F475311

General Info

Members Datasets Scaffolds Average Seq Length
688 282 1376 331

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100035557|Ga0068852_1000355571
Length 407
Sequence MTPAIDVDHIVKQFGTFTAVKGITFSVAQGEIFGLLGPNGAGKSTLIRMLTTLLPPTSGAARVNGYDVVRQADDVRRSIGVIPQALTSDLELSVEENLIIFAKLYGVPSAKRKRLIDELLKAVELSEWRSAPVKNLSGGMRRRVEIARGLVHEPRIFFLDEPTTGLDPVSRSAVWEMLRSIKAARDLTVLLTTHYMDEADKLCDRIAIVDHGELKALDSPLRLKMSVPDKNTLEVSFNNTTPAWNERLKALPFVDTVSGDGAIVRIHTSNGPATTRALLDVASEAGVGVGALSVQSTTLDAVVQADALTVRRRRAGCTGRSARDESRCAAHPSGVLASAASHWVSIRASAARASASSVSCRSSPSSRRWPAARTDRHGGRPCARASKKAARSFSGKPRRTAFRTTAT

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
165 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
168 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
175 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
176 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
177 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
178 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
179 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
180 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
181 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
182 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
192 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
193 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
220 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
265 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
266 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
267 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
268 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
280 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.49
Nodule 0
Rhizoplane 5.38
Rhizosphere 90.99
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_100035557 3300005616 Bacteria 4157
2 Ga0065712_10003846 3300005290 Bacteria 5848
3 Ga0065712_10078228 3300005290 Bacteria 3376
4 Ga0065715_10004238 3300005293 Bacteria 3867
5 Ga0065715_10095042 3300005293 Bacteria 4180
6 Ga0065715_10119283 3300005293 Bacteria 2290
7 Ga0065715_10164795 3300005293 Bacteria 1596
8 Ga0065707_10005377 3300005295 Bacteria 3594
9 Ga0065707_10006219 3300005295 Bacteria 2824
10 Ga0070658_10011606 3300005327 Bacteria 7066
11 Ga0070676_10173437 3300005328 Bacteria 1397
12 Ga0070683_100006348 3300005329 Bacteria 9914
13 Ga0070683_100132612 3300005329 Bacteria 2358
14 Ga0070690_100051448 3300005330 Bacteria 2630
15 Ga0070690_100058694 3300005330 Bacteria 2472
16 Ga0070670_100004652 3300005331 Bacteria 11512
17 Ga0070670_100008773 3300005331 Bacteria 8628
18 Ga0070670_100332852 3300005331 Bacteria 1332
19 Ga0070677_10028150 3300005333 Bacteria 2121
20 Ga0068869_100293328 3300005334 Bacteria 1311
21 Ga0070666_10144840 3300005335 Bacteria 1656
22 Ga0068868_100023747 3300005338 Bacteria 4643
23 Ga0068868_100149769 3300005338 Bacteria 1921
24 Ga0068868_100151710 3300005338 Bacteria 1908
25 Ga0070660_100029286 3300005339 Bacteria 4125
26 Ga0070660_100038736 3300005339 Bacteria 3620
27 Ga0070660_100051060 3300005339 Bacteria 3184
28 Ga0070660_100346418 3300005339 Bacteria 1223
29 Ga0070689_100001466 3300005340 Bacteria 15055
30 Ga0070689_100074026 3300005340 Bacteria 2665
31 Ga0070689_100074091 3300005340 Bacteria 2664
32 Ga0070689_100096314 3300005340 Bacteria 2339
33 Ga0070661_100023703 3300005344 Bacteria 4401
34 Ga0070661_100351221 3300005344 Bacteria 1157
35 Ga0070661_100372787 3300005344 Bacteria 1124
36 Ga0070692_10004334 3300005345 Bacteria 5908
37 Ga0070668_100199114 3300005347 Bacteria 1644
38 Ga0070669_100003963 3300005353 Bacteria 10711
39 Ga0070669_100013444 3300005353 Bacteria 5818
40 Ga0070669_100045026 3300005353 Bacteria 3215
41 Ga0070669_100075289 3300005353 Bacteria 2503
42 Ga0070669_100168940 3300005353 Bacteria 1704
43 Ga0070675_100000204 3300005354 Bacteria 37628
44 Ga0070675_100001331 3300005354 Bacteria 18072
45 Ga0070675_100019041 3300005354 Bacteria 5469
46 Ga0070675_100031393 3300005354 Bacteria 4294
47 Ga0070675_100043447 3300005354 Bacteria 3672
48 Ga0070675_100074068 3300005354 Bacteria 2828
49 Ga0070675_100144830 3300005354 Bacteria 2033
50 Ga0070675_100237131 3300005354 Bacteria 1593
51 Ga0070675_100452212 3300005354 Bacteria 1152
52 Ga0070671_100030668 3300005355 Bacteria 4438
53 Ga0070671_100034971 3300005355 Bacteria 4161
54 Ga0070671_100194203 3300005355 Bacteria 1721
55 Ga0070674_100089610 3300005356 Bacteria 2216
56 Ga0070674_100274543 3300005356 Bacteria 1334
57 Ga0070673_100015358 3300005364 Bacteria 5376
58 Ga0070673_100024245 3300005364 Bacteria 4446
59 Ga0070673_100356676 3300005364 Bacteria 1299
60 Ga0070688_100002384 3300005365 Bacteria 9488
61 Ga0070688_100125196 3300005365 Bacteria 1726
62 Ga0070659_100019851 3300005366 Bacteria 5101
63 Ga0070659_100026916 3300005366 Bacteria 4427
64 Ga0070659_100028699 3300005366 Bacteria 4299
65 Ga0070659_100148574 3300005366 Bacteria 1910
66 Ga0070667_100106997 3300005367 Bacteria 2421
67 Ga0070667_100145709 3300005367 Bacteria 2077
68 Ga0070701_10001358 3300005438 Bacteria 9016
69 Ga0070701_10020600 3300005438 Bacteria 3134
70 Ga0070701_10021709 3300005438 Bacteria 3068
71 Ga0070700_100001923 3300005441 Bacteria 10506
72 Ga0070700_100124058 3300005441 Bacteria 1734
73 Ga0070694_100003153 3300005444 Bacteria 9824
74 Ga0070694_100134527 3300005444 Bacteria 1790
75 Ga0070708_100009396 3300005445 Bacteria 7883
76 Ga0070708_100106393 3300005445 Bacteria 2575
77 Ga0070663_100077010 3300005455 Bacteria 2441
78 Ga0070663_100189243 3300005455 Bacteria 1601
79 Ga0070678_100022187 3300005456 Bacteria 4201
80 Ga0070662_100074956 3300005457 Bacteria 2505
81 Ga0070662_100112950 3300005457 Bacteria 2072
82 Ga0070681_10002327 3300005458 Bacteria 17373
83 Ga0070681_10022051 3300005458 Bacteria 6391
84 Ga0068867_100004007 3300005459 Bacteria 10356
85 Ga0068867_100134202 3300005459 Bacteria 1927
86 Ga0068867_100170626 3300005459 Bacteria 1723
87 Ga0070685_10100123 3300005466 Bacteria 1769
88 Ga0070706_100150451 3300005467 Bacteria 2173
89 Ga0070707_100017901 3300005468 Bacteria 6663
90 Ga0070707_100057701 3300005468 Bacteria 3724
91 Ga0070707_100086656 3300005468 Bacteria 3028
92 Ga0070707_100088440 3300005468 Bacteria 2997
93 Ga0070707_100126548 3300005468 Bacteria 2483
94 Ga0070707_100359234 3300005468 Bacteria 1415
95 Ga0070698_100078459 3300005471 Bacteria 3301
96 Ga0070699_100012295 3300005518 Bacteria 7385
97 Ga0070699_100015170 3300005518 Bacteria 6620
98 Ga0070699_100043055 3300005518 Bacteria 3909
99 Ga0070679_100004446 3300005530 Bacteria 12950
100 Ga0070679_100030362 3300005530 Bacteria 5336
101 Ga0070684_100005985 3300005535 Bacteria 9371
102 Ga0070684_100118470 3300005535 Bacteria 2380
103 Ga0070697_100059375 3300005536 Bacteria 3114
104 Ga0068853_100416797 3300005539 Bacteria 1259
105 Ga0070672_100012360 3300005543 Bacteria 5991
106 Ga0070672_100026781 3300005543 Bacteria 4296
107 Ga0070672_100043452 3300005543 Bacteria 3465
108 Ga0070672_100151292 3300005543 Bacteria 1920
109 Ga0070672_100208090 3300005543 Bacteria 1638
110 Ga0070686_100024567 3300005544 Bacteria 3613
111 Ga0070686_100079806 3300005544 Bacteria 2164
112 Ga0070686_100205751 3300005544 Bacteria 1414
113 Ga0070695_100000574 3300005545 Bacteria 19384
114 Ga0070696_100001855 3300005546 Bacteria 13872
115 Ga0070696_100026293 3300005546 Bacteria 3959
116 Ga0070696_100071648 3300005546 Bacteria 2439
117 Ga0070665_100000588 3300005548 Bacteria 50690
118 Ga0070665_100026025 3300005548 Bacteria 5893
119 Ga0070665_100101278 3300005548 Bacteria 2884
120 Ga0070665_100265922 3300005548 Bacteria 1716
121 Ga0070704_100011714 3300005549 Bacteria 5388
122 Ga0070704_100015012 3300005549 Bacteria 4852
123 Ga0070704_100061774 3300005549 Bacteria 2683
124 Ga0070704_100208327 3300005549 Bacteria 1583
125 Ga0068855_100039563 3300005563 Bacteria 5599
126 Ga0070664_100000766 3300005564 Bacteria 24779
127 Ga0070664_100003776 3300005564 Bacteria 12219
128 Ga0070664_100115804 3300005564 Bacteria 2343
129 Ga0070664_100147162 3300005564 Bacteria 2078
130 Ga0068857_100001973 3300005577 Bacteria 16586
131 Ga0068857_100003390 3300005577 Bacteria 13271
132 Ga0068857_100085738 3300005577 Bacteria 2815
133 Ga0068854_100032237 3300005578 Bacteria 3644
134 Ga0068856_100535946 3300005614 Bacteria 1192
135 Ga0070702_100034802 3300005615 Bacteria 2779
136 Ga0068852_100032691 3300005616 Bacteria 4310
137 Ga0068852_100304365 3300005616 Bacteria 1544
138 Ga0068859_100007386 3300005617 Bacteria 11151
139 Ga0068859_100017753 3300005617 Bacteria 7153
140 Ga0068859_100027398 3300005617 Bacteria 5715
141 Ga0068859_100027890 3300005617 Bacteria 5662
142 Ga0068859_100034618 3300005617 Bacteria 5068
143 Ga0068864_100006200 3300005618 Bacteria 9804
144 Ga0068864_100009059 3300005618 Bacteria 8204
145 Ga0068864_100041565 3300005618 Bacteria 3932
146 Ga0068864_100056278 3300005618 Bacteria 3398
147 Ga0068864_100433790 3300005618 Bacteria 1254
148 Ga0068861_100002466 3300005719 Bacteria 12064
149 Ga0068861_100003130 3300005719 Bacteria 10934
150 Ga0068861_100020252 3300005719 Bacteria 4760
151 Ga0068861_100172558 3300005719 Bacteria 1793
152 Ga0068861_100199138 3300005719 Bacteria 1680
153 Ga0068861_100377683 3300005719 Bacteria 1251
154 Ga0068851_10061164 3300005834 Bacteria 1930
155 Ga0068870_10062820 3300005840 Bacteria 2002
156 Ga0068863_100040201 3300005841 Bacteria 4447
157 Ga0068863_100271902 3300005841 Bacteria 1640
158 Ga0068858_100005367 3300005842 Bacteria 12568
159 Ga0068858_100019428 3300005842 Bacteria 6355
160 Ga0068858_100055942 3300005842 Bacteria 3647
161 Ga0068858_100181871 3300005842 Bacteria 1985
162 Ga0068860_100001702 3300005843 Bacteria 23502
163 Ga0068862_100001611 3300005844 Bacteria 20547
164 Ga0068862_100001703 3300005844 Bacteria 19941
165 Ga0068862_100038850 3300005844 Bacteria 4039
166 Ga0068862_100082939 3300005844 Bacteria 2783
167 Ga0068862_100090981 3300005844 Bacteria 2657
168 Ga0068862_100104861 3300005844 Bacteria 2477
169 Ga0081455_10145417 3300005937 Bacteria 1835
170 Ga0081539_10047393 3300005985 Bacteria 2454
171 Ga0075363_100183050 3300006048 Bacteria 1193
172 Ga0075364_10035270 3300006051 Bacteria 3232
173 Ga0075364_10059658 3300006051 Bacteria 2501
174 Ga0075364_10089858 3300006051 Bacteria 2037
175 Ga0075367_10019191 3300006178 Bacteria 3788
176 Ga0075367_10021488 3300006178 Bacteria 3607
177 Ga0075367_10060979 3300006178 Bacteria 2250
178 Ga0075366_10016726 3300006195 Bacteria 4217
179 Ga0075366_10135272 3300006195 Bacteria 1488
180 Ga0097621_100004353 3300006237 Bacteria 9845
181 Ga0097621_100031639 3300006237 Bacteria 4200
182 Ga0097621_100046088 3300006237 Bacteria 3526
183 Ga0097621_100050109 3300006237 Bacteria 3395
184 Ga0097621_100069115 3300006237 Bacteria 2916
185 Ga0097621_100126162 3300006237 Bacteria 2174
186 Ga0097621_100403006 3300006237 Bacteria 1225
187 Ga0075370_10018053 3300006353 Bacteria 3822
188 Ga0068871_100001385 3300006358 Bacteria 16232
189 Ga0068871_100008151 3300006358 Bacteria 7525
190 Ga0068871_100020947 3300006358 Bacteria 5016
191 Ga0068871_100084363 3300006358 Bacteria 2636
192 Ga0068871_100175434 3300006358 Bacteria 1840
193 Ga0068871_100316090 3300006358 Bacteria 1374
194 Ga0068871_100371428 3300006358 Bacteria 1269
195 Ga0075428_100004279 3300006844 Bacteria 15712
196 Ga0075428_100012594 3300006844 Bacteria 9403
197 Ga0075428_100077569 3300006844 Bacteria 3626
198 Ga0075431_100276690 3300006847 Bacteria 1700
199 Ga0075433_10030996 3300006852 Bacteria 4567
200 Ga0075433_10046401 3300006852 Bacteria 3779
201 Ga0075433_10083885 3300006852 Bacteria 2812
202 Ga0075433_10092278 3300006852 Bacteria 2678
203 Ga0075433_10146155 3300006852 Bacteria 2102
204 Ga0075433_10218538 3300006852 Bacteria 1693
205 Ga0075434_100004506 3300006871 Bacteria 12570
206 Ga0075434_100031934 3300006871 Bacteria 5192
207 Ga0075434_100049036 3300006871 Bacteria 4191
208 Ga0075434_100136165 3300006871 Bacteria 2475
209 Ga0075434_100199538 3300006871 Bacteria 2020
210 Ga0075434_100289571 3300006871 Bacteria 1658
211 Ga0075434_100317019 3300006871 Bacteria 1580
212 Ga0075434_100417023 3300006871 Bacteria 1364
213 Ga0075434_100508216 3300006871 Bacteria 1226
214 Ga0075429_100035521 3300006880 Bacteria 4335
215 Ga0075429_100138960 3300006880 Bacteria 2126
216 Ga0068865_100051630 3300006881 Bacteria 2847
217 Ga0075436_100006693 3300006914 Bacteria 7890
218 Ga0075436_100037755 3300006914 Bacteria 3335
219 Ga0075436_100069645 3300006914 Bacteria 2431
220 Ga0097620_100007386 3300006931 Bacteria 11151
221 Ga0097620_100017754 3300006931 Bacteria 7153
222 Ga0097620_100027397 3300006931 Bacteria 5715
223 Ga0097620_100027890 3300006931 Bacteria 5662
224 Ga0097620_100034622 3300006931 Bacteria 5068
225 Ga0075435_100006452 3300007076 Bacteria 8297
226 Ga0075435_100010427 3300007076 Bacteria 6798
227 Ga0075435_100016947 3300007076 Bacteria 5501
228 Ga0075435_100063164 3300007076 Bacteria 3007
229 Ga0075435_100091904 3300007076 Bacteria 2505
230 Ga0075435_100120701 3300007076 Bacteria 2187
231 Ga0075435_100216692 3300007076 Bacteria 1625
232 Ga0105240_10210971 3300009093 Bacteria 2269
233 Ga0111539_10002853 3300009094 Bacteria 22959
234 Ga0111539_10013795 3300009094 Bacteria 10097
235 Ga0111539_10028702 3300009094 Bacteria 6786
236 Ga0111539_10038649 3300009094 Bacteria 5758
237 Ga0111539_10040055 3300009094 Bacteria 5642
238 Ga0111539_10062729 3300009094 Bacteria 4399
239 Ga0111539_10253678 3300009094 Bacteria 2048
240 Ga0111539_10722266 3300009094 Bacteria 1160
241 Ga0105245_10008432 3300009098 Bacteria 8999
242 Ga0105245_10071155 3300009098 Bacteria 3158
243 Ga0105245_10590855 3300009098 Bacteria 1136
244 Ga0114129_10002566 3300009147 Bacteria 25226
245 Ga0114129_10005856 3300009147 Bacteria 17405
246 Ga0114129_10012152 3300009147 Bacteria 12254
247 Ga0114129_10022356 3300009147 Bacteria 8977
248 Ga0114129_10138086 3300009147 Bacteria 3344
249 Ga0114129_10361799 3300009147 Bacteria 1920
250 Ga0105243_10127355 3300009148 Bacteria 2156
251 Ga0105243_10441815 3300009148 Bacteria 1218
252 Ga0105241_10393368 3300009174 Bacteria 1214
253 Ga0105242_10001820 3300009176 Bacteria 16759
254 Ga0105242_10034131 3300009176 Bacteria 4078
255 Ga0105242_10518280 3300009176 Bacteria 1137
256 Ga0105248_10015692 3300009177 Bacteria 8349
257 Ga0105248_10035536 3300009177 Bacteria 5575
258 Ga0105248_10041502 3300009177 Bacteria 5158
259 Ga0105248_10145968 3300009177 Bacteria 2670
260 Ga0105249_10002856 3300009553 Bacteria 14921
261 Ga0105249_10015905 3300009553 Bacteria 6668
262 Ga0105239_10120364 3300010375 Bacteria 2915
263 Ga0105239_10596506 3300010375 Bacteria 1260
264 Ga0105246_10288245 3300011119 Bacteria 1320
265 Ga0157371_10014127 3300013102 Bacteria 6039
266 Ga0157370_10507160 3300013104 Bacteria 1108
267 Ga0157369_10052370 3300013105 Bacteria 4416
268 Ga0157369_10360462 3300013105 Bacteria 1509
269 Ga0157374_10013830 3300013296 Bacteria 7050
270 Ga0157374_10058068 3300013296 Bacteria 3616
271 Ga0157374_10074280 3300013296 Bacteria 3210
272 Ga0157374_10362012 3300013296 Bacteria 1442
273 Ga0157374_10528826 3300013296 Bacteria 1186
274 Ga0157378_10012281 3300013297 Bacteria 7497
275 Ga0157378_10295215 3300013297 Bacteria 1567
276 Ga0163162_10063413 3300013306 Bacteria 3738
277 Ga0163162_10069100 3300013306 Bacteria 3585
278 Ga0163162_10134768 3300013306 Bacteria 2580
279 Ga0163163_10000047 3300014325 Bacteria 131685
280 Ga0163163_10074376 3300014325 Bacteria 3389
281 Ga0163163_10121029 3300014325 Bacteria 2651
282 Ga0157380_10001050 3300014326 Bacteria 17674
283 Ga0157380_10084627 3300014326 Bacteria 2601
284 Ga0157380_10176025 3300014326 Bacteria 1875
285 Ga0157377_10009491 3300014745 Bacteria 4776
286 Ga0157377_10052274 3300014745 Bacteria 2306
287 Ga0157377_10062173 3300014745 Bacteria 2136
288 Ga0157379_10015970 3300014968 Bacteria 6601
289 Ga0157379_10029374 3300014968 Bacteria 4890
290 Ga0157379_10263884 3300014968 Bacteria 1565
291 Ga0157379_10350913 3300014968 Bacteria 1351
292 Ga0157376_10016370 3300014969 Bacteria 5628
293 Ga0157376_10062685 3300014969 Bacteria 3129
294 Ga0157376_10141618 3300014969 Bacteria 2158
295 Ga0157376_10161849 3300014969 Bacteria 2030
296 Ga0157376_10187612 3300014969 Bacteria 1894
297 Ga0163161_10014143 3300017792 Bacteria 5557
298 Ga0163161_10015034 3300017792 Bacteria 5394
299 Ga0163161_10070946 3300017792 Bacteria 2548
300 Ga0207697_10005781 3300025315 Bacteria 5700
301 Ga0207656_10041126 3300025321 Bacteria 1963
302 Ga0207656_10079212 3300025321 Bacteria 1474
303 Ga0207682_10011274 3300025893 Bacteria 3494
304 Ga0207642_10085280 3300025899 Bacteria 1545
305 Ga0207688_10090954 3300025901 Bacteria 1752
306 Ga0207647_10017695 3300025904 Bacteria 4840
307 Ga0207699_10023308 3300025906 Bacteria 3368
308 Ga0207645_10006960 3300025907 Bacteria 8052
309 Ga0207645_10141113 3300025907 Bacteria 1570
310 Ga0207705_10019580 3300025909 Bacteria 4838
311 Ga0207684_10048726 3300025910 Bacteria 3594
312 Ga0207684_10074424 3300025910 Bacteria 2886
313 Ga0207707_10008344 3300025912 Bacteria 8986
314 Ga0207707_10015750 3300025912 Bacteria 6591
315 Ga0207707_10145970 3300025912 Bacteria 2068
316 Ga0207707_10331056 3300025912 Bacteria 1314
317 Ga0207695_10056266 3300025913 Bacteria 4094
318 Ga0207695_10151352 3300025913 Bacteria 2259
319 Ga0207660_10011645 3300025917 Bacteria 5735
320 Ga0207660_10273117 3300025917 Bacteria 1339
321 Ga0207662_10014150 3300025918 Bacteria 4470
322 Ga0207662_10035891 3300025918 Bacteria 2896
323 Ga0207662_10036362 3300025918 Bacteria 2878
324 Ga0207657_10009778 3300025919 Bacteria 9614
325 Ga0207657_10015934 3300025919 Bacteria 7262
326 Ga0207657_10037942 3300025919 Bacteria 4296
327 Ga0207657_10069962 3300025919 Bacteria 2976
328 Ga0207652_10095008 3300025921 Bacteria 2625
329 Ga0207646_10004704 3300025922 Bacteria 14713
330 Ga0207646_10034355 3300025922 Bacteria 4582
331 Ga0207646_10063672 3300025922 Bacteria 3292
332 Ga0207646_10200847 3300025922 Bacteria 1801
333 Ga0207681_10009058 3300025923 Bacteria 6081
334 Ga0207681_10098547 3300025923 Bacteria 2103
335 Ga0207681_10125802 3300025923 Bacteria 1887
336 Ga0207650_10008859 3300025925 Bacteria 6876
337 Ga0207650_10010122 3300025925 Bacteria 6461
338 Ga0207650_10012310 3300025925 Bacteria 5904
339 Ga0207650_10026225 3300025925 Bacteria 4155
340 Ga0207650_10122420 3300025925 Bacteria 2027
341 Ga0207650_10123851 3300025925 Bacteria 2015
342 Ga0207650_10138328 3300025925 Bacteria 1912
343 Ga0207650_10380966 3300025925 Bacteria 1165
344 Ga0207659_10000201 3300025926 Bacteria 35674
345 Ga0207659_10000485 3300025926 Bacteria 23902
346 Ga0207659_10025434 3300025926 Bacteria 3978
347 Ga0207659_10034937 3300025926 Bacteria 3471
348 Ga0207659_10118531 3300025926 Bacteria 2025
349 Ga0207659_10146806 3300025926 Bacteria 1837
350 Ga0207659_10156150 3300025926 Bacteria 1786
351 Ga0207687_10031950 3300025927 Bacteria 3562
352 Ga0207700_10073216 3300025928 Bacteria 2645
353 Ga0207664_10371035 3300025929 Bacteria 1269
354 Ga0207644_10201277 3300025931 Bacteria 1571
355 Ga0207644_10225921 3300025931 Bacteria 1486
356 Ga0207690_10156877 3300025932 Bacteria 1693
357 Ga0207706_10001309 3300025933 Bacteria 24997
358 Ga0207706_10408637 3300025933 Bacteria 1177
359 Ga0207686_10008015 3300025934 Bacteria 5698
360 Ga0207686_10379874 3300025934 Bacteria 1071
361 Ga0207686_10389444 3300025934 Bacteria 1059
362 Ga0207709_10053561 3300025935 Bacteria 2483
363 Ga0207670_10008943 3300025936 Bacteria 5683
364 Ga0207670_10049166 3300025936 Bacteria 2819
365 Ga0207669_10051237 3300025937 Bacteria 2472
366 Ga0207704_10056417 3300025938 Bacteria 2406
367 Ga0207691_10004320 3300025940 Bacteria 13804
368 Ga0207691_10038391 3300025940 Bacteria 4432
369 Ga0207691_10066010 3300025940 Bacteria 3274
370 Ga0207691_10094051 3300025940 Bacteria 2682
371 Ga0207691_10231644 3300025940 Bacteria 1599
372 Ga0207691_10400128 3300025940 Bacteria 1171
373 Ga0207711_10057420 3300025941 Bacteria 3346
374 Ga0207711_10214819 3300025941 Bacteria 1757
375 Ga0207711_10239441 3300025941 Bacteria 1664
376 Ga0207711_10376859 3300025941 Bacteria 1316
377 Ga0207689_10009051 3300025942 Bacteria 8623
378 Ga0207689_10012446 3300025942 Bacteria 7269
379 Ga0207689_10042882 3300025942 Bacteria 3741
380 Ga0207689_10116442 3300025942 Bacteria 2197
381 Ga0207661_10002434 3300025944 Bacteria 12827
382 Ga0207661_10108092 3300025944 Bacteria 2347
383 Ga0207661_10117875 3300025944 Bacteria 2256
384 Ga0207661_10163284 3300025944 Bacteria 1934
385 Ga0207679_10005311 3300025945 Bacteria 8074
386 Ga0207679_10025879 3300025945 Bacteria 4041
387 Ga0207679_10201610 3300025945 Bacteria 1662
388 Ga0207679_10242960 3300025945 Bacteria 1526
389 Ga0207679_10393222 3300025945 Bacteria 1218
390 Ga0207667_10074383 3300025949 Bacteria 3529
391 Ga0207667_10096242 3300025949 Bacteria 3055
392 Ga0207667_10122358 3300025949 Bacteria 2681
393 Ga0207651_10047329 3300025960 Bacteria 2899
394 Ga0207651_10174384 3300025960 Bacteria 1699
395 Ga0207651_10293306 3300025960 Bacteria 1349
396 Ga0207712_10007680 3300025961 Bacteria 6821
397 Ga0207668_10036276 3300025972 Bacteria 3289
398 Ga0207668_10096423 3300025972 Bacteria 2186
399 Ga0207668_10221971 3300025972 Bacteria 1518
400 Ga0207658_10062456 3300025986 Bacteria 2788
401 Ga0207658_10247824 3300025986 Bacteria 1512
402 Ga0207658_10248283 3300025986 Bacteria 1511
403 Ga0207677_10096370 3300026023 Bacteria 2164
404 Ga0207677_10110909 3300026023 Bacteria 2043
405 Ga0207703_10064973 3300026035 Bacteria 2997
406 Ga0207703_10068658 3300026035 Bacteria 2921
407 Ga0207703_10108019 3300026035 Bacteria 2369
408 Ga0207678_10010487 3300026067 Bacteria 8138
409 Ga0207678_10039718 3300026067 Bacteria 4082
410 Ga0207708_10003791 3300026075 Bacteria 11151
411 Ga0207708_10151509 3300026075 Bacteria 1826
412 Ga0207708_10162846 3300026075 Bacteria 1762
413 Ga0207708_10252864 3300026075 Bacteria 1420
414 Ga0207641_10015691 3300026088 Bacteria 6206
415 Ga0207641_10035816 3300026088 Bacteria 4138
416 Ga0207641_10095757 3300026088 Bacteria 2606
417 Ga0207641_10173312 3300026088 Bacteria 1971
418 Ga0207648_10000478 3300026089 Bacteria 44666
419 Ga0207648_10007553 3300026089 Bacteria 10668
420 Ga0207676_10009357 3300026095 Bacteria 6973
421 Ga0207676_10055410 3300026095 Bacteria 3112
422 Ga0207676_10216409 3300026095 Bacteria 1703
423 Ga0207674_10000351 3300026116 Bacteria 59444
424 Ga0207674_10013331 3300026116 Bacteria 9131
425 Ga0207674_10022970 3300026116 Bacteria 6689
426 Ga0207674_10150892 3300026116 Bacteria 2281
427 Ga0207675_100004109 3300026118 Bacteria 14090
428 Ga0207675_100006968 3300026118 Bacteria 10692
429 Ga0207675_100006985 3300026118 Bacteria 10678
430 Ga0207675_100016432 3300026118 Bacteria 6912
431 Ga0207675_100072982 3300026118 Bacteria 3210
432 Ga0207675_100158207 3300026118 Bacteria 2160
433 Ga0207675_100259503 3300026118 Bacteria 1684
434 Ga0207675_100262894 3300026118 Bacteria 1673
435 Ga0207683_10020165 3300026121 Bacteria 5699
436 Ga0207683_10029538 3300026121 Bacteria 4747
437 Ga0207683_10044577 3300026121 Bacteria 3878
438 Ga0207683_10089859 3300026121 Bacteria 2734
439 Ga0207698_10348892 3300026142 Bacteria 1397
440 Ga0209813_10017803 3300027866 Bacteria 1954
441 Ga0207428_10002238 3300027907 Bacteria 19440
442 Ga0207428_10010793 3300027907 Bacteria 8144
443 Ga0207428_10019222 3300027907 Bacteria 5826
444 Ga0207428_10022059 3300027907 Bacteria 5378
445 Ga0207428_10046519 3300027907 Bacteria 3489
446 Ga0268266_10013261 3300028379 Bacteria 7103
447 Ga0268266_10097730 3300028379 Bacteria 2583
448 Ga0268265_10000663 3300028380 Bacteria 34113
449 Ga0268265_10007550 3300028380 Bacteria 7339
450 Ga0268265_10050527 3300028380 Bacteria 3133
451 Ga0268264_10002304 3300028381 Bacteria 16905
452 Ga0268264_10024851 3300028381 Bacteria 4894
453 Ga0268264_10114961 3300028381 Bacteria 2363
454 Ga0265332_10000115 3300031238 Bacteria 67467
455 Ga0265328_10018472 3300031239 Bacteria 2688
456 Ga0265320_10018431 3300031240 Bacteria 3843
457 Ga0265329_10039940 3300031242 Bacteria 1506
458 Ga0265339_10009076 3300031249 Bacteria 6282
459 Ga0265331_10000357 3300031250 Bacteria 48222
460 Ga0265316_10000194 3300031344 Bacteria 70399
461 Ga0265316_10000961 3300031344 Bacteria 31406
462 Ga0307408_100006627 3300031548 Bacteria 7682
463 Ga0265314_10000001 3300031711 Bacteria 3792860
464 Ga0265314_10001563 3300031711 Bacteria 25210
465 Ga0307406_10001316 3300031901 Bacteria 13940
466 Ga0373930_0003245 3300034816 Bacteria 2571
467 Ga0373958_0004568 3300034819 Bacteria 2055
468 Ga0373958_0004910 3300034819 Bacteria 2003
469 Ga0373959_0003133 3300034820 Bacteria 2633
470 Ga0373938_0000961 3300034957 Bacteria 4624
471 Ga0373928_0014790 3300035084 Bacteria 1582
472 Ga0373929_0001216 3300035085 Bacteria 4975
473 Ga0373940_0000595 3300035088 Bacteria 5737
474 Ga0373949_0032317 3300035090 Bacteria 1252
475 Ga0373951_0001197 3300035091 Bacteria 6861
476 Ga0373952_0012865 3300035092 Bacteria 1652
477 Ga0373932_0000205 3300035112 Bacteria 17455
478 Ga0373939_0001024 3300035114 Bacteria 6891
479 Ga0373941_0041020 3300035115 Bacteria 1430
480 Ga0373956_0054434 3300035119 Bacteria 1803
481 Ga0373960_0001877 3300035121 Bacteria 4703
482 Ga0373943_0003644 3300035170 Bacteria 7003
483 Ga0373955_0020449 3300035172 Bacteria 3328
484 Ga0373942_0001612 3300035207 Bacteria 5777
485 Ga0373961_0004466 3300035241 Bacteria 3381
486 Ga0373924_0133213 3300035410 Bacteria 1082
487 Ga0373931_0087940 3300035691 Bacteria 1726
488 Ga0373931_0101420 3300035691 Bacteria 1619
489 Ga0373931_0123105 3300035691 Bacteria 1484
490 Ga0373935_0004883 3300035692 Bacteria 7882
491 Ga0373935_0070939 3300035692 Bacteria 2247
492 Ga0373935_0080076 3300035692 Bacteria 2121
493 Ga0373933_0064339 3300035724 Bacteria 2219
494 Ga0373933_0065740 3300035724 Bacteria 2196
495 Ga0373937_0002641 3300036401 Bacteria 14940
496 Ga0373937_0064756 3300036401 Bacteria 3363
497 Ga0373937_0095268 3300036401 Bacteria 2760
498 Ga0395901_0169766 3300038443 Bacteria 2289
499 Ga0436365_1114141 3300039437 Bacteria 2752
500 Ga0453683_0131572 3300044673 Bacteria 1577
501 Ga0466963_0075567 3300044694 Bacteria 2274
502 Ga0451576_0004346 3300045051 Bacteria 18494
503 Ga0451576_0046329 3300045051 Bacteria 4579
504 Ga0451576_0117578 3300045051 Bacteria 2768
505 Ga0451576_0127984 3300045051 Bacteria 2646
506 Ga0451576_0237130 3300045051 Bacteria 1905
507 Ga0451576_0281334 3300045051 Bacteria 1739
508 Ga0466967_0136334 3300045976 Bacteria 2283
509 Ga0495592_0081099 3300046454 Bacteria 2346
510 Ga0495629_0096069 3300046459 Bacteria 2067
511 Ga0495629_0143991 3300046459 Bacteria 1658
512 Ga0495638_0036896 3300046460 Bacteria 3111
513 Ga0495580_0314900 3300046472 Bacteria 1064
514 Ga0495664_0068417 3300046477 Bacteria 2119
515 Ga0495608_0021568 3300046511 Bacteria 4420
516 Ga0495608_0113903 3300046511 Bacteria 1737
517 Ga0495628_0148059 3300046516 Bacteria 1789
518 Ga0495628_0294410 3300046516 Bacteria 1202
519 Ga0495628_0320435 3300046516 Bacteria 1144
520 Ga0495630_0008663 3300046517 Bacteria 7302
521 Ga0495640_0092443 3300046533 Bacteria 1995
522 Ga0495640_0189500 3300046533 Bacteria 1308
523 Ga0495586_0100815 3300046535 Bacteria 1602
524 Ga0495587_0021294 3300046536 Bacteria 3998
525 Ga0495598_0052180 3300046537 Bacteria 1235
526 Ga0495645_0003442 3300046543 Bacteria 10729
527 Ga0495645_0015977 3300046543 Bacteria 5349
528 Ga0495633_0056463 3300046558 Bacteria 1845
529 Ga0495667_0031441 3300046559 Bacteria 3564
530 Ga0495667_0105385 3300046559 Bacteria 1823
531 Ga0495635_0064866 3300046663 Bacteria 2507
532 Ga0495659_0079593 3300046664 Bacteria 1241
533 Ga0495658_0077801 3300046683 Bacteria 1940
534 Ga0495658_0102797 3300046683 Bacteria 1708
535 Ga0495658_0120589 3300046683 Bacteria 1586
536 Ga0495669_0024912 3300046684 Bacteria 2607
537 Ga0495613_0032754 3300046689 Bacteria 3861
538 Ga0495600_0023104 3300046809 Bacteria 4000
539 Ga0495604_0056790 3300047317 Bacteria 3011
540 Ga0495604_0100707 3300047317 Bacteria 2124
541 Ga0495674_0065057 3300047319 Bacteria 3168
542 Ga0495674_0310630 3300047319 Bacteria 1286
543 Ga0495680_0090778 3300047322 Bacteria 2291
544 Ga0495684_0000315 3300047471 Bacteria 39623
545 Ga0495684_0060932 3300047471 Bacteria 2872
546 Ga0496101_0006105 3300048904 Bacteria 7738
547 Ga0496101_0207491 3300048904 Bacteria 1517
548 Ga0496101_0414257 3300048904 Bacteria 1062
549 Ga0496102_0133716 3300048905 Bacteria 2323
550 Ga0496103_0038298 3300048906 Bacteria 2941
551 Ga0496104_0033302 3300048907 Bacteria 4799
552 Ga0496104_0057488 3300048907 Bacteria 3680
553 Ga0496104_0166417 3300048907 Bacteria 2114
554 Ga0496104_0238371 3300048907 Bacteria 1731
555 Ga0496105_0156128 3300048908 Bacteria 1874
556 Ga0496106_0012055 3300048909 Bacteria 6379
557 Ga0496106_0047091 3300048909 Bacteria 3244
558 Ga0496106_0227382 3300048909 Bacteria 1489
559 Ga0496107_0170880 3300048910 Bacteria 1613
560 Ga0496108_0004283 3300048911 Bacteria 11484
561 Ga0496108_0024698 3300048911 Bacteria 4950
562 Ga0496109_0009590 3300048912 Bacteria 8256
563 Ga0496109_0019550 3300048912 Bacteria 5975
564 Ga0496109_0169117 3300048912 Bacteria 2050
565 Ga0496110_0006882 3300048913 Bacteria 9040
566 Ga0496110_0051831 3300048913 Bacteria 3606
567 Ga0496110_0075310 3300048913 Bacteria 2999
568 Ga0496110_0080229 3300048913 Bacteria 2907
569 Ga0496110_0114984 3300048913 Bacteria 2422
570 Ga0496110_0296175 3300048913 Bacteria 1474
571 Ga0496111_0010625 3300048914 Bacteria 6187
572 Ga0496112_0003297 3300048915 Bacteria 13325
573 Ga0496112_0066888 3300048915 Bacteria 3546
574 Ga0496113_0297024 3300048916 Bacteria 1293
575 Ga0496114_0000214 3300048917 Bacteria 42204
576 Ga0496114_0014932 3300048917 Bacteria 6242
577 Ga0496114_0110106 3300048917 Bacteria 2359
578 Ga0496114_0114932 3300048917 Bacteria 2308
579 Ga0496114_0236259 3300048917 Bacteria 1606
580 Ga0496114_0288125 3300048917 Bacteria 1449
581 Ga0496115_0044271 3300048918 Bacteria 3550
582 Ga0496115_0183350 3300048918 Bacteria 1730
583 Ga0501032_0033197 3300049569 Bacteria 3536
584 Ga0501033_0002589 3300049570 Bacteria 15245
585 Ga0501034_0021313 3300049571 Bacteria 6607
586 Ga0501034_0032639 3300049571 Bacteria 5287
587 Ga0501034_0081344 3300049571 Bacteria 3241
588 Ga0501034_0121409 3300049571 Bacteria 2599
589 Ga0501036_0004095 3300049572 Bacteria 11734
590 Ga0501036_0011230 3300049572 Bacteria 7409
591 Ga0501038_0021838 3300049574 Bacteria 5741
592 Ga0501039_0013579 3300049575 Bacteria 6229
593 Ga0501043_0093695 3300049579 Bacteria 2361
594 Ga0501046_0014029 3300049580 Bacteria 6767
595 Ga0501046_0070046 3300049580 Bacteria 2727
596 Ga0501047_0076607 3300049581 Bacteria 3218
597 Ga0501048_0034888 3300049582 Bacteria 3625
598 Ga0501068_0015964 3300049584 Bacteria 4325
599 Ga0501068_0162548 3300049584 Bacteria 1407
600 Ga0501070_0006376 3300049586 Bacteria 10042
601 Ga0501070_0138114 3300049586 Bacteria 2012
602 Ga0501073_0002383 3300049589 Bacteria 14068
603 Ga0501073_0023626 3300049589 Bacteria 4411
604 Ga0501073_0042175 3300049589 Bacteria 3221
605 Ga0501074_0013254 3300049590 Bacteria 5992
606 Ga0501074_0074053 3300049590 Bacteria 2445
607 Ga0501074_0092647 3300049590 Bacteria 2164
608 Ga0501076_0035099 3300049592 Bacteria 3923
609 Ga0501079_0019356 3300049741 Bacteria 5198
610 Ga0501079_0048848 3300049741 Bacteria 3265
611 Ga0501080_0013631 3300049742 Bacteria 7484
612 Ga0501083_0080310 3300049744 Bacteria 2162
613 Ga0501083_0109876 3300049744 Bacteria 1813
614 Ga0501035_0017285 3300049822 Bacteria 6649
615 Ga0501035_0164305 3300049822 Bacteria 1920
616 Ga0501044_0005392 3300049823 Bacteria 14202
617 Ga0501045_0039188 3300049824 Bacteria 3448
618 nmdc:mga00v17_19411_c1 3300050491 Bacteria 3880
619 nmdc:mga00v17_44545_c1 3300050491 Bacteria 2676
620 nmdc:mga0yw44_293825_c1 3300050492 Bacteria 1088
621 nmdc:mga0k408_2375_c1 3300050493 Bacteria 9227
622 nmdc:mga0k408_46097_c1 3300050493 Bacteria 2517
623 nmdc:mga0k408_5248_c1 3300050493 Bacteria 5680
624 nmdc:mga06z11_10814_c1 3300050494 Bacteria 3906
625 nmdc:mga06z11_38547_c1 3300050494 Bacteria 2374
626 nmdc:mga06z11_41150_c1 3300050494 Bacteria 2311
627 nmdc:mga06z11_7977_c1 3300050494 Bacteria 4387
628 nmdc:mga07m45_101834_c1 3300050496 Bacteria 1649
629 nmdc:mga07m45_21385_c1 3300050496 Bacteria 3522
630 nmdc:mga07m45_22048_c1 3300050496 Bacteria 3475
631 nmdc:mga05p37_10185_c1 3300050507 Bacteria 11160
632 nmdc:mga05p37_13484_c1 3300050507 Bacteria 9795
633 nmdc:mga05p37_208968_c1 3300050507 Bacteria 2360
634 nmdc:mga05p37_33735_c1 3300050507 Bacteria 6269
635 nmdc:mga05p37_36249_c1 3300050507 Bacteria 6053
636 nmdc:mga05p37_439918_c1 3300050507 Bacteria 1512
637 nmdc:mga05p37_484264_c1 3300050507 Bacteria 1424
638 nmdc:mga05p37_487768_c1 3300050507 Bacteria 1417
639 nmdc:mga05p37_508293_c1 3300050507 Bacteria 1381
640 nmdc:mga05p37_514392_c1 3300050507 Bacteria 1371
641 nmdc:mga05p37_56315_c1 3300050507 Bacteria 3660
642 nmdc:mga05p37_8938_c1 3300050507 Bacteria 11844
643 nmdc:mga05p37_96257_c1 3300050507 Bacteria 3647
644 nmdc:mga09592_107393_c1 3300050508 Bacteria 2394
645 nmdc:mga06r32_209116_c1 3300050510 Bacteria 1939
646 nmdc:mga08y16_17811_c1 3300050511 Bacteria 7483
647 nmdc:mga08y16_29688_c1 3300050511 Bacteria 5758
648 nmdc:mga08y16_47960_c1 3300050511 Bacteria 4471
649 nmdc:mga08y16_537413_c1 3300050511 Bacteria 1184
650 nmdc:mga08y16_56855_c1 3300050511 Bacteria 4088
651 nmdc:mga08y16_570217_c1 3300050511 Bacteria 1144
652 nmdc:mga08y16_69235_c1 3300050511 Unclassified 3679
653 nmdc:mga08y16_8678_c1 3300050511 Bacteria 10661
654 nmdc:mga0n895_148379_c1 3300050512 Bacteria 2374
655 nmdc:mga0n895_250847_c1 3300050512 Bacteria 1796
656 nmdc:mga0n895_263457_c1 3300050512 Bacteria 1749
657 nmdc:mga0n895_293780_c1 3300050512 Bacteria 1647
658 nmdc:mga0n895_304013_c1 3300050512 Bacteria 1617
659 nmdc:mga0n895_316604_c1 3300050512 Bacteria 1581
660 nmdc:mga0n895_40237_c1 3300050512 Bacteria 4540
661 nmdc:mga0n895_49307_c1 3300050512 Bacteria 4124
662 nmdc:mga0n895_63295_c1 3300050512 Bacteria 3658
663 nmdc:mga0rr50_13805_c1 3300050513 Bacteria 5275
664 nmdc:mga0rr50_36796_c1 3300050513 Bacteria 3528
665 nmdc:mga0rr50_38976_c1 3300050513 Bacteria 3444
666 nmdc:mga0rr50_468012_c1 3300050513 Bacteria 1070
667 nmdc:mga0rr50_87178_c1 3300050513 Bacteria 2423
668 nmdc:mga0rr50_91913_c1 3300050513 Bacteria 2365
669 nmdc:mga0rr50_99329_c1 3300050513 Bacteria 2283
670 nmdc:mga08x19_19471_c1 3300050514 Bacteria 4165
671 nmdc:mga08x19_229587_c1 3300050514 Bacteria 1277
672 nmdc:mga08x19_8138_c1 3300050514 Bacteria 6230
673 nmdc:mga0a205_158569_c1 3300050515 Bacteria 2160
674 nmdc:mga0a205_168653_c1 3300050515 Bacteria 2085
675 nmdc:mga0a205_17267_c1 3300050515 Bacteria 6761
676 nmdc:mga0a205_226107_c1 3300050515 Bacteria 1756
677 nmdc:mga0a205_26619_c1 3300050515 Bacteria 5517
678 nmdc:mga0a205_49981_c1 3300050515 Bacteria 4037
679 nmdc:mga0a205_5966_c1 3300050515 Bacteria 10978
680 nmdc:mga0a205_76808_c1 3300050515 Bacteria 3228
681 Ga0495601_0039717 3300053077 Bacteria 2948
682 Ga0495595_0037152 3300053084 Bacteria 2213
683 Ga0495619_0011534 3300053085 Bacteria 5571
684 Ga0495619_0022673 3300053085 Bacteria 4021
685 Ga0495619_0096868 3300053085 Bacteria 2003
686 Ga0501084_0035627 3300054114 Bacteria 4160
687 Ga0501084_0209569 3300054114 Bacteria 1644
688 Ga0501082_0009279 3300060353 Bacteria 8478
689 Ga0068852_100035557
690 Ga0065712_10003846
691 Ga0065712_10078228
692 Ga0065715_10004238
693 Ga0065715_10095042
694 Ga0065715_10119283
695 Ga0065715_10164795
696 Ga0065707_10005377
697 Ga0065707_10006219
698 Ga0070658_10011606
699 Ga0070676_10173437
700 Ga0070683_100006348
701 Ga0070683_100132612
702 Ga0070690_100051448
703 Ga0070690_100058694
704 Ga0070670_100004652
705 Ga0070670_100008773
706 Ga0070670_100332852
707 Ga0070677_10028150
708 Ga0068869_100293328
709 Ga0070666_10144840
710 Ga0068868_100023747
711 Ga0068868_100149769
712 Ga0068868_100151710
713 Ga0070660_100029286
714 Ga0070660_100038736
715 Ga0070660_100051060
716 Ga0070660_100346418
717 Ga0070689_100001466
718 Ga0070689_100074026
719 Ga0070689_100074091
720 Ga0070689_100096314
721 Ga0070661_100023703
722 Ga0070661_100351221
723 Ga0070661_100372787
724 Ga0070692_10004334
725 Ga0070668_100199114
726 Ga0070669_100003963
727 Ga0070669_100013444
728 Ga0070669_100045026
729 Ga0070669_100075289
730 Ga0070669_100168940
731 Ga0070675_100000204
732 Ga0070675_100001331
733 Ga0070675_100019041
734 Ga0070675_100031393
735 Ga0070675_100043447
736 Ga0070675_100074068
737 Ga0070675_100144830
738 Ga0070675_100237131
739 Ga0070675_100452212
740 Ga0070671_100030668
741 Ga0070671_100034971
742 Ga0070671_100194203
743 Ga0070674_100089610
744 Ga0070674_100274543
745 Ga0070673_100015358
746 Ga0070673_100024245
747 Ga0070673_100356676
748 Ga0070688_100002384
749 Ga0070688_100125196
750 Ga0070659_100019851
751 Ga0070659_100026916
752 Ga0070659_100028699
753 Ga0070659_100148574
754 Ga0070667_100106997
755 Ga0070667_100145709
756 Ga0070701_10001358
757 Ga0070701_10020600
758 Ga0070701_10021709
759 Ga0070700_100001923
760 Ga0070700_100124058
761 Ga0070694_100003153
762 Ga0070694_100134527
763 Ga0070708_100009396
764 Ga0070708_100106393
765 Ga0070663_100077010
766 Ga0070663_100189243
767 Ga0070678_100022187
768 Ga0070662_100074956
769 Ga0070662_100112950
770 Ga0070681_10002327
771 Ga0070681_10022051
772 Ga0068867_100004007
773 Ga0068867_100134202
774 Ga0068867_100170626
775 Ga0070685_10100123
776 Ga0070706_100150451
777 Ga0070707_100017901
778 Ga0070707_100057701
779 Ga0070707_100086656
780 Ga0070707_100088440
781 Ga0070707_100126548
782 Ga0070707_100359234
783 Ga0070698_100078459
784 Ga0070699_100012295
785 Ga0070699_100015170
786 Ga0070699_100043055
787 Ga0070679_100004446
788 Ga0070679_100030362
789 Ga0070684_100005985
790 Ga0070684_100118470
791 Ga0070697_100059375
792 Ga0068853_100416797
793 Ga0070672_100012360
794 Ga0070672_100026781
795 Ga0070672_100043452
796 Ga0070672_100151292
797 Ga0070672_100208090
798 Ga0070686_100024567
799 Ga0070686_100079806
800 Ga0070686_100205751
801 Ga0070695_100000574
802 Ga0070696_100001855
803 Ga0070696_100026293
804 Ga0070696_100071648
805 Ga0070665_100000588
806 Ga0070665_100026025
807 Ga0070665_100101278
808 Ga0070665_100265922
809 Ga0070704_100011714
810 Ga0070704_100015012
811 Ga0070704_100061774
812 Ga0070704_100208327
813 Ga0068855_100039563
814 Ga0070664_100000766
815 Ga0070664_100003776
816 Ga0070664_100115804
817 Ga0070664_100147162
818 Ga0068857_100001973
819 Ga0068857_100003390
820 Ga0068857_100085738
821 Ga0068854_100032237
822 Ga0068856_100535946
823 Ga0070702_100034802
824 Ga0068852_100032691
825 Ga0068852_100304365
826 Ga0068859_100007386
827 Ga0068859_100017753
828 Ga0068859_100027398
829 Ga0068859_100027890
830 Ga0068859_100034618
831 Ga0068864_100006200
832 Ga0068864_100009059
833 Ga0068864_100041565
834 Ga0068864_100056278
835 Ga0068864_100433790
836 Ga0068861_100002466
837 Ga0068861_100003130
838 Ga0068861_100020252
839 Ga0068861_100172558
840 Ga0068861_100199138
841 Ga0068861_100377683
842 Ga0068851_10061164
843 Ga0068870_10062820
844 Ga0068863_100040201
845 Ga0068863_100271902
846 Ga0068858_100005367
847 Ga0068858_100019428
848 Ga0068858_100055942
849 Ga0068858_100181871
850 Ga0068860_100001702
851 Ga0068862_100001611
852 Ga0068862_100001703
853 Ga0068862_100038850
854 Ga0068862_100082939
855 Ga0068862_100090981
856 Ga0068862_100104861
857 Ga0081455_10145417
858 Ga0081539_10047393
859 Ga0075363_100183050
860 Ga0075364_10035270
861 Ga0075364_10059658
862 Ga0075364_10089858
863 Ga0075367_10019191
864 Ga0075367_10021488
865 Ga0075367_10060979
866 Ga0075366_10016726
867 Ga0075366_10135272
868 Ga0097621_100004353
869 Ga0097621_100031639
870 Ga0097621_100046088
871 Ga0097621_100050109
872 Ga0097621_100069115
873 Ga0097621_100126162
874 Ga0097621_100403006
875 Ga0075370_10018053
876 Ga0068871_100001385
877 Ga0068871_100008151
878 Ga0068871_100020947
879 Ga0068871_100084363
880 Ga0068871_100175434
881 Ga0068871_100316090
882 Ga0068871_100371428
883 Ga0075428_100004279
884 Ga0075428_100012594
885 Ga0075428_100077569
886 Ga0075431_100276690
887 Ga0075433_10030996
888 Ga0075433_10046401
889 Ga0075433_10083885
890 Ga0075433_10092278
891 Ga0075433_10146155
892 Ga0075433_10218538
893 Ga0075434_100004506
894 Ga0075434_100031934
895 Ga0075434_100049036
896 Ga0075434_100136165
897 Ga0075434_100199538
898 Ga0075434_100289571
899 Ga0075434_100317019
900 Ga0075434_100417023
901 Ga0075434_100508216
902 Ga0075429_100035521
903 Ga0075429_100138960
904 Ga0068865_100051630
905 Ga0075436_100006693
906 Ga0075436_100037755
907 Ga0075436_100069645
908 Ga0097620_100007386
909 Ga0097620_100017754
910 Ga0097620_100027397
911 Ga0097620_100027890
912 Ga0097620_100034622
913 Ga0075435_100006452
914 Ga0075435_100010427
915 Ga0075435_100016947
916 Ga0075435_100063164
917 Ga0075435_100091904
918 Ga0075435_100120701
919 Ga0075435_100216692
920 Ga0105240_10210971
921 Ga0111539_10002853
922 Ga0111539_10013795
923 Ga0111539_10028702
924 Ga0111539_10038649
925 Ga0111539_10040055
926 Ga0111539_10062729
927 Ga0111539_10253678
928 Ga0111539_10722266
929 Ga0105245_10008432
930 Ga0105245_10071155
931 Ga0105245_10590855
932 Ga0114129_10002566
933 Ga0114129_10005856
934 Ga0114129_10012152
935 Ga0114129_10022356
936 Ga0114129_10138086
937 Ga0114129_10361799
938 Ga0105243_10127355
939 Ga0105243_10441815
940 Ga0105241_10393368
941 Ga0105242_10001820
942 Ga0105242_10034131
943 Ga0105242_10518280
944 Ga0105248_10015692
945 Ga0105248_10035536
946 Ga0105248_10041502
947 Ga0105248_10145968
948 Ga0105249_10002856
949 Ga0105249_10015905
950 Ga0105239_10120364
951 Ga0105239_10596506
952 Ga0105246_10288245
953 Ga0157371_10014127
954 Ga0157370_10507160
955 Ga0157369_10052370
956 Ga0157369_10360462
957 Ga0157374_10013830
958 Ga0157374_10058068
959 Ga0157374_10074280
960 Ga0157374_10362012
961 Ga0157374_10528826
962 Ga0157378_10012281
963 Ga0157378_10295215
964 Ga0163162_10063413
965 Ga0163162_10069100
966 Ga0163162_10134768
967 Ga0163163_10000047
968 Ga0163163_10074376
969 Ga0163163_10121029
970 Ga0157380_10001050
971 Ga0157380_10084627
972 Ga0157380_10176025
973 Ga0157377_10009491
974 Ga0157377_10052274
975 Ga0157377_10062173
976 Ga0157379_10015970
977 Ga0157379_10029374
978 Ga0157379_10263884
979 Ga0157379_10350913
980 Ga0157376_10016370
981 Ga0157376_10062685
982 Ga0157376_10141618
983 Ga0157376_10161849
984 Ga0157376_10187612
985 Ga0163161_10014143
986 Ga0163161_10015034
987 Ga0163161_10070946
988 Ga0207697_10005781
989 Ga0207656_10041126
990 Ga0207656_10079212
991 Ga0207682_10011274
992 Ga0207642_10085280
993 Ga0207688_10090954
994 Ga0207647_10017695
995 Ga0207699_10023308
996 Ga0207645_10006960
997 Ga0207645_10141113
998 Ga0207705_10019580
999 Ga0207684_10048726
1000 Ga0207684_10074424
1001 Ga0207707_10008344
1002 Ga0207707_10015750
1003 Ga0207707_10145970
1004 Ga0207707_10331056
1005 Ga0207695_10056266
1006 Ga0207695_10151352
1007 Ga0207660_10011645
1008 Ga0207660_10273117
1009 Ga0207662_10014150
1010 Ga0207662_10035891
1011 Ga0207662_10036362
1012 Ga0207657_10009778
1013 Ga0207657_10015934
1014 Ga0207657_10037942
1015 Ga0207657_10069962
1016 Ga0207652_10095008
1017 Ga0207646_10004704
1018 Ga0207646_10034355
1019 Ga0207646_10063672
1020 Ga0207646_10200847
1021 Ga0207681_10009058
1022 Ga0207681_10098547
1023 Ga0207681_10125802
1024 Ga0207650_10008859
1025 Ga0207650_10010122
1026 Ga0207650_10012310
1027 Ga0207650_10026225
1028 Ga0207650_10122420
1029 Ga0207650_10123851
1030 Ga0207650_10138328
1031 Ga0207650_10380966
1032 Ga0207659_10000201
1033 Ga0207659_10000485
1034 Ga0207659_10025434
1035 Ga0207659_10034937
1036 Ga0207659_10118531
1037 Ga0207659_10146806
1038 Ga0207659_10156150
1039 Ga0207687_10031950
1040 Ga0207700_10073216
1041 Ga0207664_10371035
1042 Ga0207644_10201277
1043 Ga0207644_10225921
1044 Ga0207690_10156877
1045 Ga0207706_10001309
1046 Ga0207706_10408637
1047 Ga0207686_10008015
1048 Ga0207686_10379874
1049 Ga0207686_10389444
1050 Ga0207709_10053561
1051 Ga0207670_10008943
1052 Ga0207670_10049166
1053 Ga0207669_10051237
1054 Ga0207704_10056417
1055 Ga0207691_10004320
1056 Ga0207691_10038391
1057 Ga0207691_10066010
1058 Ga0207691_10094051
1059 Ga0207691_10231644
1060 Ga0207691_10400128
1061 Ga0207711_10057420
1062 Ga0207711_10214819
1063 Ga0207711_10239441
1064 Ga0207711_10376859
1065 Ga0207689_10009051
1066 Ga0207689_10012446
1067 Ga0207689_10042882
1068 Ga0207689_10116442
1069 Ga0207661_10002434
1070 Ga0207661_10108092
1071 Ga0207661_10117875
1072 Ga0207661_10163284
1073 Ga0207679_10005311
1074 Ga0207679_10025879
1075 Ga0207679_10201610
1076 Ga0207679_10242960
1077 Ga0207679_10393222
1078 Ga0207667_10074383
1079 Ga0207667_10096242
1080 Ga0207667_10122358
1081 Ga0207651_10047329
1082 Ga0207651_10174384
1083 Ga0207651_10293306
1084 Ga0207712_10007680
1085 Ga0207668_10036276
1086 Ga0207668_10096423
1087 Ga0207668_10221971
1088 Ga0207658_10062456
1089 Ga0207658_10247824
1090 Ga0207658_10248283
1091 Ga0207677_10096370
1092 Ga0207677_10110909
1093 Ga0207703_10064973
1094 Ga0207703_10068658
1095 Ga0207703_10108019
1096 Ga0207678_10010487
1097 Ga0207678_10039718
1098 Ga0207708_10003791
1099 Ga0207708_10151509
1100 Ga0207708_10162846
1101 Ga0207708_10252864
1102 Ga0207641_10015691
1103 Ga0207641_10035816
1104 Ga0207641_10095757
1105 Ga0207641_10173312
1106 Ga0207648_10000478
1107 Ga0207648_10007553
1108 Ga0207676_10009357
1109 Ga0207676_10055410
1110 Ga0207676_10216409
1111 Ga0207674_10000351
1112 Ga0207674_10013331
1113 Ga0207674_10022970
1114 Ga0207674_10150892
1115 Ga0207675_100004109
1116 Ga0207675_100006968
1117 Ga0207675_100006985
1118 Ga0207675_100016432
1119 Ga0207675_100072982
1120 Ga0207675_100158207
1121 Ga0207675_100259503
1122 Ga0207675_100262894
1123 Ga0207683_10020165
1124 Ga0207683_10029538
1125 Ga0207683_10044577
1126 Ga0207683_10089859
1127 Ga0207698_10348892
1128 Ga0209813_10017803
1129 Ga0207428_10002238
1130 Ga0207428_10010793
1131 Ga0207428_10019222
1132 Ga0207428_10022059
1133 Ga0207428_10046519
1134 Ga0268266_10013261
1135 Ga0268266_10097730
1136 Ga0268265_10000663
1137 Ga0268265_10007550
1138 Ga0268265_10050527
1139 Ga0268264_10002304
1140 Ga0268264_10024851
1141 Ga0268264_10114961
1142 Ga0265332_10000115
1143 Ga0265328_10018472
1144 Ga0265320_10018431
1145 Ga0265329_10039940
1146 Ga0265339_10009076
1147 Ga0265331_10000357
1148 Ga0265316_10000194
1149 Ga0265316_10000961
1150 Ga0307408_100006627
1151 Ga0265314_10000001
1152 Ga0265314_10001563
1153 Ga0307406_10001316
1154 Ga0373930_0003245
1155 Ga0373958_0004568
1156 Ga0373958_0004910
1157 Ga0373959_0003133
1158 Ga0373938_0000961
1159 Ga0373928_0014790
1160 Ga0373929_0001216
1161 Ga0373940_0000595
1162 Ga0373949_0032317
1163 Ga0373951_0001197
1164 Ga0373952_0012865
1165 Ga0373932_0000205
1166 Ga0373939_0001024
1167 Ga0373941_0041020
1168 Ga0373956_0054434
1169 Ga0373960_0001877
1170 Ga0373943_0003644
1171 Ga0373955_0020449
1172 Ga0373942_0001612
1173 Ga0373961_0004466
1174 Ga0373924_0133213
1175 Ga0373931_0087940
1176 Ga0373931_0101420
1177 Ga0373931_0123105
1178 Ga0373935_0004883
1179 Ga0373935_0070939
1180 Ga0373935_0080076
1181 Ga0373933_0064339
1182 Ga0373933_0065740
1183 Ga0373937_0002641
1184 Ga0373937_0064756
1185 Ga0373937_0095268
1186 Ga0395901_0169766
1187 Ga0436365_1114141
1188 Ga0453683_0131572
1189 Ga0466963_0075567
1190 Ga0451576_0004346
1191 Ga0451576_0046329
1192 Ga0451576_0117578
1193 Ga0451576_0127984
1194 Ga0451576_0237130
1195 Ga0451576_0281334
1196 Ga0466967_0136334
1197 Ga0495592_0081099
1198 Ga0495629_0096069
1199 Ga0495629_0143991
1200 Ga0495638_0036896
1201 Ga0495580_0314900
1202 Ga0495664_0068417
1203 Ga0495608_0021568
1204 Ga0495608_0113903
1205 Ga0495628_0148059
1206 Ga0495628_0294410
1207 Ga0495628_0320435
1208 Ga0495630_0008663
1209 Ga0495640_0092443
1210 Ga0495640_0189500
1211 Ga0495586_0100815
1212 Ga0495587_0021294
1213 Ga0495598_0052180
1214 Ga0495645_0003442
1215 Ga0495645_0015977
1216 Ga0495633_0056463
1217 Ga0495667_0031441
1218 Ga0495667_0105385
1219 Ga0495635_0064866
1220 Ga0495659_0079593
1221 Ga0495658_0077801
1222 Ga0495658_0102797
1223 Ga0495658_0120589
1224 Ga0495669_0024912
1225 Ga0495613_0032754
1226 Ga0495600_0023104
1227 Ga0495604_0056790
1228 Ga0495604_0100707
1229 Ga0495674_0065057
1230 Ga0495674_0310630
1231 Ga0495680_0090778
1232 Ga0495684_0000315
1233 Ga0495684_0060932
1234 Ga0496101_0006105
1235 Ga0496101_0207491
1236 Ga0496101_0414257
1237 Ga0496102_0133716
1238 Ga0496103_0038298
1239 Ga0496104_0033302
1240 Ga0496104_0057488
1241 Ga0496104_0166417
1242 Ga0496104_0238371
1243 Ga0496105_0156128
1244 Ga0496106_0012055
1245 Ga0496106_0047091
1246 Ga0496106_0227382
1247 Ga0496107_0170880
1248 Ga0496108_0004283
1249 Ga0496108_0024698
1250 Ga0496109_0009590
1251 Ga0496109_0019550
1252 Ga0496109_0169117
1253 Ga0496110_0006882
1254 Ga0496110_0051831
1255 Ga0496110_0075310
1256 Ga0496110_0080229
1257 Ga0496110_0114984
1258 Ga0496110_0296175
1259 Ga0496111_0010625
1260 Ga0496112_0003297
1261 Ga0496112_0066888
1262 Ga0496113_0297024
1263 Ga0496114_0000214
1264 Ga0496114_0014932
1265 Ga0496114_0110106
1266 Ga0496114_0114932
1267 Ga0496114_0236259
1268 Ga0496114_0288125
1269 Ga0496115_0044271
1270 Ga0496115_0183350
1271 Ga0501032_0033197
1272 Ga0501033_0002589
1273 Ga0501034_0021313
1274 Ga0501034_0032639
1275 Ga0501034_0081344
1276 Ga0501034_0121409
1277 Ga0501036_0004095
1278 Ga0501036_0011230
1279 Ga0501038_0021838
1280 Ga0501039_0013579
1281 Ga0501043_0093695
1282 Ga0501046_0014029
1283 Ga0501046_0070046
1284 Ga0501047_0076607
1285 Ga0501048_0034888
1286 Ga0501068_0015964
1287 Ga0501068_0162548
1288 Ga0501070_0006376
1289 Ga0501070_0138114
1290 Ga0501073_0002383
1291 Ga0501073_0023626
1292 Ga0501073_0042175
1293 Ga0501074_0013254
1294 Ga0501074_0074053
1295 Ga0501074_0092647
1296 Ga0501076_0035099
1297 Ga0501079_0019356
1298 Ga0501079_0048848
1299 Ga0501080_0013631
1300 Ga0501083_0080310
1301 Ga0501083_0109876
1302 Ga0501035_0017285
1303 Ga0501035_0164305
1304 Ga0501044_0005392
1305 Ga0501045_0039188
1306 nmdc:mga00v17_19411_c1
1307 nmdc:mga00v17_44545_c1
1308 nmdc:mga0yw44_293825_c1
1309 nmdc:mga0k408_2375_c1
1310 nmdc:mga0k408_46097_c1
1311 nmdc:mga0k408_5248_c1
1312 nmdc:mga06z11_10814_c1
1313 nmdc:mga06z11_38547_c1
1314 nmdc:mga06z11_41150_c1
1315 nmdc:mga06z11_7977_c1
1316 nmdc:mga07m45_101834_c1
1317 nmdc:mga07m45_21385_c1
1318 nmdc:mga07m45_22048_c1
1319 nmdc:mga05p37_10185_c1
1320 nmdc:mga05p37_13484_c1
1321 nmdc:mga05p37_208968_c1
1322 nmdc:mga05p37_33735_c1
1323 nmdc:mga05p37_36249_c1
1324 nmdc:mga05p37_439918_c1
1325 nmdc:mga05p37_484264_c1
1326 nmdc:mga05p37_487768_c1
1327 nmdc:mga05p37_508293_c1
1328 nmdc:mga05p37_514392_c1
1329 nmdc:mga05p37_56315_c1
1330 nmdc:mga05p37_8938_c1
1331 nmdc:mga05p37_96257_c1
1332 nmdc:mga09592_107393_c1
1333 nmdc:mga06r32_209116_c1
1334 nmdc:mga08y16_17811_c1
1335 nmdc:mga08y16_29688_c1
1336 nmdc:mga08y16_47960_c1
1337 nmdc:mga08y16_537413_c1
1338 nmdc:mga08y16_56855_c1
1339 nmdc:mga08y16_570217_c1
1340 nmdc:mga08y16_69235_c1
1341 nmdc:mga08y16_8678_c1
1342 nmdc:mga0n895_148379_c1
1343 nmdc:mga0n895_250847_c1
1344 nmdc:mga0n895_263457_c1
1345 nmdc:mga0n895_293780_c1
1346 nmdc:mga0n895_304013_c1
1347 nmdc:mga0n895_316604_c1
1348 nmdc:mga0n895_40237_c1
1349 nmdc:mga0n895_49307_c1
1350 nmdc:mga0n895_63295_c1
1351 nmdc:mga0rr50_13805_c1
1352 nmdc:mga0rr50_36796_c1
1353 nmdc:mga0rr50_38976_c1
1354 nmdc:mga0rr50_468012_c1
1355 nmdc:mga0rr50_87178_c1
1356 nmdc:mga0rr50_91913_c1
1357 nmdc:mga0rr50_99329_c1
1358 nmdc:mga08x19_19471_c1
1359 nmdc:mga08x19_229587_c1
1360 nmdc:mga08x19_8138_c1
1361 nmdc:mga0a205_158569_c1
1362 nmdc:mga0a205_168653_c1
1363 nmdc:mga0a205_17267_c1
1364 nmdc:mga0a205_226107_c1
1365 nmdc:mga0a205_26619_c1
1366 nmdc:mga0a205_49981_c1
1367 nmdc:mga0a205_5966_c1
1368 nmdc:mga0a205_76808_c1
1369 Ga0495601_0039717
1370 Ga0495595_0037152
1371 Ga0495619_0011534
1372 Ga0495619_0022673
1373 Ga0495619_0096868
1374 Ga0501084_0035627
1375 Ga0501084_0209569
1376 Ga0501082_0009279

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

20

164

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9546 1 218
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9518 3 225
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9392 1 218
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9385 3 222
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9339 1 224
ID Description Score Start End Superfamily
af_Q8T5Z7_540_794_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9677 2 224 3.40.50.300
af_Q8T6J0_514_774_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9672 2 224 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9624 4 225 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9621 2 225 3.40.50.300
af_Q9VDR4_479_718_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9604 2 223 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V6WXH7-F1-model_v4 AAA+ ATPase domain-containing protein 0.9821 1 165 GO:0005524
GO:0016887
AF-A0A511X0H7-F1-model_v4 ABC transporter domain-containing protein 0.9819 1 183 GO:0005524
GO:0016887
AF-A0A3D2KNM8-F1-model_v4 ABC transporter 0.9743 5 226 GO:0005524
GO:0016887
AF-A0A7X6ISA8-F1-model_v4 deleted 0.9736 57 156
AF-A0A7X7SX92-F1-model_v4 ABC transporter ATP-binding protein 0.9727 1 120 GO:0005524
GO:0016887

Map