | 328 |
| 297 | 3300009093 | Ga0105240_10138712 | Ga0105240_101387122 | 328 |
| 298 | 3300013100 | Ga0157373_10077039 | Ga0157373_100770392 | 328 |
| 299 | 3300013104 | Ga0157370_10114950 | Ga0157370_101149503 | 328 |
| 300 | 3300025912 | Ga0207707_10063186 | Ga0207707_100631862 | 328 |
| 301 | 3300025913 | Ga0207695_10162121 | Ga0207695_101621211 | 328 |
| 302 | 3300025914 | Ga0207671_10112587 | Ga0207671_101125873 | 328 |
| 303 | 3300025915 | Ga0207693_10262333 | Ga0207693_102623331 | 328 |
| 304 | 3300025917 | Ga0207660_10050806 | Ga0207660_100508063 | 328 |
| 305 | 3300025917 | Ga0207660_10333916 | Ga0207660_103339162 | 328 |
| 306 | 3300025981 | Ga0207640_10124342 | Ga0207640_101243423 | 328 |
| 307 | 3300025981 | Ga0207640_10299638 | Ga0207640_102996382 | 328 |
| 308 | 3300026023 | Ga0207677_10179879 | Ga0207677_101798791 | 328 |
| 309 | 3300026078 | Ga0207702_10447264 | Ga0207702_104472642 | 328 |
| 310 | 3300035170 | Ga0373943_0082046 | Ga0373943_0082046_162_1148 | 328 |
| 311 | 3300035695 | Ga0373927_0227235 | Ga0373927_0227235_226_1212 | 328 |
| 312 | 3300036401 | Ga0373937_0128313 | Ga0373937_0128313_884_1987 | 328 |
| 313 | 3300036401 | Ga0373937_0180135 | Ga0373937_0180135_525_1511 | 328 |
| 314 | 3300037068 | Ga0373925_0003807 | Ga0373925_0003807_5578_6564 | 328 |
| 315 | 3300044694 | Ga0466963_0222045 | Ga0466963_0222045_104_1090 | 328 |
| 316 | 3300044842 | Ga0466957_0225036 | Ga0466957_0225036_55_1041 | 328 |
| 317 | 3300045976 | Ga0466967_0201009 | Ga0466967_0201009_316_1302 | 328 |
| 318 | 3300046499 | Ga0495594_0072602 | Ga0495594_0072602_655_1644 | 328 |
| 319 | 3300046543 | Ga0495645_0013197 | Ga0495645_0013197_3281_4270 | 328 |
| 320 | 3300046684 | Ga0495669_0135431 | Ga0495669_0135431_108_1097 | 328 |
| 321 | 3300048905 | Ga0496102_0241491 | Ga0496102_0241491_202_1188 | 328 |
| 322 | 3300048906 | Ga0496103_0005215 | Ga0496103_0005215_3851_4837 | 328 |
| 323 | 3300048907 | Ga0496104_0109708 | Ga0496104_0109708_235_1221 | 328 |
| 324 | 3300048913 | Ga0496110_0137359 | Ga0496110_0137359_1082_2068 | 328 |
| 325 | 3300048914 | Ga0496111_0028145 | Ga0496111_0028145_1689_2675 | 328 |
| 326 | 3300048915 | Ga0496112_0101844 | Ga0496112_0101844_1472_2470 | 328 |
| 327 | 3300050512 | nmdc:mga0n895_15786_c1 | nmdc:mga0n895_15786_c1_5775_6803 | 328 |
| 328 | 3300050513 | nmdc:mga0rr50_511127_c1 | nmdc:mga0rr50_511127_c1_11_1009 | 328 |
| 329 | 3300050514 | nmdc:mga08x19_46063_c1 | nmdc:mga08x19_46063_c1_589_1617 | 328 |
| 330 | 3300050515 | nmdc:mga0a205_493912_c1 | nmdc:mga0a205_493912_c1_33_1061 | 328 |
| 331 | 3300003322 | rootL2_10074167 | rootL2_100741675 | 329 |
| 332 | 3300005334 | Ga0068869_100001857 | Ga0068869_10000185711 | 329 |
| 333 | 3300005548 | Ga0070665_100119943 | Ga0070665_1001199432 | 329 |
| 334 | 3300005577 | Ga0068857_100258835 | Ga0068857_1002588351 | 329 |
| 335 | 3300005578 | Ga0068854_100127888 | Ga0068854_1001278882 | 329 |
| 336 | 3300005616 | Ga0068852_100378513 | Ga0068852_1003785132 | 329 |
| 337 | 3300005616 | Ga0068852_100403705 | Ga0068852_1004037051 | 329 |
| 338 | 3300005719 | Ga0068861_100067746 | Ga0068861_1000677463 | 329 |
| 339 | 3300005842 | Ga0068858_100000728 | Ga0068858_10000072818 | 329 |
| 340 | 3300005843 | Ga0068860_100156457 | Ga0068860_1001564572 | 329 |
| 341 | 3300006358 | Ga0068871_100103111 | Ga0068871_1001031112 | 329 |
| 342 | 3300006358 | Ga0068871_100236235 | Ga0068871_1002362352 | 329 |
| 343 | 3300006881 | Ga0068865_100254777 | Ga0068865_1002547772 | 329 |
| 344 | 3300009177 | Ga0105248_10079009 | Ga0105248_100790093 | 329 |
| 345 | 3300009545 | Ga0105237_10058217 | Ga0105237_100582174 | 329 |
| 346 | 3300010375 | Ga0105239_10002453 | Ga0105239_100024538 | 329 |
| 347 | 3300010375 | Ga0105239_10225797 | Ga0105239_102257973 | 329 |
| 348 | 3300013296 | Ga0157374_10001620 | Ga0157374_1000162017 | 329 |
| 349 | 3300013297 | Ga0157378_10046849 | Ga0157378_100468492 | 329 |
| 350 | 3300013306 | Ga0163162_10009985 | Ga0163162_100099854 | 329 |
| 351 | 3300013308 | Ga0157375_10390409 | Ga0157375_103904092 | 329 |
| 352 | 3300014497 | Ga0182008_10021047 | Ga0182008_100210472 | 329 |
| 353 | 3300014968 | Ga0157379_10148276 | Ga0157379_101482762 | 329 |
| 354 | 3300014969 | Ga0157376_10084238 | Ga0157376_100842383 | 329 |
| 355 | 3300014969 | Ga0157376_10339339 | Ga0157376_103393392 | 329 |
| 356 | 3300015262 | Ga0182007_10007804 | Ga0182007_100078043 | 329 |
| 357 | 3300025904 | Ga0207647_10095040 | Ga0207647_100950402 | 329 |
| 358 | 3300025906 | Ga0207699_10160356 | Ga0207699_101603562 | 329 |
| 359 | 3300025938 | Ga0207704_10139319 | Ga0207704_101393193 | 329 |
| 360 | 3300025942 | Ga0207689_10000706 | Ga0207689_1000070617 | 329 |
| 361 | 3300025944 | Ga0207661_10272824 | Ga0207661_102728242 | 329 |
| 362 | 3300026035 | Ga0207703_10005756 | Ga0207703_100057564 | 329 |
| 363 | 3300026078 | Ga0207702_10027898 | Ga0207702_100278984 | 329 |
| 364 | 3300026088 | Ga0207641_10123736 | Ga0207641_101237364 | 329 |
| 365 | 3300031852 | Ga0307410_10024366 | Ga0307410_100243663 | 329 |
| 366 | 3300031903 | Ga0307407_10061268 | Ga0307407_100612682 | 329 |
| 367 | 3300031995 | Ga0307409_100000699 | Ga0307409_10000069915 | 329 |
| 368 | 3300032002 | Ga0307416_100023449 | Ga0307416_1000234497 | 329 |
| 369 | 3300032005 | Ga0307411_10003407 | Ga0307411_100034078 | 329 |
| 370 | 3300032005 | Ga0307411_10011260 | Ga0307411_100112604 | 329 |
| 371 | 3300039437 | Ga0436365_0595099 | Ga0436365_0595099_257_1246 | 329 |
| 372 | 3300046472 | Ga0495580_0085538 | Ga0495580_0085538_1037_2026 | 329 |
| 373 | 3300048903 | Ga0496100_0069823 | Ga0496100_0069823_359_1348 | 329 |
| 374 | 3300048915 | Ga0496112_0047241 | Ga0496112_0047241_2224_3219 | 329 |
| 375 | 3300048916 | Ga0496113_0448522 | Ga0496113_0448522_25_1014 | 329 |
| 376 | 3300005435 | Ga0070714_100450386 | Ga0070714_1004503861 | 330 |
| 377 | 3300005436 | Ga0070713_100036748 | Ga0070713_1000367484 | 330 |
| 378 | 3300005436 | Ga0070713_100340513 | Ga0070713_1003405131 | 330 |
| 379 | 3300005563 | Ga0068855_100047589 | Ga0068855_1000475895 | 330 |
| 380 | 3300006175 | Ga0070712_100111988 | Ga0070712_1001119882 | 330 |
| 381 | 3300009093 | Ga0105240_10039462 | Ga0105240_100394626 | 330 |
| 382 | 3300009551 | Ga0105238_10037575 | Ga0105238_100375754 | 330 |
| 383 | 3300013104 | Ga0157370_10150084 | Ga0157370_101500842 | 330 |
| 384 | 3300025913 | Ga0207695_10070288 | Ga0207695_100702882 | 330 |
| 385 | 3300025913 | Ga0207695_10262885 | Ga0207695_102628852 | 330 |
| 386 | 3300025924 | Ga0207694_10057084 | Ga0207694_100570842 | 330 |
| 387 | 3300025928 | Ga0207700_10004348 | Ga0207700_100043486 | 330 |
| 388 | 3300025929 | Ga0207664_10235851 | Ga0207664_102358512 | 330 |
| 389 | 3300028800 | Ga0265338_10052948 | Ga0265338_100529484 | 330 |
| 390 | 3300031249 | Ga0265339_10004017 | Ga0265339_100040175 | 330 |
| 391 | 3300031344 | Ga0265316_10015996 | Ga0265316_100159963 | 330 |
| 392 | 3300035692 | Ga0373935_0005093 | Ga0373935_0005093_4032_5033 | 330 |
| 393 | 3300036401 | Ga0373937_0000827 | Ga0373937_0000827_2523_3524 | 330 |
| 394 | 3300046462 | Ga0495651_0176196 | Ga0495651_0176196_98_1099 | 330 |
| 395 | 3300048908 | Ga0496105_0013709 | Ga0496105_0013709_2670_3788 | 330 |
| 396 | 3300048915 | Ga0496112_0035814 | Ga0496112_0035814_3764_4771 | 330 |
| 397 | 3300050514 | nmdc:mga08x19_9044_c1 | nmdc:mga08x19_9044_c1_4661_5689 | 330 |
| 398 | 3300026118 | Ga0207675_100068498 | Ga0207675_1000684984 | 331 |
| 399 | 3300046472 | Ga0495580_0043029 | Ga0495580_0043029_461_1468 | 331 |
| 400 | 3300005330 | Ga0070690_100106958 | Ga0070690_1001069582 | 332 |
| 401 | 3300005334 | Ga0068869_100002009 | Ga0068869_1000020096 | 332 |
| 402 | 3300005336 | Ga0070680_100204746 | Ga0070680_1002047462 | 332 |
| 403 | 3300005338 | Ga0068868_100014278 | Ga0068868_1000142785 | 332 |
| 404 | 3300005339 | Ga0070660_100177063 | Ga0070660_1001770632 | 332 |
| 405 | 3300005343 | Ga0070687_100004698 | Ga0070687_1000046984 | 332 |
| 406 | 3300005344 | Ga0070661_100041173 | Ga0070661_1000411732 | 332 |
| 407 | 3300005366 | Ga0070659_100155171 | Ga0070659_1001551712 | 332 |
| 408 | 3300005434 | Ga0070709_10034826 | Ga0070709_100348261 | 332 |
| 409 | 3300005435 | Ga0070714_100031796 | Ga0070714_1000317961 | 332 |
| 410 | 3300005435 | Ga0070714_100414440 | Ga0070714_1004144401 | 332 |
| 411 | 3300005436 | Ga0070713_100007565 | Ga0070713_1000075656 | 332 |
| 412 | 3300005437 | Ga0070710_10035306 | Ga0070710_100353061 | 332 |
| 413 | 3300005458 | Ga0070681_10016054 | Ga0070681_100160545 | 332 |
| 414 | 3300005459 | Ga0068867_100038327 | Ga0068867_1000383272 | 332 |
| 415 | 3300005535 | Ga0070684_100007055 | Ga0070684_1000070555 | 332 |
| 416 | 3300005539 | Ga0068853_100093357 | Ga0068853_1000933573 | 332 |
| 417 | 3300005546 | Ga0070696_100079366 | Ga0070696_1000793662 | 332 |
| 418 | 3300005563 | Ga0068855_100003547 | Ga0068855_10000354715 | 332 |
| 419 | 3300005564 | Ga0070664_100001991 | Ga0070664_1000019914 | 332 |
| 420 | 3300005577 | Ga0068857_100000775 | Ga0068857_1000007758 | 332 |
| 421 | 3300005614 | Ga0068856_100005024 | Ga0068856_1000050244 | 332 |
| 422 | 3300005617 | Ga0068859_100000298 | Ga0068859_10000029836 | 332 |
| 423 | 3300005618 | Ga0068864_100002195 | Ga0068864_10000219510 | 332 |
| 424 | 3300005842 | Ga0068858_100010844 | Ga0068858_1000108444 | 332 |
| 425 | 3300005843 | Ga0068860_100031286 | Ga0068860_1000312863 | 332 |
| 426 | 3300006028 | Ga0070717_10351968 | Ga0070717_103519681 | 332 |
| 427 | 3300006881 | Ga0068865_100107252 | Ga0068865_1001072522 | 332 |
| 428 | 3300006931 | Ga0097620_100000298 | Ga0097620_10000029836 | 332 |
| 429 | 3300009177 | Ga0105248_10174681 | Ga0105248_101746812 | 332 |
| 430 | 3300011119 | Ga0105246_10100654 | Ga0105246_101006542 | 332 |
| 431 | 3300013100 | Ga0157373_10005980 | Ga0157373_100059802 | 332 |
| 432 | 3300013296 | Ga0157374_10001876 | Ga0157374_1000187616 | 332 |
| 433 | 3300013297 | Ga0157378_10000970 | Ga0157378_100009707 | 332 |
| 434 | 3300013307 | Ga0157372_10000749 | Ga0157372_1000074916 | 332 |
| 435 | 3300014325 | Ga0163163_10118100 | Ga0163163_101181002 | 332 |
| 436 | 3300025906 | Ga0207699_10030809 | Ga0207699_100308093 | 332 |
| 437 | 3300025906 | Ga0207699_10199802 | Ga0207699_101998022 | 332 |
| 438 | 3300025912 | Ga0207707_10012202 | Ga0207707_100122023 | 332 |
| 439 | 3300025915 | Ga0207693_10090013 | Ga0207693_100900134 | 332 |
| 440 | 3300025925 | Ga0207650_10032174 | Ga0207650_100321742 | 332 |
| 441 | 3300025929 | Ga0207664_10001649 | Ga0207664_100016492 | 332 |
| 442 | 3300025929 | Ga0207664_10028600 | Ga0207664_100286002 | 332 |
| 443 | 3300025938 | Ga0207704_10005806 | Ga0207704_100058063 | 332 |
| 444 | 3300025945 | Ga0207679_10037097 | Ga0207679_100370973 | 332 |
| 445 | 3300025949 | Ga0207667_10011648 | Ga0207667_100116488 | 332 |
| 446 | 3300026023 | Ga0207677_10000965 | Ga0207677_100009657 | 332 |
| 447 | 3300026035 | Ga0207703_10003058 | Ga0207703_100030584 | 332 |
| 448 | 3300026041 | Ga0207639_10089042 | Ga0207639_100890422 | 332 |
| 449 | 3300026078 | Ga0207702_10005732 | Ga0207702_100057324 | 332 |
| 450 | 3300026089 | Ga0207648_10066522 | Ga0207648_100665222 | 332 |
| 451 | 3300026095 | Ga0207676_10002258 | Ga0207676_1000225810 | 332 |
| 452 | 3300026116 | Ga0207674_10000165 | Ga0207674_1000016562 | 332 |
| 453 | 3300026118 | Ga0207675_100513610 | Ga0207675_1005136101 | 332 |
| 454 | 3300028381 | Ga0268264_10032967 | Ga0268264_100329672 | 332 |
| 455 | 3300035691 | Ga0373931_0091653 | Ga0373931_0091653_109_1125 | 332 |
| 456 | 3300025928 | Ga0207700_10028787 | Ga0207700_100287871 | 333 |
| 457 | 3300045976 | Ga0466967_0302039 | Ga0466967_0302039_200_1270 | 333 |
| 458 | 3300005329 | Ga0070683_100067321 | Ga0070683_1000673213 | 334 |
| 459 | 3300005329 | Ga0070683_100228700 | Ga0070683_1002287002 | 334 |
| 460 | 3300005336 | Ga0070680_100107442 | Ga0070680_1001074422 | 334 |
| 461 | 3300005435 | Ga0070714_100053079 | Ga0070714_1000530795 | 334 |
| 462 | 3300005436 | Ga0070713_100005746 | Ga0070713_1000057466 | 334 |
| 463 | 3300005436 | Ga0070713_100046707 | Ga0070713_1000467072 | 334 |
| 464 | 3300005445 | Ga0070708_100034749 | Ga0070708_1000347493 | 334 |
| 465 | 3300005456 | Ga0070678_100131764 | Ga0070678_1001317642 | 334 |
| 466 | 3300005530 | Ga0070679_100006248 | Ga0070679_1000062488 | 334 |
| 467 | 3300005535 | Ga0070684_100256762 | Ga0070684_1002567621 | 334 |
| 468 | 3300005535 | Ga0070684_100312043 | Ga0070684_1003120431 | 334 |
| 469 | 3300005536 | Ga0070697_100228610 | Ga0070697_1002286101 | 334 |
| 470 | 3300005539 | Ga0068853_100113996 | Ga0068853_1001139962 | 334 |
| 471 | 3300005563 | Ga0068855_100000782 | Ga0068855_10000078240 | 334 |
| 472 | 3300005563 | Ga0068855_100004362 | Ga0068855_1000043622 | 334 |
| 473 | 3300005577 | Ga0068857_100198356 | Ga0068857_1001983561 | 334 |
| 474 | 3300005578 | Ga0068854_100002592 | Ga0068854_1000025921 | 334 |
| 475 | 3300005614 | Ga0068856_100000437 | Ga0068856_1000004378 | 334 |
| 476 | 3300005614 | Ga0068856_100104260 | Ga0068856_1001042602 | 334 |
| 477 | 3300005616 | Ga0068852_100189228 | Ga0068852_1001892282 | 334 |
| 478 | 3300005618 | Ga0068864_100038489 | Ga0068864_1000384892 | 334 |
| 479 | 3300005841 | Ga0068863_100101577 | Ga0068863_1001015773 | 334 |
| 480 | 3300005842 | Ga0068858_100028909 | Ga0068858_1000289092 | 334 |
| 481 | 3300005842 | Ga0068858_100072311 | Ga0068858_1000723112 | 334 |
| 482 | 3300005843 | Ga0068860_100141659 | Ga0068860_1001416591 | 334 |
| 483 | 3300006237 | Ga0097621_100000472 | Ga0097621_10000047210 | 334 |
| 484 | 3300006237 | Ga0097621_100021084 | Ga0097621_1000210845 | 334 |
| 485 | 3300006358 | Ga0068871_100000084 | Ga0068871_10000008441 | 334 |
| 486 | 3300006358 | Ga0068871_100067580 | Ga0068871_1000675802 | 334 |
| 487 | 3300006852 | Ga0075433_10017089 | Ga0075433_100170893 | 334 |
| 488 | 3300006871 | Ga0075434_100006848 | Ga0075434_1000068489 | 334 |
| 489 | 3300006881 | Ga0068865_100020735 | Ga0068865_1000207354 | 334 |
| 490 | 3300009093 | Ga0105240_10005889 | Ga0105240_1000588910 | 334 |
| 491 | 3300009093 | Ga0105240_10125612 | Ga0105240_101256121 | 334 |
| 492 | 3300009093 | Ga0105240_10306446 | Ga0105240_103064462 | 334 |
| 493 | 3300009177 | Ga0105248_10035966 | Ga0105248_100359663 | 334 |
| 494 | 3300009545 | Ga0105237_10378172 | Ga0105237_103781721 | 334 |
| 495 | 3300009551 | Ga0105238_10012484 | Ga0105238_100124847 | 334 |
| 496 | 3300013100 | Ga0157373_10221392 | Ga0157373_102213921 | 334 |
| 497 | 3300013104 | Ga0157370_10210610 | Ga0157370_102106102 | 334 |
| 498 | 3300013105 | Ga0157369_10004291 | Ga0157369_100042911 | 334 |
| 499 | 3300013105 | Ga0157369_10015876 | Ga0157369_100158764 | 334 |
| 500 | 3300013296 | Ga0157374_10000357 | Ga0157374_100003575 | 334 |
| 501 | 3300013296 | Ga0157374_10001545 | Ga0157374_1000154518 | 334 |
| 502 | 3300013297 | Ga0157378_10000133 | Ga0157378_1000013337 | 334 |
| 503 | 3300013297 | Ga0157378_10009203 | Ga0157378_100092033 | 334 |
| 504 | 3300013307 | Ga0157372_10000544 | Ga0157372_1000054433 | 334 |
| 505 | 3300013307 | Ga0157372_10002337 | Ga0157372_1000233715 | 334 |
| 506 | 3300013307 | Ga0157372_10111813 | Ga0157372_101118132 | 334 |
| 507 | 3300013307 | Ga0157372_10243572 | Ga0157372_102435722 | 334 |
| 508 | 3300014969 | Ga0157376_10023839 | Ga0157376_100238393 | 334 |
| 509 | 3300025912 | Ga0207707_10001372 | Ga0207707_100013726 | 334 |
| 510 | 3300025913 | Ga0207695_10070744 | Ga0207695_100707441 | 334 |
| 511 | 3300025913 | Ga0207695_10093475 | Ga0207695_100934753 | 334 |
| 512 | 3300025913 | Ga0207695_10199351 | Ga0207695_101993512 | 334 |
| 513 | 3300025913 | Ga0207695_10214937 | Ga0207695_102149372 | 334 |
| 514 | 3300025914 | Ga0207671_10025778 | Ga0207671_100257782 | 334 |
| 515 | 3300025921 | Ga0207652_10014836 | Ga0207652_100148364 | 334 |
| 516 | 3300025928 | Ga0207700_10005883 | Ga0207700_100058836 | 334 |
| 517 | 3300025929 | Ga0207664_10010810 | Ga0207664_100108103 | 334 |
| 518 | 3300025938 | Ga0207704_10025863 | Ga0207704_100258632 | 334 |
| 519 | 3300025941 | Ga0207711_10073624 | Ga0207711_100736243 | 334 |
| 520 | 3300025944 | Ga0207661_10012169 | Ga0207661_100121692 | 334 |
| 521 | 3300025944 | Ga0207661_10065711 | Ga0207661_100657112 | 334 |
| 522 | 3300025945 | Ga0207679_10157560 | Ga0207679_101575602 | 334 |
| 523 | 3300025949 | Ga0207667_10000475 | Ga0207667_1000047513 | 334 |
| 524 | 3300025949 | Ga0207667_10001648 | Ga0207667_1000164827 | 334 |
| 525 | 3300025949 | Ga0207667_10108728 | Ga0207667_101087281 | 334 |
| 526 | 3300025960 | Ga0207651_10251174 | Ga0207651_102511742 | 334 |
| 527 | 3300025981 | Ga0207640_10007162 | Ga0207640_100071622 | 334 |
| 528 | 3300026035 | Ga0207703_10014844 | Ga0207703_100148443 | 334 |
| 529 | 3300026041 | Ga0207639_10093972 | Ga0207639_100939722 | 334 |
| 530 | 3300026078 | Ga0207702_10011714 | Ga0207702_100117145 | 334 |
| 531 | 3300026088 | Ga0207641_10008617 | Ga0207641_100086172 | 334 |
| 532 | 3300026116 | Ga0207674_10015293 | Ga0207674_100152937 | 334 |
| 533 | 3300026142 | Ga0207698_10105318 | Ga0207698_101053182 | 334 |
| 534 | 3300028381 | Ga0268264_10063071 | Ga0268264_100630711 | 334 |
| 535 | 3300035691 | Ga0373931_0033111 | Ga0373931_0033111_92_1108 | 334 |
| 536 | 3300045049 | Ga0466959_0104947 | Ga0466959_0104947_567_1610 | 334 |
| 537 | 3300045836 | Ga0466958_0020168 | Ga0466958_0020168_1607_2650 | 334 |
| 538 | 3300045976 | Ga0466967_0045037 | Ga0466967_0045037_2102_3145 | 334 |
| 539 | 3300046472 | Ga0495580_0002222 | Ga0495580_0002222_7151_8155 | 334 |
| 540 | 3300048908 | Ga0496105_0060775 | Ga0496105_0060775_1194_2210 | 334 |
| 541 | 3300048914 | Ga0496111_0346327 | Ga0496111_0346327_20_1036 | 334 |
| 542 | 3300048915 | Ga0496112_0003539 | Ga0496112_0003539_4878_5894 | 334 |
| 543 | 3300048915 | Ga0496112_0038831 | Ga0496112_0038831_3172_4188 | 334 |
| 544 | 3300050512 | nmdc:mga0n895_6567_c1 | nmdc:mga0n895_6567_c1_3253_4257 | 334 |
| 545 | 3300050515 | nmdc:mga0a205_1031_c1 | nmdc:mga0a205_1031_c1_3043_4047 | 334 |
| 546 | 3300061719 | Ga0466962_0051791 | Ga0466962_0051791_321_1364 | 334 |
| 547 | 3300005467 | Ga0070706_100041991 | Ga0070706_1000419914 | 335 |
| 548 | 3300005468 | Ga0070707_100013103 | Ga0070707_1000131032 | 335 |
| 549 | 3300024227 | Ga0228598_1007166 | Ga0228598_10071661 | 335 |
| 550 | 3300025922 | Ga0207646_10148211 | Ga0207646_101482112 | 335 |
| 551 | 3300031249 | Ga0265339_10016016 | Ga0265339_100160161 | 335 |
| 552 | 3300031711 | Ga0265314_10005810 | Ga0265314_100058108 | 335 |
| 553 | 3300031711 | Ga0265314_10138090 | Ga0265314_101380902 | 335 |
| 554 | 3300005436 | Ga0070713_100011239 | Ga0070713_1000112395 | 336 |
| 555 | 3300005436 | Ga0070713_100083172 | Ga0070713_1000831721 | 336 |
| 556 | 3300005437 | Ga0070710_10025077 | Ga0070710_100250773 | 336 |
| 557 | 3300005439 | Ga0070711_100022031 | Ga0070711_1000220314 | 336 |
| 558 | 3300005458 | Ga0070681_10228072 | Ga0070681_102280722 | 336 |
| 559 | 3300006028 | Ga0070717_10012555 | Ga0070717_100125555 | 336 |
| 560 | 3300006173 | Ga0070716_100000412 | Ga0070716_1000004128 | 336 |
| 561 | 3300006175 | Ga0070712_100003917 | Ga0070712_1000039174 | 336 |
| 562 | 3300006175 | Ga0070712_100007097 | Ga0070712_1000070974 | 336 |
| 563 | 3300006175 | Ga0070712_100014269 | Ga0070712_1000142693 | 336 |
| 564 | 3300025906 | Ga0207699_10014129 | Ga0207699_100141294 | 336 |
| 565 | 3300025915 | Ga0207693_10001454 | Ga0207693_100014548 | 336 |
| 566 | 3300025915 | Ga0207693_10007586 | Ga0207693_100075864 | 336 |
| 567 | 3300025915 | Ga0207693_10012077 | Ga0207693_100120774 | 336 |
| 568 | 3300025916 | Ga0207663_10079133 | Ga0207663_100791333 | 336 |
| 569 | 3300025928 | Ga0207700_10007126 | Ga0207700_100071266 | 336 |
| 570 | 3300025939 | Ga0207665_10000884 | Ga0207665_100008849 | 336 |
| 571 | 3300050514 | nmdc:mga08x19_185975_c1 | nmdc:mga08x19_185975_c1_291_1406 | 336 |
| 572 | 3300025945 | Ga0207679_10000080 | Ga0207679_1000008053 | 337 |
| 573 | 3300013105 | Ga0157369_10000297 | Ga0157369_1000029725 | 338 |
| 574 | 3300046472 | Ga0495580_0000223 | Ga0495580_0000223_38278_39312 | 338 |
| 575 | 3300046531 | Ga0495665_0008695 | Ga0495665_0008695_3694_4728 | 338 |
| 576 | 3300030760 | Ga0265762_1003446 | Ga0265762_10034464 | 340 |
| 577 | 3300031090 | Ga0265760_10008099 | Ga0265760_100080994 | 340 |
| 578 | 3300035086 | Ga0373934_0027441 | Ga0373934_0027441_433_1479 | 340 |
| 579 | 3300036401 | Ga0373937_0013056 | Ga0373937_0013056_1670_2716 | 340 |
| 580 | 3300046559 | Ga0495667_0095675 | Ga0495667_0095675_797_1843 | 340 |
| 581 | 3300046679 | Ga0495623_0064847 | Ga0495623_0064847_51_1097 | 340 |
| 582 | 3300006028 | Ga0070717_10002780 | Ga0070717_1000278011 | 341 |
| 583 | 3300005468 | Ga0070707_100076256 | Ga0070707_1000762562 | 344 |
| 584 | 3300025922 | Ga0207646_10284928 | Ga0207646_102849281 | 344 |
| 585 | 3300001976 | JGI24752J21851_1002230 | JGI24752J21851_10022304 | 347 |
| 586 | 3300001991 | JGI24743J22301_10007511 | JGI24743J22301_100075112 | 347 |
| 587 | 3300002459 | JGI24751J29686_10012545 | JGI24751J29686_100125452 | 347 |
| 588 | 3300005327 | Ga0070658_10088467 | Ga0070658_100884671 | 347 |
| 589 | 3300005328 | Ga0070676_10129380 | Ga0070676_101293801 | 347 |
| 590 | 3300005329 | Ga0070683_100001626 | Ga0070683_1000016265 | 347 |
| 591 | 3300005330 | Ga0070690_100042191 | Ga0070690_1000421912 | 347 |
| 592 | 3300005331 | Ga0070670_100052443 | Ga0070670_1000524434 | 347 |
| 593 | 3300005331 | Ga0070670_100110019 | Ga0070670_1001100195 | 347 |
| 594 | 3300005334 | Ga0068869_100103680 | Ga0068869_1001036802 | 347 |
| 595 | 3300005335 | Ga0070666_10013203 | Ga0070666_100132032 | 347 |
| 596 | 3300005337 | Ga0070682_100034220 | Ga0070682_1000342202 | 347 |
| 597 | 3300005338 | Ga0068868_100043917 | Ga0068868_1000439173 | 347 |
| 598 | 3300005339 | Ga0070660_100002367 | Ga0070660_1000023674 | 347 |
| 599 | 3300005343 | Ga0070687_100033238 | Ga0070687_1000332382 | 347 |
| 600 | 3300005344 | Ga0070661_100060461 | Ga0070661_1000604611 | 347 |
| 601 | 3300005354 | Ga0070675_100193240 | Ga0070675_1001932403 | 347 |
| 602 | 3300005356 | Ga0070674_100036897 | Ga0070674_1000368972 | 347 |
| 603 | 3300005365 | Ga0070688_100000649 | Ga0070688_10000064911 | 347 |
| 604 | 3300005366 | Ga0070659_100002024 | Ga0070659_10000202411 | 347 |
| 605 | 3300005438 | Ga0070701_10005375 | Ga0070701_100053755 | 347 |
| 606 | 3300005455 | Ga0070663_100022418 | Ga0070663_1000224185 | 347 |
| 607 | 3300005456 | Ga0070678_100044700 | Ga0070678_1000447002 | 347 |
| 608 | 3300005457 | Ga0070662_100035203 | Ga0070662_1000352033 | 347 |
| 609 | 3300005459 | Ga0068867_100015408 | Ga0068867_1000154083 | 347 |
| 610 | 3300005535 | Ga0070684_100025259 | Ga0070684_1000252592 | 347 |
| 611 | 3300005539 | Ga0068853_100006954 | Ga0068853_1000069547 | 347 |
| 612 | 3300005543 | Ga0070672_100061334 | Ga0070672_1000613343 | 347 |
| 613 | 3300005563 | Ga0068855_100018769 | Ga0068855_1000187694 | 347 |
| 614 | 3300005564 | Ga0070664_100010095 | Ga0070664_1000100957 | 347 |
| 615 | 3300005577 | Ga0068857_100001392 | Ga0068857_1000013927 | 347 |
| 616 | 3300005578 | Ga0068854_100095898 | Ga0068854_1000958983 | 347 |
| 617 | 3300005614 | Ga0068856_100005815 | Ga0068856_10000581510 | 347 |
| 618 | 3300005615 | Ga0070702_100021445 | Ga0070702_1000214455 | 347 |
| 619 | 3300005616 | Ga0068852_100012290 | Ga0068852_1000122907 | 347 |
| 620 | 3300005617 | Ga0068859_100018200 | Ga0068859_1000182004 | 347 |
| 621 | 3300005618 | Ga0068864_100135313 | Ga0068864_1001353132 | 347 |
| 622 | 3300005719 | Ga0068861_100075095 | Ga0068861_1000750952 | 347 |
| 623 | 3300005840 | Ga0068870_10000211 | Ga0068870_100002119 | 347 |
| 624 | 3300006237 | Ga0097621_100161643 | Ga0097621_1001616434 | 347 |
| 625 | 3300006881 | Ga0068865_100030842 | Ga0068865_1000308423 | 347 |
| 626 | 3300006931 | Ga0097620_100018202 | Ga0097620_1000182026 | 347 |
| 627 | 3300009098 | Ga0105245_10005120 | Ga0105245_100051204 | 347 |
| 628 | 3300009098 | Ga0105245_10020679 | Ga0105245_100206794 | 347 |
| 629 | 3300009101 | Ga0105247_10036051 | Ga0105247_100360513 | 347 |
| 630 | 3300009174 | Ga0105241_10212161 | Ga0105241_102121612 | 347 |
| 631 | 3300009553 | Ga0105249_10092022 | Ga0105249_100920222 | 347 |
| 632 | 3300009553 | Ga0105249_10282203 | Ga0105249_102822032 | 347 |
| 633 | 3300011119 | Ga0105246_10063497 | Ga0105246_100634971 | 347 |
| 634 | 3300013100 | Ga0157373_10053729 | Ga0157373_100537292 | 347 |
| 635 | 3300013105 | Ga0157369_10007091 | Ga0157369_100070914 | 347 |
| 636 | 3300013296 | Ga0157374_10075968 | Ga0157374_100759682 | 347 |
| 637 | 3300013307 | Ga0157372_10053060 | Ga0157372_100530605 | 347 |
| 638 | 3300013308 | Ga0157375_10147731 | Ga0157375_101477312 | 347 |
| 639 | 3300014325 | Ga0163163_10041486 | Ga0163163_100414864 | 347 |
| 640 | 3300014326 | Ga0157380_10187513 | Ga0157380_101875132 | 347 |
| 641 | 3300014745 | Ga0157377_10000704 | Ga0157377_100007044 | 347 |
| 642 | 3300014968 | Ga0157379_10036033 | Ga0157379_100360335 | 347 |
| 643 | 3300017792 | Ga0163161_10010962 | Ga0163161_100109624 | 347 |
| 644 | 3300025893 | Ga0207682_10026377 | Ga0207682_100263772 | 347 |
| 645 | 3300025901 | Ga0207688_10032133 | Ga0207688_100321333 | 347 |
| 646 | 3300025903 | Ga0207680_10035685 | Ga0207680_100356852 | 347 |
| 647 | 3300025904 | Ga0207647_10001725 | Ga0207647_100017252 | 347 |
| 648 | 3300025907 | Ga0207645_10000104 | Ga0207645_1000010450 | 347 |
| 649 | 3300025908 | Ga0207643_10000512 | Ga0207643_1000051211 | 347 |
| 650 | 3300025911 | Ga0207654_10160948 | Ga0207654_101609482 | 347 |
| 651 | 3300025918 | Ga0207662_10028514 | Ga0207662_100285142 | 347 |
| 652 | 3300025919 | Ga0207657_10002030 | Ga0207657_1000203015 | 347 |
| 653 | 3300025920 | Ga0207649_10000149 | Ga0207649_1000014933 | 347 |
| 654 | 3300025923 | Ga0207681_10006994 | Ga0207681_100069941 | 347 |
| 655 | 3300025925 | Ga0207650_10000442 | Ga0207650_1000044228 | 347 |
| 656 | 3300025925 | Ga0207650_10037358 | Ga0207650_100373583 | 347 |
| 657 | 3300025933 | Ga0207706_10000651 | Ga0207706_100006514 | 347 |
| 658 | 3300025937 | Ga0207669_10053883 | Ga0207669_100538832 | 347 |
| 659 | 3300025940 | Ga0207691_10006924 | Ga0207691_100069242 | 347 |
| 660 | 3300025941 | Ga0207711_10002489 | Ga0207711_100024897 | 347 |
| 661 | 3300025942 | Ga0207689_10003386 | Ga0207689_1000338611 | 347 |
| 662 | 3300025944 | Ga0207661_10000213 | Ga0207661_1000021311 | 347 |
| 663 | 3300025960 | Ga0207651_10000653 | Ga0207651_1000065310 | 347 |
| 664 | 3300025961 | Ga0207712_10027693 | Ga0207712_100276932 | 347 |
| 665 | 3300025961 | Ga0207712_10143522 | Ga0207712_101435222 | 347 |
| 666 | 3300026023 | Ga0207677_10001580 | Ga0207677_1000158010 | 347 |
| 667 | 3300026023 | Ga0207677_10006822 | Ga0207677_100068225 | 347 |
| 668 | 3300026035 | Ga0207703_10004846 | Ga0207703_100048462 | 347 |
| 669 | 3300026041 | Ga0207639_10040501 | Ga0207639_100405014 | 347 |
| 670 | 3300026067 | Ga0207678_10000687 | Ga0207678_1000068714 | 347 |
| 671 | 3300026075 | Ga0207708_10026128 | Ga0207708_100261283 | 347 |
| 672 | 3300026088 | Ga0207641_10000432 | Ga0207641_1000043228 | 347 |
| 673 | 3300026089 | Ga0207648_10001706 | Ga0207648_1000170621 | 347 |
| 674 | 3300026095 | Ga0207676_10000586 | Ga0207676_1000058622 | 347 |
| 675 | 3300026116 | Ga0207674_10001107 | Ga0207674_100011075 | 347 |
| 676 | 3300026121 | Ga0207683_10004384 | Ga0207683_100043843 | 347 |
| 677 | 3300028380 | Ga0268265_10005678 | Ga0268265_100056785 | 347 |
| 678 | 3300028381 | Ga0268264_10005599 | Ga0268264_100055993 | 347 |
| 679 | 3300046684 | Ga0495669_0038467 | Ga0495669_0038467_715_1758 | 347 |
| 680 | 3300048905 | Ga0496102_0074118 | Ga0496102_0074118_1387_2430 | 347 |
| 681 | 3300048905 | Ga0496102_0075100 | Ga0496102_0075100_1857_2900 | 347 |
| 682 | 3300048911 | Ga0496108_0000228 | Ga0496108_0000228_22163_23317 | 347 |
| 683 | 3300048912 | Ga0496109_0000362 | Ga0496109_0000362_23046_24200 | 347 |
| 684 | 3300048913 | Ga0496110_0012685 | Ga0496110_0012685_4470_5624 | 347 |
| 685 | 3300048914 | Ga0496111_0001468 | Ga0496111_0001468_7446_8600 | 347 |
| 686 | 3300048915 | Ga0496112_0000034 | Ga0496112_0000034_80349_81503 | 347 |
| 687 | 3300048916 | Ga0496113_0000391 | Ga0496113_0000391_704_1858 | 347 |
| 688 | 3300048918 | Ga0496115_0101896 | Ga0496115_0101896_1133_2176 | 347 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2xhz-assembly1.cif.gz_B | probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography | 0.971 | 2 | 202 |
| 3fxa-assembly1.cif.gz_D | crystal structure of a putative sugar-phosphate isomerase (lmof2365_0531) from listeria monocytogenes str. 4b f2365 at 1.60 a resolution | 0.953 | 4 | 213 |
| 2xhz-assembly1.cif.gz_B | probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography | 0.9492 | 2 | 202 |
| 3fna-assembly3.cif.gz_A | crystal structure of the cbs pair of possible d-arabinose 5-phosphate isomerase yrbh from escherichia coli cft073 | 0.9427 | 218 | 339 |
| 3k2v-assembly1.cif.gz_B | structure of the cbs pair of a putative d-arabinose 5-phosphate isomerase from klebsiella pneumoniae subsp. pneumoniae. | 0.9394 | 215 | 339 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P45395_11_201_3.40.50.10490 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.9743 | 2 | 219 | 3.40.50.10490 |
| af_P45395_11_201_3.40.50.10490 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.9544 | 2 | 219 | 3.40.50.10490 |
| 3fnaA00 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9489 | 218 | 339 | 3.10.580.10 |
| af_P45395_202_325_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.947 | 221 | 341 | 3.10.580.10 |
| 3fxaD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.9398 | 4 | 213 | 3.40.50.10490 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K1Z903-F1-model_v4 | SIS domain-containing protein | 0.9808 | 8 | 169 |
GO:0097367
GO:1901135 |
| AF-A0A660PIE3-F1-model_v4 | D-arabinose 5-phosphate isomerase | 0.9797 | 3 | 196 |
GO:0016853
GO:0097367 GO:1901135 |
| AF-A0A7G3ELT6-F1-model_v4 | deleted | 0.9779 | 1 | 213 |
|
| AF-A0A656SJ60-F1-model_v4 | deleted | 0.9738 | 38 | 119 |
|
| AF-A0A5C4YD10-F1-model_v4 | KpsF/GutQ family sugar-phosphate isomerase | 0.9719 | 3 | 221 |
GO:0005975
GO:0016853 GO:0097367 GO:1901135 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar