F475321

General Info

Members Datasets Scaffolds Average Seq Length
688 280 687 333

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10007091|Ga0157369_100070914
Length 384
Sequence LFWTIIFKASESGQTSSDHQRAERVTRPAGFCYHPLSMKRTGENVVRIEAEALRRLADRIGGPMGEAFQRALDLMFECRGRVVVTGMGKSGIIARKIAATLSSIGTPALYLHPVEAIHGDLGMVVSGDVVVALSASGETEEILRLLANIKRLRVPLITMTCDEIFGASPLSVEPHGVDGDSRELAAPQKLSTLAAAAEVALDCSIDKEACSLGLAPTASTTAMLALGDALAVALSEKRGFKEEDFANLHPGGKLGKRLARVESLMHSGDAVPRVAPTAKMPDVIYEMSRKKLGMTAVVEGDKLLGVVSDGDLRRLLEQRGKDVLDLTAAECMTRDPKTIAGTEFAATALSIMEEKKITALVVVGNGAKLEGIVHLHDLWGTEMV

Samples

Sample ID Description Type Environment
1 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
183 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
188 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
189 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
192 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
193 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
200 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
201 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
202 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
215 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
218 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
242 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
247 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
248 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
249 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
250 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
280 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.73
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 4.07
Rhizosphere 93.9
Stem 0
Stem Tuber 0
Unclassified 1.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1002230 3300001976 Bacteria 2587
2 JGI24743J22301_10007511 3300001991 Bacteria 1892
3 JGI24751J29686_10012545 3300002459 Bacteria 1747
4 rootH1_10087392 3300003316 Bacteria 4244
5 rootH2_10017798 3300003320 Bacteria 14280
6 rootL2_10074167 3300003322 Bacteria 3966
7 rootL2_10180054 3300003322 Bacteria 2710
8 Ga0058862_10076746 3300004803 Bacteria 2674
9 Ga0065715_10151838 3300005293 Bacteria 1706
10 Ga0070658_10088467 3300005327 Bacteria 2550
11 Ga0070676_10103438 3300005328 Bacteria 1763
12 Ga0070676_10129380 3300005328 Bacteria 1594
13 Ga0070683_100001626 3300005329 Bacteria 17385
14 Ga0070683_100067321 3300005329 Bacteria 3336
15 Ga0070683_100163742 3300005329 Bacteria 2110
16 Ga0070683_100228700 3300005329 Bacteria 1768
17 Ga0070690_100042191 3300005330 Bacteria 2889
18 Ga0070690_100106958 3300005330 Bacteria 1861
19 Ga0070670_100052443 3300005331 Bacteria 3503
20 Ga0070670_100098527 3300005331 Bacteria 2515
21 Ga0070670_100110019 3300005331 Bacteria 2374
22 Ga0068869_100001857 3300005334 Bacteria 12700
23 Ga0068869_100002009 3300005334 Bacteria 12223
24 Ga0068869_100103680 3300005334 Bacteria 2155
25 Ga0070666_10000112 3300005335 Bacteria 55997
26 Ga0070666_10013203 3300005335 Bacteria 5236
27 Ga0070666_10194478 3300005335 Bacteria 1426
28 Ga0070680_100037547 3300005336 Bacteria 3914
29 Ga0070680_100107442 3300005336 Bacteria 2321
30 Ga0070680_100204746 3300005336 Bacteria 1664
31 Ga0070682_100020328 3300005337 Bacteria 3906
32 Ga0070682_100034220 3300005337 Bacteria 3093
33 Ga0070682_100060727 3300005337 Bacteria 2391
34 Ga0068868_100008985 3300005338 Bacteria 7171
35 Ga0068868_100014278 3300005338 Bacteria 5851
36 Ga0068868_100043917 3300005338 Bacteria 3492
37 Ga0070660_100002367 3300005339 Bacteria 12955
38 Ga0070660_100177063 3300005339 Bacteria 1725
39 Ga0070691_10018185 3300005341 Bacteria 3239
40 Ga0070687_100004698 3300005343 Bacteria 5463
41 Ga0070687_100033238 3300005343 Bacteria 2544
42 Ga0070661_100041173 3300005344 Bacteria 3371
43 Ga0070661_100060461 3300005344 Bacteria 2780
44 Ga0070675_100193240 3300005354 Bacteria 1764
45 Ga0070671_100145196 3300005355 Bacteria 2002
46 Ga0070674_100036897 3300005356 Bacteria 3285
47 Ga0070688_100000649 3300005365 Bacteria 17263
48 Ga0070688_100254182 3300005365 Unclassified 1252
49 Ga0070659_100002024 3300005366 Bacteria 14493
50 Ga0070659_100110688 3300005366 Bacteria 2217
51 Ga0070659_100155171 3300005366 Unclassified 1869
52 Ga0070667_100017599 3300005367 Bacteria 5921
53 Ga0070709_10012407 3300005434 Bacteria 4770
54 Ga0070709_10034826 3300005434 Bacteria 3056
55 Ga0070714_100031796 3300005435 Bacteria 4405
56 Ga0070714_100053079 3300005435 Bacteria 3459
57 Ga0070714_100059609 3300005435 Bacteria 3273
58 Ga0070714_100105981 3300005435 Bacteria 2483
59 Ga0070714_100413684 3300005435 Bacteria 1276
60 Ga0070714_100414440 3300005435 Bacteria 1275
61 Ga0070714_100450386 3300005435 Bacteria 1223
62 Ga0070713_100005746 3300005436 Bacteria 8521
63 Ga0070713_100007565 3300005436 Bacteria 7636
64 Ga0070713_100011239 3300005436 Bacteria 6511
65 Ga0070713_100036748 3300005436 Bacteria 3955
66 Ga0070713_100046707 3300005436 Bacteria 3554
67 Ga0070713_100061504 3300005436 Unclassified 3141
68 Ga0070713_100083172 3300005436 Unclassified 2736
69 Ga0070713_100340513 3300005436 Bacteria 1389
70 Ga0070710_10025077 3300005437 Bacteria 3154
71 Ga0070710_10035306 3300005437 Bacteria 2725
72 Ga0070710_10160127 3300005437 Bacteria 1395
73 Ga0070701_10005375 3300005438 Bacteria 5284
74 Ga0070711_100008817 3300005439 Bacteria 6188
75 Ga0070711_100013799 3300005439 Bacteria 5082
76 Ga0070711_100022031 3300005439 Bacteria 4125
77 Ga0070711_100127600 3300005439 Bacteria 1890
78 Ga0070711_100227844 3300005439 Bacteria 1452
79 Ga0070700_100034036 3300005441 Bacteria 3074
80 Ga0070708_100004387 3300005445 Bacteria 11082
81 Ga0070708_100034749 3300005445 Bacteria 4387
82 Ga0070708_100044873 3300005445 Bacteria 3890
83 Ga0070708_100060491 3300005445 Bacteria 3381
84 Ga0070708_100085848 3300005445 Bacteria 2857
85 Ga0070663_100022418 3300005455 Bacteria 4222
86 Ga0070678_100020672 3300005456 Bacteria 4324
87 Ga0070678_100044700 3300005456 Bacteria 3164
88 Ga0070678_100111458 3300005456 Bacteria 2141
89 Ga0070678_100131764 3300005456 Bacteria 1987
90 Ga0070662_100035203 3300005457 Bacteria 3535
91 Ga0070681_10016054 3300005458 Bacteria 7464
92 Ga0070681_10056317 3300005458 Bacteria 3913
93 Ga0070681_10111751 3300005458 Unclassified 2671
94 Ga0070681_10187229 3300005458 Bacteria 1990
95 Ga0070681_10211351 3300005458 Bacteria 1856
96 Ga0070681_10212467 3300005458 Bacteria 1851
97 Ga0070681_10228072 3300005458 Bacteria 1777
98 Ga0068867_100015408 3300005459 Bacteria 5421
99 Ga0068867_100038327 3300005459 Bacteria 3489
100 Ga0068867_100098863 3300005459 Bacteria 2225
101 Ga0070685_10088377 3300005466 Unclassified 1871
102 Ga0070706_100004518 3300005467 Bacteria 13398
103 Ga0070706_100007965 3300005467 Bacteria 9892
104 Ga0070706_100041991 3300005467 Bacteria 4224
105 Ga0070706_100151444 3300005467 Unclassified 2165
106 Ga0070706_100307884 3300005467 Bacteria 1478
107 Ga0070707_100010330 3300005468 Bacteria 8690
108 Ga0070707_100013103 3300005468 Bacteria 7750
109 Ga0070707_100076256 3300005468 Bacteria 3234
110 Ga0070698_100000039 3300005471 Bacteria 91348
111 Ga0070698_100042796 3300005471 Bacteria 4646
112 Ga0070699_100096724 3300005518 Bacteria 2586
113 Ga0070679_100002354 3300005530 Bacteria 17120
114 Ga0070679_100006248 3300005530 Bacteria 11099
115 Ga0070679_100031817 3300005530 Bacteria 5216
116 Ga0070679_100182384 3300005530 Bacteria 2071
117 Ga0070684_100007055 3300005535 Bacteria 8732
118 Ga0070684_100025259 3300005535 Bacteria 4992
119 Ga0070684_100026321 3300005535 Bacteria 4899
120 Ga0070684_100256762 3300005535 Bacteria 1598
121 Ga0070684_100312043 3300005535 Bacteria 1444
122 Ga0070697_100040698 3300005536 Bacteria 3761
123 Ga0070697_100067209 3300005536 Bacteria 2932
124 Ga0070697_100228610 3300005536 Unclassified 1586
125 Ga0068853_100006954 3300005539 Bacteria 9036
126 Ga0068853_100093357 3300005539 Bacteria 2649
127 Ga0068853_100113996 3300005539 Bacteria 2404
128 Ga0068853_100157184 3300005539 Bacteria 2049
129 Ga0070672_100061334 3300005543 Bacteria 2964
130 Ga0070696_100079366 3300005546 Bacteria 2322
131 Ga0070696_100134052 3300005546 Bacteria 1805
132 Ga0070665_100119943 3300005548 Unclassified 2632
133 Ga0070665_100154251 3300005548 Bacteria 2299
134 Ga0070665_100443517 3300005548 Bacteria 1307
135 Ga0068855_100000782 3300005563 Bacteria 39281
136 Ga0068855_100003547 3300005563 Bacteria 19079
137 Ga0068855_100004362 3300005563 Bacteria 17294
138 Ga0068855_100018769 3300005563 Bacteria 8314
139 Ga0068855_100047589 3300005563 Bacteria 5066
140 Ga0068855_100222868 3300005563 Bacteria 2114
141 Ga0070664_100001991 3300005564 Bacteria 16379
142 Ga0070664_100010095 3300005564 Bacteria 7655
143 Ga0068857_100000775 3300005577 Bacteria 23800
144 Ga0068857_100001392 3300005577 Bacteria 19079
145 Ga0068857_100198356 3300005577 Bacteria 1829
146 Ga0068857_100258835 3300005577 Unclassified 1597
147 Ga0068857_100418012 3300005577 Unclassified 1250
148 Ga0068854_100002592 3300005578 Bacteria 11198
149 Ga0068854_100090550 3300005578 Bacteria 2275
150 Ga0068854_100095898 3300005578 Bacteria 2215
151 Ga0068854_100127888 3300005578 Bacteria 1937
152 Ga0068854_100174988 3300005578 Unclassified 1672
153 Ga0068856_100000437 3300005614 Bacteria 45849
154 Ga0068856_100005024 3300005614 Bacteria 13099
155 Ga0068856_100005815 3300005614 Bacteria 12156
156 Ga0068856_100083869 3300005614 Bacteria 3165
157 Ga0068856_100104260 3300005614 Bacteria 2829
158 Ga0068856_100179631 3300005614 Unclassified 2129
159 Ga0068856_100331633 3300005614 Unclassified 1539
160 Ga0070702_100021445 3300005615 Bacteria 3399
161 Ga0068852_100005128 3300005616 Bacteria 9334
162 Ga0068852_100012290 3300005616 Bacteria 6493
163 Ga0068852_100189228 3300005616 Bacteria 1941
164 Ga0068852_100378513 3300005616 Bacteria 1388
165 Ga0068852_100394460 3300005616 Bacteria 1360
166 Ga0068852_100403705 3300005616 Unclassified 1345
167 Ga0068859_100000018 3300005617 Bacteria 248813
168 Ga0068859_100000298 3300005617 Bacteria 49363
169 Ga0068859_100018200 3300005617 Bacteria 7062
170 Ga0068859_100251227 3300005617 Bacteria 1859
171 Ga0068864_100002195 3300005618 Bacteria 16100
172 Ga0068864_100002226 3300005618 Bacteria 16023
173 Ga0068864_100026453 3300005618 Bacteria 4893
174 Ga0068864_100035311 3300005618 Bacteria 4256
175 Ga0068864_100038489 3300005618 Bacteria 4085
176 Ga0068864_100135313 3300005618 Bacteria 2218
177 Ga0068861_100067746 3300005719 Unclassified 2756
178 Ga0068861_100075095 3300005719 Bacteria 2631
179 Ga0068861_100404971 3300005719 Bacteria 1212
180 Ga0068861_100515472 3300005719 Bacteria 1083
181 Ga0068851_10078344 3300005834 Bacteria 1722
182 Ga0068851_10094974 3300005834 Bacteria 1575
183 Ga0068870_10000211 3300005840 Bacteria 21074
184 Ga0068870_10108856 3300005840 Bacteria 1578
185 Ga0068863_100005189 3300005841 Bacteria 12849
186 Ga0068863_100101577 3300005841 Bacteria 2734
187 Ga0068858_100000728 3300005842 Bacteria 34411
188 Ga0068858_100002919 3300005842 Bacteria 17201
189 Ga0068858_100010844 3300005842 Bacteria 8616
190 Ga0068858_100028909 3300005842 Bacteria 5147
191 Ga0068858_100072311 3300005842 Bacteria 3200
192 Ga0068860_100031286 3300005843 Bacteria 5116
193 Ga0068860_100048179 3300005843 Bacteria 4062
194 Ga0068860_100141659 3300005843 Bacteria 2311
195 Ga0068860_100156457 3300005843 Bacteria 2197
196 Ga0068862_100413965 3300005844 Bacteria 1263
197 Ga0070717_10002780 3300006028 Bacteria 12385
198 Ga0070717_10012555 3300006028 Bacteria 6463
199 Ga0070717_10351968 3300006028 Bacteria 1317
200 Ga0070715_10125253 3300006163 Bacteria 1230
201 Ga0070716_100000412 3300006173 Bacteria 17590
202 Ga0070712_100003917 3300006175 Bacteria 9168
203 Ga0070712_100007097 3300006175 Bacteria 6988
204 Ga0070712_100014269 3300006175 Bacteria 5101
205 Ga0070712_100099225 3300006175 Bacteria 2149
206 Ga0070712_100111988 3300006175 Bacteria 2038
207 Ga0075366_10008292 3300006195 Bacteria 5772
208 Ga0097621_100000472 3300006237 Bacteria 28201
209 Ga0097621_100005119 3300006237 Bacteria 9211
210 Ga0097621_100021084 3300006237 Bacteria 5033
211 Ga0097621_100161643 3300006237 Bacteria 1925
212 Ga0097621_100179945 3300006237 Bacteria 1827
213 Ga0097621_100188313 3300006237 Bacteria 1786
214 Ga0068871_100000084 3300006358 Bacteria 53380
215 Ga0068871_100027840 3300006358 Bacteria 4426
216 Ga0068871_100067580 3300006358 Bacteria 2933
217 Ga0068871_100103111 3300006358 Bacteria 2392
218 Ga0068871_100130163 3300006358 Bacteria 2133
219 Ga0068871_100236235 3300006358 Unclassified 1588
220 Ga0075428_100002512 3300006844 Bacteria 19933
221 Ga0075433_10017089 3300006852 Bacteria 5999
222 Ga0075433_10201290 3300006852 Bacteria 1770
223 Ga0075434_100000303 3300006871 Bacteria 34918
224 Ga0075434_100006848 3300006871 Bacteria 10493
225 Ga0075434_100010660 3300006871 Bacteria 8629
226 Ga0075434_100013728 3300006871 Bacteria 7723
227 Ga0075434_100567561 3300006871 Bacteria 1154
228 Ga0068865_100020735 3300006881 Bacteria 4266
229 Ga0068865_100030842 3300006881 Bacteria 3569
230 Ga0068865_100059521 3300006881 Bacteria 2672
231 Ga0068865_100107252 3300006881 Bacteria 2054
232 Ga0068865_100254777 3300006881 Bacteria 1387
233 Ga0075436_100001773 3300006914 Bacteria 14792
234 Ga0075436_100012670 3300006914 Bacteria 5778
235 Ga0075436_100022740 3300006914 Unclassified 4307
236 Ga0075436_100086953 3300006914 Bacteria 2171
237 Ga0097620_100000018 3300006931 Bacteria 248813
238 Ga0097620_100000298 3300006931 Bacteria 49363
239 Ga0097620_100018202 3300006931 Bacteria 7062
240 Ga0097620_100251243 3300006931 Bacteria 1859
241 Ga0075435_100001940 3300007076 Bacteria 13479
242 Ga0075435_100041806 3300007076 Bacteria 3665
243 Ga0105240_10005889 3300009093 Bacteria 18155
244 Ga0105240_10019633 3300009093 Bacteria 9026
245 Ga0105240_10039462 3300009093 Bacteria 6047
246 Ga0105240_10125612 3300009093 Bacteria 3083
247 Ga0105240_10138712 3300009093 Bacteria 2909
248 Ga0105240_10306446 3300009093 Bacteria 1815
249 Ga0111539_10209782 3300009094 Bacteria 2270
250 Ga0105245_10003176 3300009098 Bacteria 14685
251 Ga0105245_10005120 3300009098 Bacteria 11520
252 Ga0105245_10020679 3300009098 Bacteria 5770
253 Ga0105245_10199370 3300009098 Bacteria 1921
254 Ga0105247_10005382 3300009101 Bacteria 8065
255 Ga0105247_10036051 3300009101 Bacteria 3016
256 Ga0105241_10001966 3300009174 Bacteria 15555
257 Ga0105241_10040079 3300009174 Bacteria 3535
258 Ga0105241_10127828 3300009174 Bacteria 2054
259 Ga0105241_10212161 3300009174 Bacteria 1623
260 Ga0105248_10029115 3300009177 Bacteria 6158
261 Ga0105248_10035966 3300009177 Bacteria 5539
262 Ga0105248_10079009 3300009177 Unclassified 3697
263 Ga0105248_10174681 3300009177 Bacteria 2422
264 Ga0105237_10002252 3300009545 Bacteria 24014
265 Ga0105237_10003222 3300009545 Bacteria 19554
266 Ga0105237_10027686 3300009545 Bacteria 5780
267 Ga0105237_10058217 3300009545 Bacteria 3868
268 Ga0105237_10378172 3300009545 Unclassified 1421
269 Ga0105238_10012484 3300009551 Bacteria 8569
270 Ga0105238_10037575 3300009551 Bacteria 4922
271 Ga0105249_10005930 3300009553 Bacteria 10585
272 Ga0105249_10092022 3300009553 Bacteria 2838
273 Ga0105249_10282203 3300009553 Bacteria 1659
274 Ga0105249_10504310 3300009553 Bacteria 1255
275 Ga0105239_10002453 3300010375 Bacteria 23633
276 Ga0105239_10071172 3300010375 Bacteria 3821
277 Ga0105239_10097035 3300010375 Bacteria 3257
278 Ga0105239_10225797 3300010375 Unclassified 2101
279 Ga0105239_10557092 3300010375 Bacteria 1306
280 Ga0105246_10063497 3300011119 Bacteria 2576
281 Ga0105246_10100654 3300011119 Bacteria 2103
282 Ga0105246_10199382 3300011119 Bacteria 1555
283 Ga0157373_10005980 3300013100 Bacteria 9103
284 Ga0157373_10053729 3300013100 Bacteria 2864
285 Ga0157373_10077039 3300013100 Bacteria 2352
286 Ga0157373_10221392 3300013100 Bacteria 1335
287 Ga0157370_10114950 3300013104 Bacteria 2514
288 Ga0157370_10141257 3300013104 Unclassified 2243
289 Ga0157370_10150084 3300013104 Unclassified 2169
290 Ga0157370_10210610 3300013104 Bacteria 1801
291 Ga0157369_10000297 3300013105 Bacteria 66398
292 Ga0157369_10004291 3300013105 Bacteria 16859
293 Ga0157369_10007091 3300013105 Bacteria 12928
294 Ga0157369_10015876 3300013105 Bacteria 8480
295 Ga0157369_10066644 3300013105 Bacteria 3873
296 Ga0157374_10000357 3300013296 Bacteria 42343
297 Ga0157374_10001545 3300013296 Bacteria 19407
298 Ga0157374_10001620 3300013296 Bacteria 18879
299 Ga0157374_10001876 3300013296 Bacteria 17667
300 Ga0157374_10075968 3300013296 Bacteria 3175
301 Ga0157374_10167999 3300013296 Bacteria 2139
302 Ga0157378_10000133 3300013297 Bacteria 70888
303 Ga0157378_10000970 3300013297 Bacteria 26291
304 Ga0157378_10009203 3300013297 Bacteria 8602
305 Ga0157378_10018115 3300013297 Bacteria 6184
306 Ga0157378_10037172 3300013297 Bacteria 4312
307 Ga0157378_10046849 3300013297 Bacteria 3842
308 Ga0163162_10001107 3300013306 Bacteria 24993
309 Ga0163162_10009985 3300013306 Bacteria 9231
310 Ga0163162_10036746 3300013306 Bacteria 4884
311 Ga0157372_10000544 3300013307 Bacteria 41533
312 Ga0157372_10000749 3300013307 Bacteria 35224
313 Ga0157372_10002337 3300013307 Bacteria 20534
314 Ga0157372_10053060 3300013307 Bacteria 4517
315 Ga0157372_10111813 3300013307 Bacteria 3129
316 Ga0157372_10208841 3300013307 Bacteria 2262
317 Ga0157372_10243572 3300013307 Bacteria 2086
318 Ga0157372_10358666 3300013307 Bacteria 1699
319 Ga0157372_10589640 3300013307 Bacteria 1296
320 Ga0157375_10147731 3300013308 Bacteria 2483
321 Ga0157375_10390409 3300013308 Bacteria 1559
322 Ga0163163_10041486 3300014325 Bacteria 4500
323 Ga0163163_10118100 3300014325 Bacteria 2684
324 Ga0163163_10310268 3300014325 Bacteria 1630
325 Ga0157380_10086862 3300014326 Bacteria 2571
326 Ga0157380_10187513 3300014326 Bacteria 1823
327 Ga0182008_10021047 3300014497 Bacteria 3353
328 Ga0157377_10000704 3300014745 Bacteria 13786
329 Ga0157379_10036033 3300014968 Bacteria 4412
330 Ga0157379_10148276 3300014968 Bacteria 2116
331 Ga0157379_10248894 3300014968 Bacteria 1613
332 Ga0157376_10002166 3300014969 Bacteria 13231
333 Ga0157376_10023839 3300014969 Bacteria 4797
334 Ga0157376_10084238 3300014969 Bacteria 2737
335 Ga0157376_10339339 3300014969 Bacteria 1434
336 Ga0182007_10007804 3300015262 Bacteria 4450
337 Ga0163161_10010962 3300017792 Bacteria 6281
338 Ga0228598_1007166 3300024227 Bacteria 2281
339 Ga0207656_10064673 3300025321 Bacteria 1613
340 Ga0207682_10026377 3300025893 Bacteria 2310
341 Ga0207692_10088723 3300025898 Bacteria 1672
342 Ga0207710_10004125 3300025900 Bacteria 6380
343 Ga0207688_10009395 3300025901 Bacteria 5326
344 Ga0207688_10032133 3300025901 Bacteria 2900
345 Ga0207680_10000193 3300025903 Bacteria 29312
346 Ga0207680_10035685 3300025903 Bacteria 2857
347 Ga0207647_10001725 3300025904 Bacteria 16767
348 Ga0207647_10095040 3300025904 Bacteria 1775
349 Ga0207699_10014129 3300025906 Bacteria 4106
350 Ga0207699_10030809 3300025906 Bacteria 3005
351 Ga0207699_10160356 3300025906 Bacteria 1496
352 Ga0207699_10199802 3300025906 Bacteria 1354
353 Ga0207699_10201656 3300025906 Unclassified 1348
354 Ga0207645_10000104 3300025907 Bacteria 62309
355 Ga0207643_10000512 3300025908 Bacteria 24816
356 Ga0207643_10006921 3300025908 Bacteria 6080
357 Ga0207684_10000457 3300025910 Bacteria 53335
358 Ga0207684_10054018 3300025910 Bacteria 3408
359 Ga0207654_10001980 3300025911 Bacteria 10581
360 Ga0207654_10018281 3300025911 Bacteria 3676
361 Ga0207654_10130020 3300025911 Bacteria 1592
362 Ga0207654_10160948 3300025911 Bacteria 1450
363 Ga0207707_10001372 3300025912 Bacteria 22585
364 Ga0207707_10012202 3300025912 Bacteria 7470
365 Ga0207707_10063186 3300025912 Bacteria 3222
366 Ga0207695_10070288 3300025913 Bacteria 3579
367 Ga0207695_10070744 3300025913 Bacteria 3565
368 Ga0207695_10093475 3300025913 Unclassified 3016
369 Ga0207695_10162121 3300025913 Bacteria 2167
370 Ga0207695_10199351 3300025913 Bacteria 1916
371 Ga0207695_10214937 3300025913 Bacteria 1832
372 Ga0207695_10262885 3300025913 Bacteria 1623
373 Ga0207671_10001799 3300025914 Bacteria 23966
374 Ga0207671_10009175 3300025914 Bacteria 8298
375 Ga0207671_10025778 3300025914 Bacteria 4412
376 Ga0207671_10042066 3300025914 Bacteria 3382
377 Ga0207671_10112587 3300025914 Bacteria 2072
378 Ga0207693_10001454 3300025915 Bacteria 20960
379 Ga0207693_10007586 3300025915 Bacteria 8914
380 Ga0207693_10012077 3300025915 Bacteria 6983
381 Ga0207693_10034746 3300025915 Bacteria 3976
382 Ga0207693_10090013 3300025915 Bacteria 2405
383 Ga0207693_10262333 3300025915 Bacteria 1354
384 Ga0207663_10023888 3300025916 Bacteria 3515
385 Ga0207663_10079133 3300025916 Bacteria 2145
386 Ga0207660_10050806 3300025917 Bacteria 2945
387 Ga0207660_10190271 3300025917 Bacteria 1598
388 Ga0207660_10333916 3300025917 Bacteria 1212
389 Ga0207662_10028514 3300025918 Bacteria 3228
390 Ga0207657_10002030 3300025919 Bacteria 21872
391 Ga0207649_10000149 3300025920 Bacteria 57837
392 Ga0207652_10000098 3300025921 Bacteria 94858
393 Ga0207652_10014836 3300025921 Bacteria 6317
394 Ga0207646_10013710 3300025922 Bacteria 7740
395 Ga0207646_10148211 3300025922 Bacteria 2115
396 Ga0207646_10191675 3300025922 Bacteria 1846
397 Ga0207646_10284928 3300025922 Unclassified 1493
398 Ga0207681_10006994 3300025923 Bacteria 6924
399 Ga0207694_10057084 3300025924 Unclassified 3034
400 Ga0207694_10113525 3300025924 Bacteria 2157
401 Ga0207650_10000442 3300025925 Bacteria 35606
402 Ga0207650_10032174 3300025925 Bacteria 3794
403 Ga0207650_10037358 3300025925 Bacteria 3539
404 Ga0207659_10006779 3300025926 Bacteria 7040
405 Ga0207687_10001854 3300025927 Bacteria 14548
406 Ga0207700_10004348 3300025928 Bacteria 8337
407 Ga0207700_10005883 3300025928 Bacteria 7374
408 Ga0207700_10007126 3300025928 Bacteria 6813
409 Ga0207700_10028787 3300025928 Bacteria 3913
410 Ga0207664_10001649 3300025929 Bacteria 14702
411 Ga0207664_10010810 3300025929 Bacteria 6460
412 Ga0207664_10028600 3300025929 Bacteria 4238
413 Ga0207664_10084133 3300025929 Bacteria 2594
414 Ga0207664_10235851 3300025929 Bacteria 1592
415 Ga0207644_10276281 3300025931 Bacteria 1348
416 Ga0207706_10000651 3300025933 Bacteria 36655
417 Ga0207706_10014413 3300025933 Bacteria 7164
418 Ga0207686_10081199 3300025934 Bacteria 2116
419 Ga0207709_10182258 3300025935 Unclassified 1484
420 Ga0207669_10053883 3300025937 Bacteria 2426
421 Ga0207704_10005806 3300025938 Bacteria 5709
422 Ga0207704_10025863 3300025938 Bacteria 3210
423 Ga0207704_10139319 3300025938 Bacteria 1694
424 Ga0207704_10222833 3300025938 Bacteria 1397
425 Ga0207704_10256779 3300025938 Bacteria 1315
426 Ga0207665_10000884 3300025939 Bacteria 20220
427 Ga0207665_10032359 3300025939 Bacteria 3462
428 Ga0207691_10000312 3300025940 Bacteria 48438
429 Ga0207691_10006924 3300025940 Bacteria 10933
430 Ga0207691_10015832 3300025940 Bacteria 7168
431 Ga0207711_10002489 3300025941 Bacteria 16445
432 Ga0207711_10073624 3300025941 Bacteria 2969
433 Ga0207689_10000706 3300025942 Bacteria 32003
434 Ga0207689_10003386 3300025942 Bacteria 14566
435 Ga0207689_10003649 3300025942 Bacteria 14045
436 Ga0207689_10048022 3300025942 Bacteria 3521
437 Ga0207661_10000213 3300025944 Bacteria 37493
438 Ga0207661_10012169 3300025944 Bacteria 6248
439 Ga0207661_10065711 3300025944 Bacteria 2945
440 Ga0207661_10255183 3300025944 Bacteria 1560
441 Ga0207661_10272824 3300025944 Bacteria 1510
442 Ga0207679_10000080 3300025945 Bacteria 84997
443 Ga0207679_10037097 3300025945 Bacteria 3462
444 Ga0207679_10157560 3300025945 Bacteria 1856
445 Ga0207667_10000475 3300025949 Bacteria 53512
446 Ga0207667_10001648 3300025949 Bacteria 28133
447 Ga0207667_10011648 3300025949 Bacteria 10207
448 Ga0207667_10067837 3300025949 Unclassified 3715
449 Ga0207667_10108728 3300025949 Bacteria 2860
450 Ga0207651_10000653 3300025960 Bacteria 14741
451 Ga0207651_10251174 3300025960 Bacteria 1447
452 Ga0207712_10026102 3300025961 Bacteria 3889
453 Ga0207712_10027693 3300025961 Bacteria 3785
454 Ga0207712_10143522 3300025961 Bacteria 1835
455 Ga0207640_10007162 3300025981 Bacteria 6146
456 Ga0207640_10044860 3300025981 Bacteria 2835
457 Ga0207640_10124342 3300025981 Bacteria 1854
458 Ga0207640_10299638 3300025981 Bacteria 1271
459 Ga0207658_10228740 3300025986 Bacteria 1569
460 Ga0207677_10000965 3300026023 Bacteria 15939
461 Ga0207677_10001580 3300026023 Bacteria 12065
462 Ga0207677_10004544 3300026023 Bacteria 7462
463 Ga0207677_10006822 3300026023 Bacteria 6272
464 Ga0207677_10179879 3300026023 Unclassified 1662
465 Ga0207677_10206307 3300026023 Bacteria 1566
466 Ga0207703_10001934 3300026035 Bacteria 18342
467 Ga0207703_10003058 3300026035 Bacteria 14148
468 Ga0207703_10004846 3300026035 Bacteria 10948
469 Ga0207703_10005756 3300026035 Bacteria 9931
470 Ga0207703_10014844 3300026035 Bacteria 6079
471 Ga0207703_10043426 3300026035 Bacteria 3608
472 Ga0207639_10040501 3300026041 Bacteria 3477
473 Ga0207639_10089042 3300026041 Unclassified 2465
474 Ga0207639_10093972 3300026041 Bacteria 2406
475 Ga0207678_10000687 3300026067 Bacteria 30966
476 Ga0207708_10006721 3300026075 Bacteria 8509
477 Ga0207708_10026128 3300026075 Bacteria 4417
478 Ga0207702_10005732 3300026078 Bacteria 10822
479 Ga0207702_10011714 3300026078 Bacteria 7305
480 Ga0207702_10027898 3300026078 Bacteria 4691
481 Ga0207702_10047228 3300026078 Bacteria 3627
482 Ga0207702_10447264 3300026078 Bacteria 1253
483 Ga0207641_10000015 3300026088 Bacteria 321332
484 Ga0207641_10000432 3300026088 Bacteria 48190
485 Ga0207641_10008617 3300026088 Bacteria 8417
486 Ga0207641_10123736 3300026088 Bacteria 2312
487 Ga0207648_10001706 3300026089 Bacteria 24036
488 Ga0207648_10066522 3300026089 Bacteria 3143
489 Ga0207648_10078093 3300026089 Bacteria 2887
490 Ga0207676_10000586 3300026095 Bacteria 29950
491 Ga0207676_10002258 3300026095 Bacteria 13840
492 Ga0207676_10474770 3300026095 Bacteria 1183
493 Ga0207674_10000165 3300026116 Bacteria 79381
494 Ga0207674_10001107 3300026116 Bacteria 35021
495 Ga0207674_10015293 3300026116 Bacteria 8436
496 Ga0207675_100068498 3300026118 Bacteria 3316
497 Ga0207675_100077216 3300026118 Bacteria 3120
498 Ga0207675_100169987 3300026118 Bacteria 2083
499 Ga0207675_100513610 3300026118 Unclassified 1194
500 Ga0207683_10004384 3300026121 Bacteria 12193
501 Ga0207683_10016959 3300026121 Bacteria 6199
502 Ga0207698_10009978 3300026142 Bacteria 6078
503 Ga0207698_10105318 3300026142 Bacteria 2350
504 Ga0268265_10005678 3300028380 Bacteria 8521
505 Ga0268264_10005599 3300028381 Bacteria 10646
506 Ga0268264_10009685 3300028381 Bacteria 7982
507 Ga0268264_10032967 3300028381 Bacteria 4252
508 Ga0268264_10063071 3300028381 Bacteria 3114
509 Ga0268264_10125444 3300028381 Bacteria 2268
510 Ga0307515_10000031 3300028794 Bacteria 358648
511 Ga0307515_10000133 3300028794 Bacteria 176091
512 Ga0265338_10052948 3300028800 Bacteria 3636
513 Ga0265762_1003446 3300030760 Bacteria 2834
514 Ga0265760_10007449 3300031090 Bacteria 3129
515 Ga0265760_10008099 3300031090 Bacteria 3002
516 Ga0265760_10016441 3300031090 Bacteria 2123
517 Ga0265325_10001387 3300031241 Bacteria 17099
518 Ga0265325_10027690 3300031241 Bacteria 3061
519 Ga0265339_10004017 3300031249 Bacteria 10174
520 Ga0265339_10016016 3300031249 Bacteria 4479
521 Ga0265331_10014653 3300031250 Bacteria 4166
522 Ga0265316_10006073 3300031344 Bacteria 11591
523 Ga0265316_10011504 3300031344 Bacteria 7973
524 Ga0265316_10015996 3300031344 Bacteria 6528
525 Ga0307509_10044659 3300031507 Bacteria 4786
526 Ga0307408_100022706 3300031548 Bacteria 4266
527 Ga0265313_10005589 3300031595 Bacteria 9196
528 Ga0307508_10004635 3300031616 Bacteria 13350
529 Ga0307514_10019165 3300031649 Bacteria 5601
530 Ga0316575_10008094 3300031665 Bacteria 3822
531 Ga0316579_10003282 3300031691 Bacteria 6280
532 Ga0265314_10001960 3300031711 Bacteria 21893
533 Ga0265314_10005810 3300031711 Bacteria 11052
534 Ga0265314_10138090 3300031711 Bacteria 1511
535 Ga0316576_10031932 3300031727 Bacteria 3740
536 Ga0316578_10099723 3300031728 Unclassified 1740
537 Ga0316577_10123048 3300031733 Unclassified 1458
538 Ga0307410_10024366 3300031852 Bacteria 3779
539 Ga0307407_10061268 3300031903 Bacteria 2199
540 Ga0307409_100000699 3300031995 Bacteria 14940
541 Ga0307416_100023449 3300032002 Bacteria 4479
542 Ga0307411_10003407 3300032005 Bacteria 7371
543 Ga0307411_10011260 3300032005 Bacteria 4817
544 Ga0316583_10021225 3300032133 Unclassified 2328
545 Ga0316585_10005751 3300032137 Bacteria 3510
546 Ga0307510_10004925 3300033180 Bacteria 15802
547 Ga0373934_0027441 3300035086 Bacteria 2213
548 Ga0373936_0085152 3300035113 Bacteria 1320
549 Ga0373956_0007195 3300035119 Bacteria 4483
550 Ga0373956_0025356 3300035119 Bacteria 2562
551 Ga0373943_0082046 3300035170 Bacteria 1655
552 Ga0373943_0211543 3300035170 Bacteria 1077
553 Ga0373955_0023631 3300035172 Bacteria 3133
554 Ga0316574_0082453 3300035398 Unclassified 2043
555 Ga0373931_0033111 3300035691 Bacteria 2677
556 Ga0373931_0091653 3300035691 Bacteria 1694
557 Ga0373935_0005093 3300035692 Bacteria 7746
558 Ga0373927_0043324 3300035695 Bacteria 2914
559 Ga0373927_0162460 3300035695 Bacteria 1463
560 Ga0373927_0227235 3300035695 Bacteria 1226
561 Ga0373933_0000545 3300035724 Bacteria 23433
562 Ga0373947_0227224 3300035725 Unclassified 1228
563 Ga0373937_0000074 3300036401 Bacteria 91289
564 Ga0373937_0000827 3300036401 Bacteria 26530
565 Ga0373937_0013056 3300036401 Bacteria 7316
566 Ga0373937_0128313 3300036401 Bacteria 2367
567 Ga0373937_0180135 3300036401 Bacteria 1984
568 Ga0373937_0388890 3300036401 Bacteria 1323
569 Ga0316582_0061461 3300036647 Unclassified 2409
570 Ga0316582_0096846 3300036647 Bacteria 1949
571 Ga0316584_0044986 3300036712 Unclassified 3293
572 Ga0373925_0003807 3300037068 Bacteria 11585
573 Ga0373925_0079754 3300037068 Bacteria 2487
574 Ga0395899_0002500 3300037312 Bacteria 14918
575 Ga0395899_0071908 3300037312 Bacteria 2531
576 Ga0395900_0006705 3300037418 Bacteria 11964
577 Ga0395900_0041142 3300037418 Bacteria 4765
578 Ga0395898_0001101 3300037466 Bacteria 41709
579 Ga0395901_0022924 3300038443 Bacteria 6400
580 Ga0400489_01028 3300039093 Bacteria 1027
581 Ga0436365_0595099 3300039437 Bacteria 1447
582 Ga0439445_0007815 3300042004 Bacteria 2491
583 Ga0451577_0022384 3300042876 Bacteria 5770
584 Ga0451577_0155216 3300042876 Bacteria 2060
585 Ga0451577_0202955 3300042876 Bacteria 1790
586 Ga0466963_0222045 3300044694 Unclassified 1323
587 Ga0453684_0007454 3300044712 Bacteria 20093
588 Ga0466957_0022232 3300044842 Bacteria 3739
589 Ga0466957_0225036 3300044842 Unclassified 1240
590 Ga0466959_0004141 3300045049 Bacteria 9660
591 Ga0466959_0104947 3300045049 Bacteria 2021
592 Ga0451576_0003645 3300045051 Bacteria 20903
593 Ga0451576_0015526 3300045051 Bacteria 8431
594 Ga0451576_0059225 3300045051 Bacteria 3999
595 Ga0451576_0161748 3300045051 Bacteria 2337
596 Ga0451576_0170572 3300045051 Unclassified 2271
597 Ga0466958_0020168 3300045836 Bacteria 3886
598 Ga0466967_0032255 3300045976 Unclassified 4421
599 Ga0466967_0045037 3300045976 Bacteria 3832
600 Ga0466967_0052110 3300045976 Bacteria 3590
601 Ga0466967_0201009 3300045976 Unclassified 1887
602 Ga0466967_0302039 3300045976 Bacteria 1540
603 Ga0495651_0001464 3300046462 Bacteria 18261
604 Ga0495651_0176196 3300046462 Bacteria 1518
605 Ga0495653_0045441 3300046463 Bacteria 3405
606 Ga0495580_0000223 3300046472 Bacteria 44018
607 Ga0495580_0002222 3300046472 Bacteria 16974
608 Ga0495580_0012137 3300046472 Bacteria 6626
609 Ga0495580_0037632 3300046472 Bacteria 3470
610 Ga0495580_0037850 3300046472 Bacteria 3459
611 Ga0495580_0043029 3300046472 Bacteria 3215
612 Ga0495580_0085538 3300046472 Bacteria 2196
613 Ga0495582_0010349 3300046473 Bacteria 5132
614 Ga0495594_0072602 3300046499 Bacteria 1915
615 Ga0495606_0037411 3300046507 Bacteria 3297
616 Ga0495608_0106130 3300046511 Bacteria 1808
617 Ga0495652_0135735 3300046529 Bacteria 1941
618 Ga0495665_0008695 3300046531 Bacteria 5512
619 Ga0495586_0082604 3300046535 Bacteria 1767
620 Ga0495587_0000113 3300046536 Bacteria 61684
621 Ga0495645_0013197 3300046543 Bacteria 5842
622 Ga0495667_0095675 3300046559 Unclassified 1923
623 Ga0495667_0117257 3300046559 Bacteria 1720
624 Ga0495634_0112444 3300046642 Bacteria 1750
625 Ga0495625_0064441 3300046660 Bacteria 2585
626 Ga0495599_0336704 3300046678 Bacteria 906
627 Ga0495623_0064847 3300046679 Bacteria 2285
628 Ga0495647_0006947 3300046681 Bacteria 3771
629 Ga0495658_0034724 3300046683 Bacteria 2769
630 Ga0495669_0038467 3300046684 Bacteria 2119
631 Ga0495669_0135431 3300046684 Bacteria 1161
632 Ga0495669_0150902 3300046684 Bacteria 1100
633 Ga0495649_0004267 3300046694 Bacteria 9378
634 Ga0495604_0021951 3300047317 Bacteria 5095
635 Ga0495680_0079534 3300047322 Bacteria 2479
636 Ga0495675_0000317 3300047444 Bacteria 34404
637 Ga0495686_0000473 3300047472 Bacteria 59965
638 Ga0495602_0000069 3300048088 Bacteria 101160
639 Ga0495602_0107559 3300048088 Unclassified 2273
640 Ga0496100_0069823 3300048903 Bacteria 2341
641 Ga0496102_0074118 3300048905 Bacteria 3129
642 Ga0496102_0075100 3300048905 Bacteria 3107
643 Ga0496102_0145760 3300048905 Bacteria 2222
644 Ga0496102_0241491 3300048905 Bacteria 1703
645 Ga0496103_0005215 3300048906 Bacteria 7808
646 Ga0496104_0109708 3300048907 Bacteria 2645
647 Ga0496105_0013709 3300048908 Bacteria 6436
648 Ga0496105_0060775 3300048908 Bacteria 3118
649 Ga0496108_0000228 3300048911 Bacteria 50279
650 Ga0496109_0000362 3300048912 Bacteria 42175
651 Ga0496110_0012685 3300048913 Bacteria 6935
652 Ga0496110_0137359 3300048913 Unclassified 2209
653 Ga0496111_0001468 3300048914 Bacteria 13488
654 Ga0496111_0028145 3300048914 Bacteria 3981
655 Ga0496111_0346327 3300048914 Unclassified 1100
656 Ga0496112_0000034 3300048915 Bacteria 107237
657 Ga0496112_0003539 3300048915 Bacteria 12966
658 Ga0496112_0035814 3300048915 Bacteria 4837
659 Ga0496112_0038831 3300048915 Bacteria 4651
660 Ga0496112_0047241 3300048915 Unclassified 4223
661 Ga0496112_0066889 3300048915 Bacteria 3546
662 Ga0496112_0081759 3300048915 Bacteria 3195
663 Ga0496112_0101844 3300048915 Unclassified 2842
664 Ga0496113_0000391 3300048916 Bacteria 21186
665 Ga0496113_0448522 3300048916 Unclassified 1036
666 Ga0496115_0101896 3300048918 Bacteria 2354
667 Ga0496115_0197690 3300048918 Unclassified 1661
668 Ga0501034_0024828 3300049571 Bacteria 6098
669 Ga0501038_0121881 3300049574 Bacteria 2149
670 Ga0501076_0202829 3300049592 Bacteria 1620
671 Ga0501044_0181513 3300049823 Bacteria 2071
672 nmdc:mga0k408_7554_c1 3300050493 Bacteria 5806
673 nmdc:mga0n895_15786_c1 3300050512 Bacteria 6904
674 nmdc:mga0n895_3115_c1 3300050512 Bacteria 13216
675 nmdc:mga0n895_327185_c1 3300050512 Bacteria 1553
676 nmdc:mga0n895_6567_c1 3300050512 Bacteria 9899
677 nmdc:mga0rr50_1398_c1 3300050513 Bacteria 13221
678 nmdc:mga0rr50_511127_c1 3300050513 Unclassified 1022
679 nmdc:mga08x19_17986_c1 3300050514 Unclassified 4329
680 nmdc:mga08x19_185975_c1 3300050514 Bacteria 1420
681 nmdc:mga08x19_46063_c1 3300050514 Unclassified 2788
682 nmdc:mga08x19_5765_c1 3300050514 Bacteria 7323
683 nmdc:mga08x19_9044_c1 3300050514 Bacteria 5946
684 nmdc:mga0a205_1031_c1 3300050515 Bacteria 15759
685 nmdc:mga0a205_493912_c1 3300050515 Unclassified 1081
686 Ga0495601_0037734 3300053077 Unclassified 3020
687 Ga0466962_0051791 3300061719 Bacteria 1963

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0071908 Ga0395899_0071908_1612_2514 268
2 3300046678 Ga0495599_0336704 Ga0495599_0336704_25_879 281
3 3300048915 Ga0496112_0081759 Ga0496112_0081759_41_910 283
4 3300005530 Ga0070679_100002354 Ga0070679_10000235412 284
5 3300025921 Ga0207652_10000098 Ga0207652_1000009876 284
6 3300037312 Ga0395899_0002500 Ga0395899_0002500_1857_2819 284
7 3300037418 Ga0395900_0006705 Ga0395900_0006705_8340_9302 284
8 3300037418 Ga0395900_0041142 Ga0395900_0041142_1116_2078 284
9 3300037466 Ga0395898_0001101 Ga0395898_0001101_10008_10970 284
10 3300038443 Ga0395901_0022924 Ga0395901_0022924_2635_3597 284
11 3300048918 Ga0496115_0197690 Ga0496115_0197690_38_907 285
12 3300037068 Ga0373925_0079754 Ga0373925_0079754_1571_2470 296
13 3300025938 Ga0207704_10222833 Ga0207704_102228331 302
14 3300035695 Ga0373927_0162460 Ga0373927_0162460_520_1443 304
15 3300005456 Ga0070678_100111458 Ga0070678_1001114581 305
16 3300025931 Ga0207644_10276281 Ga0207644_102762812 305
17 3300025940 Ga0207691_10015832 Ga0207691_100158323 305
18 3300006237 Ga0097621_100005119 Ga0097621_10000511911 306
19 3300006358 Ga0068871_100027840 Ga0068871_1000278402 306
20 3300013297 Ga0157378_10037172 Ga0157378_100371722 306
21 3300014969 Ga0157376_10002166 Ga0157376_100021661 306
22 3300005435 Ga0070714_100105981 Ga0070714_1001059812 307
23 3300005439 Ga0070711_100127600 Ga0070711_1001276001 307
24 3300005578 Ga0068854_100090550 Ga0068854_1000905503 307
25 3300006237 Ga0097621_100188313 Ga0097621_1001883132 307
26 3300006358 Ga0068871_100130163 Ga0068871_1001301632 307
27 3300009174 Ga0105241_10040079 Ga0105241_100400792 307
28 3300009545 Ga0105237_10027686 Ga0105237_100276864 307
29 3300010375 Ga0105239_10557092 Ga0105239_105570921 307
30 3300013104 Ga0157370_10141257 Ga0157370_101412572 307
31 3300013105 Ga0157369_10066644 Ga0157369_100666442 307
32 3300013296 Ga0157374_10167999 Ga0157374_101679992 307
33 3300013307 Ga0157372_10208841 Ga0157372_102088412 307
34 3300025911 Ga0207654_10018281 Ga0207654_100182812 307
35 3300025914 Ga0207671_10042066 Ga0207671_100420662 307
36 3300026078 Ga0207702_10047228 Ga0207702_100472282 307
37 3300048915 Ga0496112_0066889 Ga0496112_0066889_152_1132 307
38 3300031665 Ga0316575_10008094 Ga0316575_100080945 308
39 3300031691 Ga0316579_10003282 Ga0316579_100032825 308
40 3300031727 Ga0316576_10031932 Ga0316576_100319325 308
41 3300031728 Ga0316578_10099723 Ga0316578_100997231 308
42 3300032133 Ga0316583_10021225 Ga0316583_100212253 308
43 3300032137 Ga0316585_10005751 Ga0316585_100057514 308
44 3300035398 Ga0316574_0082453 Ga0316574_0082453_611_1588 308
45 3300036647 Ga0316582_0061461 Ga0316582_0061461_149_1126 308
46 3300036712 Ga0316584_0044986 Ga0316584_0044986_2173_3150 308
47 3300005530 Ga0070679_100182384 Ga0070679_1001823842 310
48 3300005546 Ga0070696_100134052 Ga0070696_1001340521 310
49 3300006871 Ga0075434_100567561 Ga0075434_1005675612 311
50 3300035695 Ga0373927_0043324 Ga0373927_0043324_713_1693 311
51 3300046472 Ga0495580_0037850 Ga0495580_0037850_1087_2067 311
52 3300050512 nmdc:mga0n895_327185_c1 nmdc:mga0n895_327185_c1_450_1415 311
53 3300003316 rootH1_10087392 rootH1_100873924 312
54 3300005467 Ga0070706_100307884 Ga0070706_1003078842 312
55 3300010375 Ga0105239_10071172 Ga0105239_100711723 312
56 3300046507 Ga0495606_0037411 Ga0495606_0037411_1236_2222 312
57 3300046642 Ga0495634_0112444 Ga0495634_0112444_300_1256 312
58 3300046694 Ga0495649_0004267 Ga0495649_0004267_5953_6939 312
59 iso_pu_bacteria 2919138771 2919139599 312
60 3300006852 Ga0075433_10201290 Ga0075433_102012901 313
61 3300009177 Ga0105248_10029115 Ga0105248_100291153 313
62 3300014325 Ga0163163_10310268 Ga0163163_103102682 313
63 3300025934 Ga0207686_10081199 Ga0207686_100811992 313
64 3300035113 Ga0373936_0085152 Ga0373936_0085152_253_1212 313
65 3300035170 Ga0373943_0211543 Ga0373943_0211543_100_1062 313
66 3300036401 Ga0373937_0388890 Ga0373937_0388890_225_1187 313
67 3300042876 Ga0451577_0155216 Ga0451577_0155216_611_1570 313
68 3300042876 Ga0451577_0202955 Ga0451577_0202955_52_1020 313
69 3300044712 Ga0453684_0007454 Ga0453684_0007454_5085_6083 313
70 3300045051 Ga0451576_0003645 Ga0451576_0003645_6756_7715 313
71 3300045051 Ga0451576_0059225 Ga0451576_0059225_1575_2543 313
72 3300045051 Ga0451576_0170572 Ga0451576_0170572_19_978 313
73 3300046535 Ga0495586_0082604 Ga0495586_0082604_516_1478 313
74 3300046683 Ga0495658_0034724 Ga0495658_0034724_621_1583 313
75 3300047322 Ga0495680_0079534 Ga0495680_0079534_1138_2100 313
76 3300003320 rootH2_10017798 rootH2_1001779811 314
77 3300005331 Ga0070670_100098527 Ga0070670_1000985271 314
78 3300005335 Ga0070666_10000112 Ga0070666_1000011211 314
79 3300005338 Ga0068868_100008985 Ga0068868_1000089852 314
80 3300005341 Ga0070691_10018185 Ga0070691_100181852 314
81 3300005365 Ga0070688_100254182 Ga0070688_1002541821 314
82 3300005367 Ga0070667_100017599 Ga0070667_1000175994 314
83 3300005466 Ga0070685_10088377 Ga0070685_100883771 314
84 3300005536 Ga0070697_100040698 Ga0070697_1000406984 314
85 3300005616 Ga0068852_100005128 Ga0068852_1000051282 314
86 3300005616 Ga0068852_100394460 Ga0068852_1003944602 314
87 3300005617 Ga0068859_100000018 Ga0068859_10000001855 314
88 3300005618 Ga0068864_100002226 Ga0068864_10000222613 314
89 3300005618 Ga0068864_100026453 Ga0068864_1000264536 314
90 3300005719 Ga0068861_100404971 Ga0068861_1004049711 314
91 3300005834 Ga0068851_10078344 Ga0068851_100783442 314
92 3300005834 Ga0068851_10094974 Ga0068851_100949742 314
93 3300005841 Ga0068863_100005189 Ga0068863_10000518911 314
94 3300005842 Ga0068858_100002919 Ga0068858_1000029192 314
95 3300006237 Ga0097621_100179945 Ga0097621_1001799452 314
96 3300006931 Ga0097620_100000018 Ga0097620_10000001855 314
97 3300009098 Ga0105245_10199370 Ga0105245_101993702 314
98 3300009101 Ga0105247_10005382 Ga0105247_100053822 314
99 3300009174 Ga0105241_10001966 Ga0105241_1000196614 314
100 3300009174 Ga0105241_10127828 Ga0105241_101278282 314
101 3300009545 Ga0105237_10002252 Ga0105237_1000225215 314
102 3300009545 Ga0105237_10003222 Ga0105237_100032223 314
103 3300009553 Ga0105249_10005930 Ga0105249_100059303 314
104 3300009553 Ga0105249_10504310 Ga0105249_105043102 314
105 3300010375 Ga0105239_10097035 Ga0105239_100970352 314
106 3300011119 Ga0105246_10199382 Ga0105246_101993822 314
107 3300013297 Ga0157378_10018115 Ga0157378_100181156 314
108 3300013306 Ga0163162_10001107 Ga0163162_1000110710 314
109 3300014968 Ga0157379_10248894 Ga0157379_102488942 314
110 3300025321 Ga0207656_10064673 Ga0207656_100646731 314
111 3300025900 Ga0207710_10004125 Ga0207710_100041252 314
112 3300025903 Ga0207680_10000193 Ga0207680_100001932 314
113 3300025911 Ga0207654_10001980 Ga0207654_1000198011 314
114 3300025911 Ga0207654_10130020 Ga0207654_101300201 314
115 3300025914 Ga0207671_10001799 Ga0207671_100017999 314
116 3300025914 Ga0207671_10009175 Ga0207671_100091751 314
117 3300025924 Ga0207694_10113525 Ga0207694_101135252 314
118 3300025935 Ga0207709_10182258 Ga0207709_101822581 314
119 3300025942 Ga0207689_10003649 Ga0207689_100036493 314
120 3300025961 Ga0207712_10026102 Ga0207712_100261023 314
121 3300026023 Ga0207677_10004544 Ga0207677_100045445 314
122 3300026023 Ga0207677_10206307 Ga0207677_102063072 314
123 3300026035 Ga0207703_10001934 Ga0207703_100019342 314
124 3300026035 Ga0207703_10043426 Ga0207703_100434263 314
125 3300026088 Ga0207641_10000015 Ga0207641_1000001550 314
126 3300026118 Ga0207675_100169987 Ga0207675_1001699872 314
127 3300026142 Ga0207698_10009978 Ga0207698_100099786 314
128 3300028381 Ga0268264_10009685 Ga0268264_100096854 314
129 3300028794 Ga0307515_10000031 Ga0307515_10000031213 314
130 3300031507 Ga0307509_10044659 Ga0307509_100446593 314
131 3300031616 Ga0307508_10004635 Ga0307508_1000463510 314
132 3300033180 Ga0307510_10004925 Ga0307510_100049257 314
133 3300042004 Ga0439445_0007815 Ga0439445_0007815_1422_2396 314
134 3300045051 Ga0451576_0015526 Ga0451576_0015526_6501_7469 314
135 3300045051 Ga0451576_0161748 Ga0451576_0161748_941_1909 314
136 3300046660 Ga0495625_0064441 Ga0495625_0064441_817_1782 314
137 3300049571 Ga0501034_0024828 Ga0501034_0024828_4363_5325 314
138 3300049574 Ga0501038_0121881 Ga0501038_0121881_420_1391 314
139 3300005328 Ga0070676_10103438 Ga0070676_101034382 315
140 3300005335 Ga0070666_10194478 Ga0070666_101944782 315
141 3300005366 Ga0070659_100110688 Ga0070659_1001106883 315
142 3300005439 Ga0070711_100008817 Ga0070711_1000088173 315
143 3300005441 Ga0070700_100034036 Ga0070700_1000340363 315
144 3300005445 Ga0070708_100044873 Ga0070708_1000448732 315
145 3300005456 Ga0070678_100020672 Ga0070678_1000206722 315
146 3300005459 Ga0068867_100098863 Ga0068867_1000988632 315
147 3300005539 Ga0068853_100157184 Ga0068853_1001571842 315
148 3300005548 Ga0070665_100154251 Ga0070665_1001542513 315
149 3300005617 Ga0068859_100251227 Ga0068859_1002512272 315
150 3300005618 Ga0068864_100035311 Ga0068864_1000353113 315
151 3300005719 Ga0068861_100515472 Ga0068861_1005154721 315
152 3300005840 Ga0068870_10108856 Ga0068870_101088562 315
153 3300005843 Ga0068860_100048179 Ga0068860_1000481793 315
154 3300005844 Ga0068862_100413965 Ga0068862_1004139652 315
155 3300006195 Ga0075366_10008292 Ga0075366_100082924 315
156 3300006871 Ga0075434_100013728 Ga0075434_1000137287 315
157 3300006881 Ga0068865_100059521 Ga0068865_1000595214 315
158 3300006914 Ga0075436_100012670 Ga0075436_1000126702 315
159 3300006931 Ga0097620_100251243 Ga0097620_1002512432 315
160 3300009094 Ga0111539_10209782 Ga0111539_102097824 315
161 3300013306 Ga0163162_10036746 Ga0163162_100367465 315
162 3300014326 Ga0157380_10086862 Ga0157380_100868622 315
163 3300025901 Ga0207688_10009395 Ga0207688_100093956 315
164 3300025908 Ga0207643_10006921 Ga0207643_100069212 315
165 3300025910 Ga0207684_10054018 Ga0207684_100540183 315
166 3300025933 Ga0207706_10014413 Ga0207706_100144137 315
167 3300025938 Ga0207704_10256779 Ga0207704_102567792 315
168 3300025940 Ga0207691_10000312 Ga0207691_1000031210 315
169 3300025942 Ga0207689_10048022 Ga0207689_100480225 315
170 3300025986 Ga0207658_10228740 Ga0207658_102287402 315
171 3300026075 Ga0207708_10006721 Ga0207708_100067212 315
172 3300026089 Ga0207648_10078093 Ga0207648_100780932 315
173 3300026095 Ga0207676_10474770 Ga0207676_104747701 315
174 3300026118 Ga0207675_100077216 Ga0207675_1000772164 315
175 3300026121 Ga0207683_10016959 Ga0207683_100169592 315
176 3300028381 Ga0268264_10125444 Ga0268264_101254443 315
177 3300028794 Ga0307515_10000133 Ga0307515_1000013387 315
178 3300031649 Ga0307514_10019165 Ga0307514_100191654 315
179 3300049592 Ga0501076_0202829 Ga0501076_0202829_321_1274 315
180 3300050493 nmdc:mga0k408_7554_c1 nmdc:mga0k408_7554_c1_2498_3475 315
181 3300005445 Ga0070708_100004387 Ga0070708_1000043877 316
182 3300005445 Ga0070708_100060491 Ga0070708_1000604912 316
183 3300005467 Ga0070706_100004518 Ga0070706_1000045187 316
184 3300005467 Ga0070706_100007965 Ga0070706_1000079653 316
185 3300005467 Ga0070706_100151444 Ga0070706_1001514442 316
186 3300005468 Ga0070707_100010330 Ga0070707_1000103308 316
187 3300005471 Ga0070698_100000039 Ga0070698_10000003911 316
188 3300005471 Ga0070698_100042796 Ga0070698_1000427963 316
189 3300005536 Ga0070697_100067209 Ga0070697_1000672092 316
190 3300006844 Ga0075428_100002512 Ga0075428_1000025125 316
191 3300025910 Ga0207684_10000457 Ga0207684_100004573 316
192 3300025922 Ga0207646_10013710 Ga0207646_100137105 316
193 3300031733 Ga0316577_10123048 Ga0316577_101230481 316
194 3300036647 Ga0316582_0096846 Ga0316582_0096846_434_1435 316
195 3300042876 Ga0451577_0022384 Ga0451577_0022384_2176_3144 316
196 3300046472 Ga0495580_0012137 Ga0495580_0012137_743_1702 316
197 3300046472 Ga0495580_0037632 Ga0495580_0037632_2323_3282 316
198 3300046473 Ga0495582_0010349 Ga0495582_0010349_1646_2605 316
199 3300046681 Ga0495647_0006947 Ga0495647_0006947_1099_2058 316
200 3300049823 Ga0501044_0181513 Ga0501044_0181513_233_1216 316
201 3300005435 Ga0070714_100413684 Ga0070714_1004136841 317
202 3300005436 Ga0070713_100061504 Ga0070713_1000615041 317
203 3300005445 Ga0070708_100085848 Ga0070708_1000858483 317
204 3300005518 Ga0070699_100096724 Ga0070699_1000967242 317
205 3300009093 Ga0105240_10019633 Ga0105240_100196339 317
206 3300025906 Ga0207699_10201656 Ga0207699_102016561 317
207 3300025922 Ga0207646_10191675 Ga0207646_101916752 317
208 3300031090 Ga0265760_10007449 Ga0265760_100074493 317
209 3300031090 Ga0265760_10016441 Ga0265760_100164412 317
210 3300031241 Ga0265325_10001387 Ga0265325_100013877 317
211 3300031241 Ga0265325_10027690 Ga0265325_100276903 317
212 3300031250 Ga0265331_10014653 Ga0265331_100146534 317
213 3300031344 Ga0265316_10011504 Ga0265316_100115046 317
214 3300031595 Ga0265313_10005589 Ga0265313_100055893 317
215 3300035119 Ga0373956_0007195 Ga0373956_0007195_812_1912 317
216 3300035172 Ga0373955_0023631 Ga0373955_0023631_1439_2539 317
217 3300035724 Ga0373933_0000545 Ga0373933_0000545_6617_7717 317
218 3300036401 Ga0373937_0000074 Ga0373937_0000074_63948_64958 317
219 3300039093 Ga0400489_01028 Ga0400489_01028_16_975 317
220 3300046462 Ga0495651_0001464 Ga0495651_0001464_14636_15646 317
221 3300046463 Ga0495653_0045441 Ga0495653_0045441_1430_2440 317
222 3300046511 Ga0495608_0106130 Ga0495608_0106130_228_1238 317
223 3300046536 Ga0495587_0000113 Ga0495587_0000113_4253_5263 317
224 3300047317 Ga0495604_0021951 Ga0495604_0021951_3211_4311 317
225 3300047444 Ga0495675_0000317 Ga0495675_0000317_6093_7103 317
226 3300047472 Ga0495686_0000473 Ga0495686_0000473_29691_30665 317
227 3300048088 Ga0495602_0000069 Ga0495602_0000069_33622_34722 317
228 3300053077 Ga0495601_0037734 Ga0495601_0037734_220_1209 317
229 3300005458 Ga0070681_10212467 Ga0070681_102124671 320
230 3300025917 Ga0207660_10190271 Ga0207660_101902712 320
231 3300044842 Ga0466957_0022232 Ga0466957_0022232_1492_2454 320
232 3300003322 rootL2_10180054 rootL2_101800541 321
233 3300005435 Ga0070714_100059609 Ga0070714_1000596093 321
234 3300005458 Ga0070681_10187229 Ga0070681_101872291 321
235 3300005548 Ga0070665_100443517 Ga0070665_1004435171 321
236 3300006914 Ga0075436_100001773 Ga0075436_1000017735 321
237 3300013307 Ga0157372_10358666 Ga0157372_103586661 321
238 3300013307 Ga0157372_10589640 Ga0157372_105896401 321
239 3300025926 Ga0207659_10006779 Ga0207659_100067796 321
240 3300025929 Ga0207664_10084133 Ga0207664_100841332 321
241 3300035725 Ga0373947_0227224 Ga0373947_0227224_100_1065 321
242 3300050514 nmdc:mga08x19_5765_c1 nmdc:mga08x19_5765_c1_645_1610 321
243 3300005293 Ga0065715_10151838 Ga0065715_101518382 322
244 3300005337 Ga0070682_100060727 Ga0070682_1000607273 322
245 3300005355 Ga0070671_100145196 Ga0070671_1001451962 322
246 3300005439 Ga0070711_100013799 Ga0070711_1000137993 322
247 3300005458 Ga0070681_10111751 Ga0070681_101117513 322
248 3300005535 Ga0070684_100026321 Ga0070684_1000263215 322
249 3300005577 Ga0068857_100418012 Ga0068857_1004180121 322
250 3300005614 Ga0068856_100083869 Ga0068856_1000838692 322
251 3300006163 Ga0070715_10125253 Ga0070715_101252531 322
252 3300006175 Ga0070712_100099225 Ga0070712_1000992253 322
253 3300009098 Ga0105245_10003176 Ga0105245_100031766 322
254 3300025915 Ga0207693_10034746 Ga0207693_100347463 322
255 3300025916 Ga0207663_10023888 Ga0207663_100238883 322
256 3300025927 Ga0207687_10001854 Ga0207687_100018548 322
257 3300025939 Ga0207665_10032359 Ga0207665_100323592 322
258 3300025944 Ga0207661_10255183 Ga0207661_102551831 322
259 3300025949 Ga0207667_10067837 Ga0207667_100678372 322
260 3300025981 Ga0207640_10044860 Ga0207640_100448604 322
261 3300035119 Ga0373956_0025356 Ga0373956_0025356_1145_2122 322
262 3300046529 Ga0495652_0135735 Ga0495652_0135735_72_1049 322
263 3300046559 Ga0495667_0117257 Ga0495667_0117257_608_1585 322
264 3300046684 Ga0495669_0150902 Ga0495669_0150902_73_1062 323
265 3300048088 Ga0495602_0107559 Ga0495602_0107559_537_1550 323
266 3300031344 Ga0265316_10006073 Ga0265316_1000607311 326
267 3300031711 Ga0265314_10001960 Ga0265314_1000196012 326
268 3300045976 Ga0466967_0052110 Ga0466967_0052110_1551_2531 326
269 3300005434 Ga0070709_10012407 Ga0070709_100124076 327
270 3300005437 Ga0070710_10160127 Ga0070710_101601271 327
271 3300005439 Ga0070711_100227844 Ga0070711_1002278442 327
272 3300006871 Ga0075434_100000303 Ga0075434_10000030325 327
273 3300006914 Ga0075436_100022740 Ga0075436_1000227403 327
274 3300007076 Ga0075435_100001940 Ga0075435_10000194012 327
275 3300025898 Ga0207692_10088723 Ga0207692_100887233 327
276 3300031548 Ga0307408_100022706 Ga0307408_1000227062 327
277 3300045049 Ga0466959_0004141 Ga0466959_0004141_2751_3734 327
278 3300045976 Ga0466967_0032255 Ga0466967_0032255_1105_2088 327
279 3300048905 Ga0496102_0145760 Ga0496102_0145760_700_1689 327
280 3300050512 nmdc:mga0n895_3115_c1 nmdc:mga0n895_3115_c1_11872_12885 327
281 3300050513 nmdc:mga0rr50_1398_c1 nmdc:mga0rr50_1398_c1_9796_10809 327
282 3300050514 nmdc:mga08x19_17986_c1 nmdc:mga08x19_17986_c1_2470_3483 327
283 3300004803 Ga0058862_10076746 Ga0058862_100767462 328
284 3300005329 Ga0070683_100163742 Ga0070683_1001637422 328
285 3300005336 Ga0070680_100037547 Ga0070680_1000375473 328
286 3300005337 Ga0070682_100020328 Ga0070682_1000203283 328
287 3300005458 Ga0070681_10056317 Ga0070681_100563173 328
288 3300005458 Ga0070681_10211351 Ga0070681_102113512 328
289 3300005530 Ga0070679_100031817 Ga0070679_1000318173 328
290 3300005563 Ga0068855_100222868 Ga0068855_1002228681 328
291 3300005578 Ga0068854_100174988 Ga0068854_1001749881 328
292 3300005614 Ga0068856_100179631 Ga0068856_1001796312 328
293 3300005614 Ga0068856_100331633 Ga0068856_1003316332 328
294 3300006871 Ga0075434_100010660 Ga0075434_1000106603 328
295 3300006914 Ga0075436_100086953 Ga0075436_1000869532 328
296 3300007076 Ga0075435_100041806 Ga0075435_1000418064 328
297 3300009093 Ga0105240_10138712 Ga0105240_101387122 328
298 3300013100 Ga0157373_10077039 Ga0157373_100770392 328
299 3300013104 Ga0157370_10114950 Ga0157370_101149503 328
300 3300025912 Ga0207707_10063186 Ga0207707_100631862 328
301 3300025913 Ga0207695_10162121 Ga0207695_101621211 328
302 3300025914 Ga0207671_10112587 Ga0207671_101125873 328
303 3300025915 Ga0207693_10262333 Ga0207693_102623331 328
304 3300025917 Ga0207660_10050806 Ga0207660_100508063 328
305 3300025917 Ga0207660_10333916 Ga0207660_103339162 328
306 3300025981 Ga0207640_10124342 Ga0207640_101243423 328
307 3300025981 Ga0207640_10299638 Ga0207640_102996382 328
308 3300026023 Ga0207677_10179879 Ga0207677_101798791 328
309 3300026078 Ga0207702_10447264 Ga0207702_104472642 328
310 3300035170 Ga0373943_0082046 Ga0373943_0082046_162_1148 328
311 3300035695 Ga0373927_0227235 Ga0373927_0227235_226_1212 328
312 3300036401 Ga0373937_0128313 Ga0373937_0128313_884_1987 328
313 3300036401 Ga0373937_0180135 Ga0373937_0180135_525_1511 328
314 3300037068 Ga0373925_0003807 Ga0373925_0003807_5578_6564 328
315 3300044694 Ga0466963_0222045 Ga0466963_0222045_104_1090 328
316 3300044842 Ga0466957_0225036 Ga0466957_0225036_55_1041 328
317 3300045976 Ga0466967_0201009 Ga0466967_0201009_316_1302 328
318 3300046499 Ga0495594_0072602 Ga0495594_0072602_655_1644 328
319 3300046543 Ga0495645_0013197 Ga0495645_0013197_3281_4270 328
320 3300046684 Ga0495669_0135431 Ga0495669_0135431_108_1097 328
321 3300048905 Ga0496102_0241491 Ga0496102_0241491_202_1188 328
322 3300048906 Ga0496103_0005215 Ga0496103_0005215_3851_4837 328
323 3300048907 Ga0496104_0109708 Ga0496104_0109708_235_1221 328
324 3300048913 Ga0496110_0137359 Ga0496110_0137359_1082_2068 328
325 3300048914 Ga0496111_0028145 Ga0496111_0028145_1689_2675 328
326 3300048915 Ga0496112_0101844 Ga0496112_0101844_1472_2470 328
327 3300050512 nmdc:mga0n895_15786_c1 nmdc:mga0n895_15786_c1_5775_6803 328
328 3300050513 nmdc:mga0rr50_511127_c1 nmdc:mga0rr50_511127_c1_11_1009 328
329 3300050514 nmdc:mga08x19_46063_c1 nmdc:mga08x19_46063_c1_589_1617 328
330 3300050515 nmdc:mga0a205_493912_c1 nmdc:mga0a205_493912_c1_33_1061 328
331 3300003322 rootL2_10074167 rootL2_100741675 329
332 3300005334 Ga0068869_100001857 Ga0068869_10000185711 329
333 3300005548 Ga0070665_100119943 Ga0070665_1001199432 329
334 3300005577 Ga0068857_100258835 Ga0068857_1002588351 329
335 3300005578 Ga0068854_100127888 Ga0068854_1001278882 329
336 3300005616 Ga0068852_100378513 Ga0068852_1003785132 329
337 3300005616 Ga0068852_100403705 Ga0068852_1004037051 329
338 3300005719 Ga0068861_100067746 Ga0068861_1000677463 329
339 3300005842 Ga0068858_100000728 Ga0068858_10000072818 329
340 3300005843 Ga0068860_100156457 Ga0068860_1001564572 329
341 3300006358 Ga0068871_100103111 Ga0068871_1001031112 329
342 3300006358 Ga0068871_100236235 Ga0068871_1002362352 329
343 3300006881 Ga0068865_100254777 Ga0068865_1002547772 329
344 3300009177 Ga0105248_10079009 Ga0105248_100790093 329
345 3300009545 Ga0105237_10058217 Ga0105237_100582174 329
346 3300010375 Ga0105239_10002453 Ga0105239_100024538 329
347 3300010375 Ga0105239_10225797 Ga0105239_102257973 329
348 3300013296 Ga0157374_10001620 Ga0157374_1000162017 329
349 3300013297 Ga0157378_10046849 Ga0157378_100468492 329
350 3300013306 Ga0163162_10009985 Ga0163162_100099854 329
351 3300013308 Ga0157375_10390409 Ga0157375_103904092 329
352 3300014497 Ga0182008_10021047 Ga0182008_100210472 329
353 3300014968 Ga0157379_10148276 Ga0157379_101482762 329
354 3300014969 Ga0157376_10084238 Ga0157376_100842383 329
355 3300014969 Ga0157376_10339339 Ga0157376_103393392 329
356 3300015262 Ga0182007_10007804 Ga0182007_100078043 329
357 3300025904 Ga0207647_10095040 Ga0207647_100950402 329
358 3300025906 Ga0207699_10160356 Ga0207699_101603562 329
359 3300025938 Ga0207704_10139319 Ga0207704_101393193 329
360 3300025942 Ga0207689_10000706 Ga0207689_1000070617 329
361 3300025944 Ga0207661_10272824 Ga0207661_102728242 329
362 3300026035 Ga0207703_10005756 Ga0207703_100057564 329
363 3300026078 Ga0207702_10027898 Ga0207702_100278984 329
364 3300026088 Ga0207641_10123736 Ga0207641_101237364 329
365 3300031852 Ga0307410_10024366 Ga0307410_100243663 329
366 3300031903 Ga0307407_10061268 Ga0307407_100612682 329
367 3300031995 Ga0307409_100000699 Ga0307409_10000069915 329
368 3300032002 Ga0307416_100023449 Ga0307416_1000234497 329
369 3300032005 Ga0307411_10003407 Ga0307411_100034078 329
370 3300032005 Ga0307411_10011260 Ga0307411_100112604 329
371 3300039437 Ga0436365_0595099 Ga0436365_0595099_257_1246 329
372 3300046472 Ga0495580_0085538 Ga0495580_0085538_1037_2026 329
373 3300048903 Ga0496100_0069823 Ga0496100_0069823_359_1348 329
374 3300048915 Ga0496112_0047241 Ga0496112_0047241_2224_3219 329
375 3300048916 Ga0496113_0448522 Ga0496113_0448522_25_1014 329
376 3300005435 Ga0070714_100450386 Ga0070714_1004503861 330
377 3300005436 Ga0070713_100036748 Ga0070713_1000367484 330
378 3300005436 Ga0070713_100340513 Ga0070713_1003405131 330
379 3300005563 Ga0068855_100047589 Ga0068855_1000475895 330
380 3300006175 Ga0070712_100111988 Ga0070712_1001119882 330
381 3300009093 Ga0105240_10039462 Ga0105240_100394626 330
382 3300009551 Ga0105238_10037575 Ga0105238_100375754 330
383 3300013104 Ga0157370_10150084 Ga0157370_101500842 330
384 3300025913 Ga0207695_10070288 Ga0207695_100702882 330
385 3300025913 Ga0207695_10262885 Ga0207695_102628852 330
386 3300025924 Ga0207694_10057084 Ga0207694_100570842 330
387 3300025928 Ga0207700_10004348 Ga0207700_100043486 330
388 3300025929 Ga0207664_10235851 Ga0207664_102358512 330
389 3300028800 Ga0265338_10052948 Ga0265338_100529484 330
390 3300031249 Ga0265339_10004017 Ga0265339_100040175 330
391 3300031344 Ga0265316_10015996 Ga0265316_100159963 330
392 3300035692 Ga0373935_0005093 Ga0373935_0005093_4032_5033 330
393 3300036401 Ga0373937_0000827 Ga0373937_0000827_2523_3524 330
394 3300046462 Ga0495651_0176196 Ga0495651_0176196_98_1099 330
395 3300048908 Ga0496105_0013709 Ga0496105_0013709_2670_3788 330
396 3300048915 Ga0496112_0035814 Ga0496112_0035814_3764_4771 330
397 3300050514 nmdc:mga08x19_9044_c1 nmdc:mga08x19_9044_c1_4661_5689 330
398 3300026118 Ga0207675_100068498 Ga0207675_1000684984 331
399 3300046472 Ga0495580_0043029 Ga0495580_0043029_461_1468 331
400 3300005330 Ga0070690_100106958 Ga0070690_1001069582 332
401 3300005334 Ga0068869_100002009 Ga0068869_1000020096 332
402 3300005336 Ga0070680_100204746 Ga0070680_1002047462 332
403 3300005338 Ga0068868_100014278 Ga0068868_1000142785 332
404 3300005339 Ga0070660_100177063 Ga0070660_1001770632 332
405 3300005343 Ga0070687_100004698 Ga0070687_1000046984 332
406 3300005344 Ga0070661_100041173 Ga0070661_1000411732 332
407 3300005366 Ga0070659_100155171 Ga0070659_1001551712 332
408 3300005434 Ga0070709_10034826 Ga0070709_100348261 332
409 3300005435 Ga0070714_100031796 Ga0070714_1000317961 332
410 3300005435 Ga0070714_100414440 Ga0070714_1004144401 332
411 3300005436 Ga0070713_100007565 Ga0070713_1000075656 332
412 3300005437 Ga0070710_10035306 Ga0070710_100353061 332
413 3300005458 Ga0070681_10016054 Ga0070681_100160545 332
414 3300005459 Ga0068867_100038327 Ga0068867_1000383272 332
415 3300005535 Ga0070684_100007055 Ga0070684_1000070555 332
416 3300005539 Ga0068853_100093357 Ga0068853_1000933573 332
417 3300005546 Ga0070696_100079366 Ga0070696_1000793662 332
418 3300005563 Ga0068855_100003547 Ga0068855_10000354715 332
419 3300005564 Ga0070664_100001991 Ga0070664_1000019914 332
420 3300005577 Ga0068857_100000775 Ga0068857_1000007758 332
421 3300005614 Ga0068856_100005024 Ga0068856_1000050244 332
422 3300005617 Ga0068859_100000298 Ga0068859_10000029836 332
423 3300005618 Ga0068864_100002195 Ga0068864_10000219510 332
424 3300005842 Ga0068858_100010844 Ga0068858_1000108444 332
425 3300005843 Ga0068860_100031286 Ga0068860_1000312863 332
426 3300006028 Ga0070717_10351968 Ga0070717_103519681 332
427 3300006881 Ga0068865_100107252 Ga0068865_1001072522 332
428 3300006931 Ga0097620_100000298 Ga0097620_10000029836 332
429 3300009177 Ga0105248_10174681 Ga0105248_101746812 332
430 3300011119 Ga0105246_10100654 Ga0105246_101006542 332
431 3300013100 Ga0157373_10005980 Ga0157373_100059802 332
432 3300013296 Ga0157374_10001876 Ga0157374_1000187616 332
433 3300013297 Ga0157378_10000970 Ga0157378_100009707 332
434 3300013307 Ga0157372_10000749 Ga0157372_1000074916 332
435 3300014325 Ga0163163_10118100 Ga0163163_101181002 332
436 3300025906 Ga0207699_10030809 Ga0207699_100308093 332
437 3300025906 Ga0207699_10199802 Ga0207699_101998022 332
438 3300025912 Ga0207707_10012202 Ga0207707_100122023 332
439 3300025915 Ga0207693_10090013 Ga0207693_100900134 332
440 3300025925 Ga0207650_10032174 Ga0207650_100321742 332
441 3300025929 Ga0207664_10001649 Ga0207664_100016492 332
442 3300025929 Ga0207664_10028600 Ga0207664_100286002 332
443 3300025938 Ga0207704_10005806 Ga0207704_100058063 332
444 3300025945 Ga0207679_10037097 Ga0207679_100370973 332
445 3300025949 Ga0207667_10011648 Ga0207667_100116488 332
446 3300026023 Ga0207677_10000965 Ga0207677_100009657 332
447 3300026035 Ga0207703_10003058 Ga0207703_100030584 332
448 3300026041 Ga0207639_10089042 Ga0207639_100890422 332
449 3300026078 Ga0207702_10005732 Ga0207702_100057324 332
450 3300026089 Ga0207648_10066522 Ga0207648_100665222 332
451 3300026095 Ga0207676_10002258 Ga0207676_1000225810 332
452 3300026116 Ga0207674_10000165 Ga0207674_1000016562 332
453 3300026118 Ga0207675_100513610 Ga0207675_1005136101 332
454 3300028381 Ga0268264_10032967 Ga0268264_100329672 332
455 3300035691 Ga0373931_0091653 Ga0373931_0091653_109_1125 332
456 3300025928 Ga0207700_10028787 Ga0207700_100287871 333
457 3300045976 Ga0466967_0302039 Ga0466967_0302039_200_1270 333
458 3300005329 Ga0070683_100067321 Ga0070683_1000673213 334
459 3300005329 Ga0070683_100228700 Ga0070683_1002287002 334
460 3300005336 Ga0070680_100107442 Ga0070680_1001074422 334
461 3300005435 Ga0070714_100053079 Ga0070714_1000530795 334
462 3300005436 Ga0070713_100005746 Ga0070713_1000057466 334
463 3300005436 Ga0070713_100046707 Ga0070713_1000467072 334
464 3300005445 Ga0070708_100034749 Ga0070708_1000347493 334
465 3300005456 Ga0070678_100131764 Ga0070678_1001317642 334
466 3300005530 Ga0070679_100006248 Ga0070679_1000062488 334
467 3300005535 Ga0070684_100256762 Ga0070684_1002567621 334
468 3300005535 Ga0070684_100312043 Ga0070684_1003120431 334
469 3300005536 Ga0070697_100228610 Ga0070697_1002286101 334
470 3300005539 Ga0068853_100113996 Ga0068853_1001139962 334
471 3300005563 Ga0068855_100000782 Ga0068855_10000078240 334
472 3300005563 Ga0068855_100004362 Ga0068855_1000043622 334
473 3300005577 Ga0068857_100198356 Ga0068857_1001983561 334
474 3300005578 Ga0068854_100002592 Ga0068854_1000025921 334
475 3300005614 Ga0068856_100000437 Ga0068856_1000004378 334
476 3300005614 Ga0068856_100104260 Ga0068856_1001042602 334
477 3300005616 Ga0068852_100189228 Ga0068852_1001892282 334
478 3300005618 Ga0068864_100038489 Ga0068864_1000384892 334
479 3300005841 Ga0068863_100101577 Ga0068863_1001015773 334
480 3300005842 Ga0068858_100028909 Ga0068858_1000289092 334
481 3300005842 Ga0068858_100072311 Ga0068858_1000723112 334
482 3300005843 Ga0068860_100141659 Ga0068860_1001416591 334
483 3300006237 Ga0097621_100000472 Ga0097621_10000047210 334
484 3300006237 Ga0097621_100021084 Ga0097621_1000210845 334
485 3300006358 Ga0068871_100000084 Ga0068871_10000008441 334
486 3300006358 Ga0068871_100067580 Ga0068871_1000675802 334
487 3300006852 Ga0075433_10017089 Ga0075433_100170893 334
488 3300006871 Ga0075434_100006848 Ga0075434_1000068489 334
489 3300006881 Ga0068865_100020735 Ga0068865_1000207354 334
490 3300009093 Ga0105240_10005889 Ga0105240_1000588910 334
491 3300009093 Ga0105240_10125612 Ga0105240_101256121 334
492 3300009093 Ga0105240_10306446 Ga0105240_103064462 334
493 3300009177 Ga0105248_10035966 Ga0105248_100359663 334
494 3300009545 Ga0105237_10378172 Ga0105237_103781721 334
495 3300009551 Ga0105238_10012484 Ga0105238_100124847 334
496 3300013100 Ga0157373_10221392 Ga0157373_102213921 334
497 3300013104 Ga0157370_10210610 Ga0157370_102106102 334
498 3300013105 Ga0157369_10004291 Ga0157369_100042911 334
499 3300013105 Ga0157369_10015876 Ga0157369_100158764 334
500 3300013296 Ga0157374_10000357 Ga0157374_100003575 334
501 3300013296 Ga0157374_10001545 Ga0157374_1000154518 334
502 3300013297 Ga0157378_10000133 Ga0157378_1000013337 334
503 3300013297 Ga0157378_10009203 Ga0157378_100092033 334
504 3300013307 Ga0157372_10000544 Ga0157372_1000054433 334
505 3300013307 Ga0157372_10002337 Ga0157372_1000233715 334
506 3300013307 Ga0157372_10111813 Ga0157372_101118132 334
507 3300013307 Ga0157372_10243572 Ga0157372_102435722 334
508 3300014969 Ga0157376_10023839 Ga0157376_100238393 334
509 3300025912 Ga0207707_10001372 Ga0207707_100013726 334
510 3300025913 Ga0207695_10070744 Ga0207695_100707441 334
511 3300025913 Ga0207695_10093475 Ga0207695_100934753 334
512 3300025913 Ga0207695_10199351 Ga0207695_101993512 334
513 3300025913 Ga0207695_10214937 Ga0207695_102149372 334
514 3300025914 Ga0207671_10025778 Ga0207671_100257782 334
515 3300025921 Ga0207652_10014836 Ga0207652_100148364 334
516 3300025928 Ga0207700_10005883 Ga0207700_100058836 334
517 3300025929 Ga0207664_10010810 Ga0207664_100108103 334
518 3300025938 Ga0207704_10025863 Ga0207704_100258632 334
519 3300025941 Ga0207711_10073624 Ga0207711_100736243 334
520 3300025944 Ga0207661_10012169 Ga0207661_100121692 334
521 3300025944 Ga0207661_10065711 Ga0207661_100657112 334
522 3300025945 Ga0207679_10157560 Ga0207679_101575602 334
523 3300025949 Ga0207667_10000475 Ga0207667_1000047513 334
524 3300025949 Ga0207667_10001648 Ga0207667_1000164827 334
525 3300025949 Ga0207667_10108728 Ga0207667_101087281 334
526 3300025960 Ga0207651_10251174 Ga0207651_102511742 334
527 3300025981 Ga0207640_10007162 Ga0207640_100071622 334
528 3300026035 Ga0207703_10014844 Ga0207703_100148443 334
529 3300026041 Ga0207639_10093972 Ga0207639_100939722 334
530 3300026078 Ga0207702_10011714 Ga0207702_100117145 334
531 3300026088 Ga0207641_10008617 Ga0207641_100086172 334
532 3300026116 Ga0207674_10015293 Ga0207674_100152937 334
533 3300026142 Ga0207698_10105318 Ga0207698_101053182 334
534 3300028381 Ga0268264_10063071 Ga0268264_100630711 334
535 3300035691 Ga0373931_0033111 Ga0373931_0033111_92_1108 334
536 3300045049 Ga0466959_0104947 Ga0466959_0104947_567_1610 334
537 3300045836 Ga0466958_0020168 Ga0466958_0020168_1607_2650 334
538 3300045976 Ga0466967_0045037 Ga0466967_0045037_2102_3145 334
539 3300046472 Ga0495580_0002222 Ga0495580_0002222_7151_8155 334
540 3300048908 Ga0496105_0060775 Ga0496105_0060775_1194_2210 334
541 3300048914 Ga0496111_0346327 Ga0496111_0346327_20_1036 334
542 3300048915 Ga0496112_0003539 Ga0496112_0003539_4878_5894 334
543 3300048915 Ga0496112_0038831 Ga0496112_0038831_3172_4188 334
544 3300050512 nmdc:mga0n895_6567_c1 nmdc:mga0n895_6567_c1_3253_4257 334
545 3300050515 nmdc:mga0a205_1031_c1 nmdc:mga0a205_1031_c1_3043_4047 334
546 3300061719 Ga0466962_0051791 Ga0466962_0051791_321_1364 334
547 3300005467 Ga0070706_100041991 Ga0070706_1000419914 335
548 3300005468 Ga0070707_100013103 Ga0070707_1000131032 335
549 3300024227 Ga0228598_1007166 Ga0228598_10071661 335
550 3300025922 Ga0207646_10148211 Ga0207646_101482112 335
551 3300031249 Ga0265339_10016016 Ga0265339_100160161 335
552 3300031711 Ga0265314_10005810 Ga0265314_100058108 335
553 3300031711 Ga0265314_10138090 Ga0265314_101380902 335
554 3300005436 Ga0070713_100011239 Ga0070713_1000112395 336
555 3300005436 Ga0070713_100083172 Ga0070713_1000831721 336
556 3300005437 Ga0070710_10025077 Ga0070710_100250773 336
557 3300005439 Ga0070711_100022031 Ga0070711_1000220314 336
558 3300005458 Ga0070681_10228072 Ga0070681_102280722 336
559 3300006028 Ga0070717_10012555 Ga0070717_100125555 336
560 3300006173 Ga0070716_100000412 Ga0070716_1000004128 336
561 3300006175 Ga0070712_100003917 Ga0070712_1000039174 336
562 3300006175 Ga0070712_100007097 Ga0070712_1000070974 336
563 3300006175 Ga0070712_100014269 Ga0070712_1000142693 336
564 3300025906 Ga0207699_10014129 Ga0207699_100141294 336
565 3300025915 Ga0207693_10001454 Ga0207693_100014548 336
566 3300025915 Ga0207693_10007586 Ga0207693_100075864 336
567 3300025915 Ga0207693_10012077 Ga0207693_100120774 336
568 3300025916 Ga0207663_10079133 Ga0207663_100791333 336
569 3300025928 Ga0207700_10007126 Ga0207700_100071266 336
570 3300025939 Ga0207665_10000884 Ga0207665_100008849 336
571 3300050514 nmdc:mga08x19_185975_c1 nmdc:mga08x19_185975_c1_291_1406 336
572 3300025945 Ga0207679_10000080 Ga0207679_1000008053 337
573 3300013105 Ga0157369_10000297 Ga0157369_1000029725 338
574 3300046472 Ga0495580_0000223 Ga0495580_0000223_38278_39312 338
575 3300046531 Ga0495665_0008695 Ga0495665_0008695_3694_4728 338
576 3300030760 Ga0265762_1003446 Ga0265762_10034464 340
577 3300031090 Ga0265760_10008099 Ga0265760_100080994 340
578 3300035086 Ga0373934_0027441 Ga0373934_0027441_433_1479 340
579 3300036401 Ga0373937_0013056 Ga0373937_0013056_1670_2716 340
580 3300046559 Ga0495667_0095675 Ga0495667_0095675_797_1843 340
581 3300046679 Ga0495623_0064847 Ga0495623_0064847_51_1097 340
582 3300006028 Ga0070717_10002780 Ga0070717_1000278011 341
583 3300005468 Ga0070707_100076256 Ga0070707_1000762562 344
584 3300025922 Ga0207646_10284928 Ga0207646_102849281 344
585 3300001976 JGI24752J21851_1002230 JGI24752J21851_10022304 347
586 3300001991 JGI24743J22301_10007511 JGI24743J22301_100075112 347
587 3300002459 JGI24751J29686_10012545 JGI24751J29686_100125452 347
588 3300005327 Ga0070658_10088467 Ga0070658_100884671 347
589 3300005328 Ga0070676_10129380 Ga0070676_101293801 347
590 3300005329 Ga0070683_100001626 Ga0070683_1000016265 347
591 3300005330 Ga0070690_100042191 Ga0070690_1000421912 347
592 3300005331 Ga0070670_100052443 Ga0070670_1000524434 347
593 3300005331 Ga0070670_100110019 Ga0070670_1001100195 347
594 3300005334 Ga0068869_100103680 Ga0068869_1001036802 347
595 3300005335 Ga0070666_10013203 Ga0070666_100132032 347
596 3300005337 Ga0070682_100034220 Ga0070682_1000342202 347
597 3300005338 Ga0068868_100043917 Ga0068868_1000439173 347
598 3300005339 Ga0070660_100002367 Ga0070660_1000023674 347
599 3300005343 Ga0070687_100033238 Ga0070687_1000332382 347
600 3300005344 Ga0070661_100060461 Ga0070661_1000604611 347
601 3300005354 Ga0070675_100193240 Ga0070675_1001932403 347
602 3300005356 Ga0070674_100036897 Ga0070674_1000368972 347
603 3300005365 Ga0070688_100000649 Ga0070688_10000064911 347
604 3300005366 Ga0070659_100002024 Ga0070659_10000202411 347
605 3300005438 Ga0070701_10005375 Ga0070701_100053755 347
606 3300005455 Ga0070663_100022418 Ga0070663_1000224185 347
607 3300005456 Ga0070678_100044700 Ga0070678_1000447002 347
608 3300005457 Ga0070662_100035203 Ga0070662_1000352033 347
609 3300005459 Ga0068867_100015408 Ga0068867_1000154083 347
610 3300005535 Ga0070684_100025259 Ga0070684_1000252592 347
611 3300005539 Ga0068853_100006954 Ga0068853_1000069547 347
612 3300005543 Ga0070672_100061334 Ga0070672_1000613343 347
613 3300005563 Ga0068855_100018769 Ga0068855_1000187694 347
614 3300005564 Ga0070664_100010095 Ga0070664_1000100957 347
615 3300005577 Ga0068857_100001392 Ga0068857_1000013927 347
616 3300005578 Ga0068854_100095898 Ga0068854_1000958983 347
617 3300005614 Ga0068856_100005815 Ga0068856_10000581510 347
618 3300005615 Ga0070702_100021445 Ga0070702_1000214455 347
619 3300005616 Ga0068852_100012290 Ga0068852_1000122907 347
620 3300005617 Ga0068859_100018200 Ga0068859_1000182004 347
621 3300005618 Ga0068864_100135313 Ga0068864_1001353132 347
622 3300005719 Ga0068861_100075095 Ga0068861_1000750952 347
623 3300005840 Ga0068870_10000211 Ga0068870_100002119 347
624 3300006237 Ga0097621_100161643 Ga0097621_1001616434 347
625 3300006881 Ga0068865_100030842 Ga0068865_1000308423 347
626 3300006931 Ga0097620_100018202 Ga0097620_1000182026 347
627 3300009098 Ga0105245_10005120 Ga0105245_100051204 347
628 3300009098 Ga0105245_10020679 Ga0105245_100206794 347
629 3300009101 Ga0105247_10036051 Ga0105247_100360513 347
630 3300009174 Ga0105241_10212161 Ga0105241_102121612 347
631 3300009553 Ga0105249_10092022 Ga0105249_100920222 347
632 3300009553 Ga0105249_10282203 Ga0105249_102822032 347
633 3300011119 Ga0105246_10063497 Ga0105246_100634971 347
634 3300013100 Ga0157373_10053729 Ga0157373_100537292 347
635 3300013105 Ga0157369_10007091 Ga0157369_100070914 347
636 3300013296 Ga0157374_10075968 Ga0157374_100759682 347
637 3300013307 Ga0157372_10053060 Ga0157372_100530605 347
638 3300013308 Ga0157375_10147731 Ga0157375_101477312 347
639 3300014325 Ga0163163_10041486 Ga0163163_100414864 347
640 3300014326 Ga0157380_10187513 Ga0157380_101875132 347
641 3300014745 Ga0157377_10000704 Ga0157377_100007044 347
642 3300014968 Ga0157379_10036033 Ga0157379_100360335 347
643 3300017792 Ga0163161_10010962 Ga0163161_100109624 347
644 3300025893 Ga0207682_10026377 Ga0207682_100263772 347
645 3300025901 Ga0207688_10032133 Ga0207688_100321333 347
646 3300025903 Ga0207680_10035685 Ga0207680_100356852 347
647 3300025904 Ga0207647_10001725 Ga0207647_100017252 347
648 3300025907 Ga0207645_10000104 Ga0207645_1000010450 347
649 3300025908 Ga0207643_10000512 Ga0207643_1000051211 347
650 3300025911 Ga0207654_10160948 Ga0207654_101609482 347
651 3300025918 Ga0207662_10028514 Ga0207662_100285142 347
652 3300025919 Ga0207657_10002030 Ga0207657_1000203015 347
653 3300025920 Ga0207649_10000149 Ga0207649_1000014933 347
654 3300025923 Ga0207681_10006994 Ga0207681_100069941 347
655 3300025925 Ga0207650_10000442 Ga0207650_1000044228 347
656 3300025925 Ga0207650_10037358 Ga0207650_100373583 347
657 3300025933 Ga0207706_10000651 Ga0207706_100006514 347
658 3300025937 Ga0207669_10053883 Ga0207669_100538832 347
659 3300025940 Ga0207691_10006924 Ga0207691_100069242 347
660 3300025941 Ga0207711_10002489 Ga0207711_100024897 347
661 3300025942 Ga0207689_10003386 Ga0207689_1000338611 347
662 3300025944 Ga0207661_10000213 Ga0207661_1000021311 347
663 3300025960 Ga0207651_10000653 Ga0207651_1000065310 347
664 3300025961 Ga0207712_10027693 Ga0207712_100276932 347
665 3300025961 Ga0207712_10143522 Ga0207712_101435222 347
666 3300026023 Ga0207677_10001580 Ga0207677_1000158010 347
667 3300026023 Ga0207677_10006822 Ga0207677_100068225 347
668 3300026035 Ga0207703_10004846 Ga0207703_100048462 347
669 3300026041 Ga0207639_10040501 Ga0207639_100405014 347
670 3300026067 Ga0207678_10000687 Ga0207678_1000068714 347
671 3300026075 Ga0207708_10026128 Ga0207708_100261283 347
672 3300026088 Ga0207641_10000432 Ga0207641_1000043228 347
673 3300026089 Ga0207648_10001706 Ga0207648_1000170621 347
674 3300026095 Ga0207676_10000586 Ga0207676_1000058622 347
675 3300026116 Ga0207674_10001107 Ga0207674_100011075 347
676 3300026121 Ga0207683_10004384 Ga0207683_100043843 347
677 3300028380 Ga0268265_10005678 Ga0268265_100056785 347
678 3300028381 Ga0268264_10005599 Ga0268264_100055993 347
679 3300046684 Ga0495669_0038467 Ga0495669_0038467_715_1758 347
680 3300048905 Ga0496102_0074118 Ga0496102_0074118_1387_2430 347
681 3300048905 Ga0496102_0075100 Ga0496102_0075100_1857_2900 347
682 3300048911 Ga0496108_0000228 Ga0496108_0000228_22163_23317 347
683 3300048912 Ga0496109_0000362 Ga0496109_0000362_23046_24200 347
684 3300048913 Ga0496110_0012685 Ga0496110_0012685_4470_5624 347
685 3300048914 Ga0496111_0001468 Ga0496111_0001468_7446_8600 347
686 3300048915 Ga0496112_0000034 Ga0496112_0000034_80349_81503 347
687 3300048916 Ga0496113_0000391 Ga0496113_0000391_704_1858 347
688 3300048918 Ga0496115_0101896 Ga0496115_0101896_1133_2176 347

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01380

SIS

SIS domain

75

171

0.95

PF00571

CBS

CBS domain

328

378

0.93

PF00571

CBS

CBS domain

261

318

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xhz-assembly1.cif.gz_B probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography 0.971 2 202
3fxa-assembly1.cif.gz_D crystal structure of a putative sugar-phosphate isomerase (lmof2365_0531) from listeria monocytogenes str. 4b f2365 at 1.60 a resolution 0.953 4 213
2xhz-assembly1.cif.gz_B probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography 0.9492 2 202
3fna-assembly3.cif.gz_A crystal structure of the cbs pair of possible d-arabinose 5-phosphate isomerase yrbh from escherichia coli cft073 0.9427 218 339
3k2v-assembly1.cif.gz_B structure of the cbs pair of a putative d-arabinose 5-phosphate isomerase from klebsiella pneumoniae subsp. pneumoniae. 0.9394 215 339
ID Description Score Start End Superfamily
af_P45395_11_201_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9743 2 219 3.40.50.10490
af_P45395_11_201_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9544 2 219 3.40.50.10490
3fnaA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9489 218 339 3.10.580.10
af_P45395_202_325_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.947 221 341 3.10.580.10
3fxaD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9398 4 213 3.40.50.10490
ID Description Score Start End GO Terms
AF-K1Z903-F1-model_v4 SIS domain-containing protein 0.9808 8 169 GO:0097367
GO:1901135
AF-A0A660PIE3-F1-model_v4 D-arabinose 5-phosphate isomerase 0.9797 3 196 GO:0016853
GO:0097367
GO:1901135
AF-A0A7G3ELT6-F1-model_v4 deleted 0.9779 1 213
AF-A0A656SJ60-F1-model_v4 deleted 0.9738 38 119
AF-A0A5C4YD10-F1-model_v4 KpsF/GutQ family sugar-phosphate isomerase 0.9719 3 221 GO:0005975
GO:0016853
GO:0097367
GO:1901135

Feature Viewer

pLDDT pTM Quality
86.89 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map