F475171

General Info

Members Datasets Scaffolds Average Seq Length
686 235 1372 217

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100086918|Ga0070698_1000869185
Length 226
Sequence MILEVRAVAPFYKNGFVVGCERTREAVLIDPGDEVDELLGAVRDLDVDVQAVLLTHAHIDHITGVAAAKDAFDVPVYLHRDDLFLYEMAVQQGAMFGFKVRQPPPVDEFYGAEPFAFGDYAARAYHTPGHCPGGVCLAIGKTGQPGSGIGDRGSGSHLFVGDTLFAGSIGRTDLPGGDYNVLLRSITEVLFPLGDASIVHPGHGPDTTIGRERTTNPFVLEYLRSG

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
166 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
167 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
176 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 1.9
Rhizosphere 97.81
Stem 0
Stem Tuber 0
Unclassified 9.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100086918 3300005471 Bacteria 3113
2 JGI24746J21847_1000314 3300001977 Bacteria 6968
3 Ga0065714_10103660 3300005288 Bacteria 1599
4 Ga0065704_10217738 3300005289 Bacteria 1084
5 Ga0065712_10080773 3300005290 Bacteria 3071
6 Ga0065712_10142082 3300005290 Bacteria 1441
7 Ga0065712_10201811 3300005290 Bacteria 1105
8 Ga0065715_10003675 3300005293 Bacteria 7379
9 Ga0065715_10160142 3300005293 Bacteria 1637
10 Ga0065715_10225521 3300005293 Bacteria 1245
11 Ga0065715_10345293 3300005293 Bacteria 960
12 Ga0065707_10037487 3300005295 Bacteria 1272
13 Ga0065707_10082648 3300005295 Bacteria 13063
14 Ga0065707_10082970 3300005295 Bacteria 11113
15 Ga0065707_10146304 3300005295 Bacteria 1710
16 Ga0065707_10152956 3300005295 Bacteria 1638
17 Ga0065707_10202371 3300005295 Unclassified 1304
18 Ga0065707_10409691 3300005295 Bacteria 839
19 Ga0070658_10469621 3300005327 Bacteria 1085
20 Ga0070676_10087863 3300005328 Bacteria 1898
21 Ga0070676_10198210 3300005328 Bacteria 1315
22 Ga0070676_10260754 3300005328 Bacteria 1160
23 Ga0070676_10290765 3300005328 Bacteria 1104
24 Ga0070676_10441757 3300005328 Bacteria 913
25 Ga0070690_100036357 3300005330 Bacteria 3094
26 Ga0070690_100223456 3300005330 Bacteria 1320
27 Ga0070670_100004662 3300005331 Bacteria 11501
28 Ga0070670_100006826 3300005331 Bacteria 9669
29 Ga0070670_100162434 3300005331 Bacteria 1936
30 Ga0070670_100250297 3300005331 Bacteria 1543
31 Ga0070670_100882286 3300005331 Unclassified 810
32 Ga0070677_10006567 3300005333 Bacteria 3865
33 Ga0070677_10026033 3300005333 Bacteria 2190
34 Ga0068869_100017866 3300005334 Bacteria 4819
35 Ga0068869_100025712 3300005334 Bacteria 4091
36 Ga0068869_100029939 3300005334 Bacteria 3818
37 Ga0068869_100077907 3300005334 Bacteria 2467
38 Ga0068869_100263602 3300005334 Bacteria 1380
39 Ga0068869_100393069 3300005334 Bacteria 1139
40 Ga0070666_10093264 3300005335 Bacteria 2070
41 Ga0070666_10178946 3300005335 Bacteria 1487
42 Ga0070666_10252513 3300005335 Bacteria 1249
43 Ga0070680_100711903 3300005336 Bacteria 864
44 Ga0068868_100016487 3300005338 Bacteria 5488
45 Ga0068868_100028951 3300005338 Bacteria 4240
46 Ga0068868_100304720 3300005338 Bacteria 1354
47 Ga0068868_100872011 3300005338 Bacteria 816
48 Ga0070689_100023510 3300005340 Bacteria 4614
49 Ga0070689_100035750 3300005340 Bacteria 3796
50 Ga0070689_100042056 3300005340 Bacteria 3508
51 Ga0070687_100004680 3300005343 Bacteria 5473
52 Ga0070687_100006827 3300005343 Bacteria 4707
53 Ga0070687_100124365 3300005343 Bacteria 1480
54 Ga0070687_100279529 3300005343 Bacteria 1050
55 Ga0070661_100018357 3300005344 Bacteria 4973
56 Ga0070661_100235568 3300005344 Bacteria 1408
57 Ga0070661_100296387 3300005344 Unclassified 1258
58 Ga0070661_100657596 3300005344 Bacteria 851
59 Ga0070692_10001904 3300005345 Bacteria 7878
60 Ga0070692_10057038 3300005345 Unclassified 2046
61 Ga0070692_10206464 3300005345 Unclassified 1154
62 Ga0070668_100049514 3300005347 Bacteria 3232
63 Ga0070668_100087260 3300005347 Bacteria 2455
64 Ga0070669_100001115 3300005353 Bacteria 19624
65 Ga0070669_100009454 3300005353 Bacteria 6942
66 Ga0070669_100228796 3300005353 Bacteria 1473
67 Ga0070675_100000497 3300005354 Bacteria 26931
68 Ga0070675_100001310 3300005354 Bacteria 18174
69 Ga0070675_100004012 3300005354 Bacteria 11174
70 Ga0070675_100068115 3300005354 Bacteria 2947
71 Ga0070675_100068759 3300005354 Bacteria 2933
72 Ga0070675_100106872 3300005354 Bacteria 2363
73 Ga0070675_100362887 3300005354 Bacteria 1286
74 Ga0070671_100765075 3300005355 Bacteria 840
75 Ga0070674_100008926 3300005356 Bacteria 5987
76 Ga0070674_100009259 3300005356 Bacteria 5895
77 Ga0070674_100055252 3300005356 Bacteria 2749
78 Ga0070674_100061120 3300005356 Bacteria 2628
79 Ga0070674_100427225 3300005356 Bacteria 1088
80 Ga0070673_100009954 3300005364 Bacteria 6409
81 Ga0070673_100097540 3300005364 Bacteria 2414
82 Ga0070673_100144955 3300005364 Bacteria 2007
83 Ga0070673_100196230 3300005364 Bacteria 1736
84 Ga0070688_100043103 3300005365 Bacteria 2778
85 Ga0070688_100192782 3300005365 Bacteria 1421
86 Ga0070688_100238322 3300005365 Bacteria 1290
87 Ga0070688_100252569 3300005365 Unclassified 1256
88 Ga0070659_100056452 3300005366 Bacteria 3096
89 Ga0070667_100027422 3300005367 Bacteria 4738
90 Ga0070667_100148800 3300005367 Bacteria 2055
91 Ga0070667_100241140 3300005367 Bacteria 1614
92 Ga0070667_100380949 3300005367 Bacteria 1281
93 Ga0070709_10402595 3300005434 Bacteria 1022
94 Ga0070701_10002679 3300005438 Bacteria 6904
95 Ga0070705_100063634 3300005440 Bacteria 2201
96 Ga0070700_100145505 3300005441 Bacteria 1615
97 Ga0070700_100249550 3300005441 Unclassified 1272
98 Ga0070700_100257984 3300005441 Bacteria 1254
99 Ga0070694_100020930 3300005444 Bacteria 4174
100 Ga0070708_100543682 3300005445 Bacteria 1096
101 Ga0070708_100628458 3300005445 Unclassified 1012
102 Ga0070663_100004122 3300005455 Bacteria 8491
103 Ga0070663_100289454 3300005455 Bacteria 1308
104 Ga0070663_100996259 3300005455 Bacteria 728
105 Ga0070678_100065462 3300005456 Bacteria 2699
106 Ga0070678_100171857 3300005456 Bacteria 1766
107 Ga0070678_100570699 3300005456 Bacteria 1007
108 Ga0070662_100128442 3300005457 Bacteria 1951
109 Ga0070662_100187782 3300005457 Bacteria 1632
110 Ga0070662_100613769 3300005457 Bacteria 915
111 Ga0070681_10165157 3300005458 Unclassified 2136
112 Ga0070681_10181309 3300005458 Bacteria 2027
113 Ga0068867_100012791 3300005459 Bacteria 5937
114 Ga0068867_100021519 3300005459 Bacteria 4601
115 Ga0068867_100132765 3300005459 Bacteria 1937
116 Ga0068867_100419694 3300005459 Bacteria 1133
117 Ga0068867_100628415 3300005459 Unclassified 940
118 Ga0070685_10022171 3300005466 Unclassified 3459
119 Ga0070685_10039593 3300005466 Bacteria 2679
120 Ga0070685_10055721 3300005466 Bacteria 2297
121 Ga0070685_10183754 3300005466 Bacteria 1348
122 Ga0070698_100005417 3300005471 Bacteria 13947
123 Ga0070698_100026499 3300005471 Bacteria 6035
124 Ga0070698_100074062 3300005471 Bacteria 3411
125 Ga0070698_100398570 3300005471 Bacteria 1309
126 Ga0070699_100001199 3300005518 Bacteria 23945
127 Ga0070699_100024426 3300005518 Bacteria 5208
128 Ga0070684_100390922 3300005535 Bacteria 1282
129 Ga0070684_100771559 3300005535 Bacteria 898
130 Ga0070672_100023083 3300005543 Bacteria 4581
131 Ga0070672_100165393 3300005543 Bacteria 1837
132 Ga0070672_100188870 3300005543 Bacteria 1719
133 Ga0070672_100198177 3300005543 Bacteria 1678
134 Ga0070672_100659079 3300005543 Bacteria 914
135 Ga0070686_100103334 3300005544 Bacteria 1928
136 Ga0070686_100196236 3300005544 Unclassified 1444
137 Ga0070695_100419256 3300005545 Unclassified 1019
138 Ga0070696_100014822 3300005546 Bacteria 5232
139 Ga0070696_100251828 3300005546 Unclassified 1336
140 Ga0070696_100359549 3300005546 Bacteria 1129
141 Ga0070665_100004450 3300005548 Bacteria 14719
142 Ga0070665_100005752 3300005548 Bacteria 12729
143 Ga0070665_100300689 3300005548 Unclassified 1607
144 Ga0070665_100458200 3300005548 Bacteria 1285
145 Ga0070704_100002402 3300005549 Bacteria 10508
146 Ga0070704_100016349 3300005549 Bacteria 4685
147 Ga0070704_100024994 3300005549 Bacteria 3927
148 Ga0070704_100104206 3300005549 Bacteria 2144
149 Ga0070704_100147437 3300005549 Bacteria 1846
150 Ga0070704_100237439 3300005549 Unclassified 1490
151 Ga0070664_100007557 3300005564 Bacteria 8775
152 Ga0070664_100010479 3300005564 Bacteria 7513
153 Ga0070664_100036735 3300005564 Unclassified 4116
154 Ga0070664_100271563 3300005564 Bacteria 1527
155 Ga0070664_100279283 3300005564 Bacteria 1506
156 Ga0070664_100574288 3300005564 Bacteria 1044
157 Ga0070664_100584879 3300005564 Bacteria 1035
158 Ga0070664_100630999 3300005564 Bacteria 995
159 Ga0070664_101034010 3300005564 Bacteria 773
160 Ga0068857_100003685 3300005577 Bacteria 12846
161 Ga0068857_100023288 3300005577 Bacteria 5451
162 Ga0068857_100109475 3300005577 Bacteria 2482
163 Ga0068857_101152238 3300005577 Unclassified 750
164 Ga0068854_100047009 3300005578 Bacteria 3075
165 Ga0068854_100791052 3300005578 Bacteria 826
166 Ga0068856_100577506 3300005614 Bacteria 1145
167 Ga0070702_100213107 3300005615 Unclassified 1287
168 Ga0068852_100061422 3300005616 Bacteria 3266
169 Ga0068859_100010997 3300005617 Bacteria 9106
170 Ga0068859_100050529 3300005617 Bacteria 4176
171 Ga0068859_100147074 3300005617 Bacteria 2431
172 Ga0068859_100329115 3300005617 Bacteria 1622
173 Ga0068859_100389721 3300005617 Bacteria 1489
174 Ga0068859_100440896 3300005617 Bacteria 1398
175 Ga0068859_100506749 3300005617 Bacteria 1302
176 Ga0068859_101179336 3300005617 Bacteria 843
177 Ga0068864_100037782 3300005618 Bacteria 4122
178 Ga0068864_100103862 3300005618 Bacteria 2523
179 Ga0068864_100108818 3300005618 Bacteria 2467
180 Ga0068864_100114950 3300005618 Bacteria 2400
181 Ga0068864_100116504 3300005618 Unclassified 2384
182 Ga0068864_100122581 3300005618 Bacteria 2326
183 Ga0068864_100187039 3300005618 Bacteria 1896
184 Ga0068864_100416209 3300005618 Bacteria 1280
185 Ga0068866_10031930 3300005718 Bacteria 2541
186 Ga0068866_10036229 3300005718 Bacteria 2416
187 Ga0068861_100031578 3300005719 Bacteria 3891
188 Ga0068861_100048372 3300005719 Bacteria 3214
189 Ga0068861_100086065 3300005719 Bacteria 2470
190 Ga0068861_100133215 3300005719 Bacteria 2019
191 Ga0068851_10120684 3300005834 Bacteria 1408
192 Ga0068870_10003258 3300005840 Bacteria 6851
193 Ga0068870_10005338 3300005840 Bacteria 5604
194 Ga0068870_10253039 3300005840 Bacteria 1093
195 Ga0068870_10378653 3300005840 Bacteria 915
196 Ga0068863_100025268 3300005841 Bacteria 5661
197 Ga0068863_100047359 3300005841 Bacteria 4078
198 Ga0068863_100075155 3300005841 Bacteria 3197
199 Ga0068863_100286948 3300005841 Bacteria 1595
200 Ga0068863_100291034 3300005841 Bacteria 1583
201 Ga0068863_100463217 3300005841 Bacteria 1245
202 Ga0068863_101074901 3300005841 Bacteria 809
203 Ga0068858_100010977 3300005842 Bacteria 8560
204 Ga0068858_100012439 3300005842 Bacteria 8024
205 Ga0068858_100020848 3300005842 Bacteria 6126
206 Ga0068858_100228373 3300005842 Bacteria 1764
207 Ga0068858_100287326 3300005842 Unclassified 1567
208 Ga0068858_100435879 3300005842 Bacteria 1262
209 Ga0068860_100017937 3300005843 Bacteria 6893
210 Ga0068860_100042754 3300005843 Bacteria 4325
211 Ga0068860_100614617 3300005843 Bacteria 1093
212 Ga0068862_100011733 3300005844 Bacteria 7231
213 Ga0068862_100020096 3300005844 Bacteria 5577
214 Ga0068862_100109072 3300005844 Bacteria 2428
215 Ga0068862_100197227 3300005844 Bacteria 1814
216 Ga0068862_100198211 3300005844 Bacteria 1809
217 Ga0068862_100435394 3300005844 Unclassified 1233
218 Ga0081539_10008804 3300005985 Bacteria 8644
219 Ga0075367_10197800 3300006178 Bacteria 1255
220 Ga0097621_100000858 3300006237 Bacteria 21364
221 Ga0097621_100022040 3300006237 Bacteria 4940
222 Ga0097621_100051725 3300006237 Bacteria 3344
223 Ga0097621_100077788 3300006237 Unclassified 2754
224 Ga0097621_100094410 3300006237 Bacteria 2508
225 Ga0097621_100118611 3300006237 Unclassified 2243
226 Ga0068871_100036689 3300006358 Unclassified 3904
227 Ga0068871_100047522 3300006358 Bacteria 3461
228 Ga0068871_100055047 3300006358 Bacteria 3229
229 Ga0068871_100351113 3300006358 Bacteria 1304
230 Ga0068871_100495372 3300006358 Unclassified 1101
231 Ga0068871_100558049 3300006358 Unclassified 1038
232 Ga0075428_100000007 3300006844 Bacteria 273226
233 Ga0075428_100001453 3300006844 Bacteria 25347
234 Ga0075428_100011190 3300006844 Bacteria 9985
235 Ga0075428_100038578 3300006844 Bacteria 5257
236 Ga0075428_100049534 3300006844 Bacteria 4608
237 Ga0075428_100235690 3300006844 Bacteria 1975
238 Ga0075428_100297084 3300006844 Bacteria 1737
239 Ga0075430_100001584 3300006846 Bacteria 18577
240 Ga0075430_100002399 3300006846 Bacteria 15583
241 Ga0075431_100000913 3300006847 Bacteria 26025
242 Ga0075431_100026894 3300006847 Bacteria 5901
243 Ga0075431_100069440 3300006847 Bacteria 3635
244 Ga0075433_10008301 3300006852 Bacteria 8278
245 Ga0075433_10100916 3300006852 Bacteria 2555
246 Ga0075433_10112159 3300006852 Bacteria 2419
247 Ga0075434_100003684 3300006871 Bacteria 13684
248 Ga0075434_100108510 3300006871 Bacteria 2786
249 Ga0075434_100479860 3300006871 Unclassified 1264
250 Ga0075434_100778878 3300006871 Unclassified 973
251 Ga0075429_100001862 3300006880 Bacteria 17471
252 Ga0075429_100004557 3300006880 Bacteria 11912
253 Ga0075429_100037349 3300006880 Bacteria 4228
254 Ga0075429_100138040 3300006880 Bacteria 2134
255 Ga0075429_100470845 3300006880 Bacteria 1101
256 Ga0068865_100009020 3300006881 Bacteria 6169
257 Ga0068865_100042091 3300006881 Bacteria 3112
258 Ga0097620_100010997 3300006931 Bacteria 9106
259 Ga0097620_100050530 3300006931 Bacteria 4176
260 Ga0097620_100147076 3300006931 Bacteria 2431
261 Ga0097620_100329121 3300006931 Bacteria 1622
262 Ga0097620_100389729 3300006931 Bacteria 1489
263 Ga0097620_100440915 3300006931 Bacteria 1398
264 Ga0097620_100506671 3300006931 Bacteria 1302
265 Ga0097620_100690327 3300006931 Bacteria 1112
266 Ga0097620_101179432 3300006931 Bacteria 843
267 Ga0075435_100002223 3300007076 Bacteria 12802
268 Ga0075435_100022941 3300007076 Bacteria 4818
269 Ga0075435_100050863 3300007076 Bacteria 3335
270 Ga0075435_100170078 3300007076 Bacteria 1838
271 Ga0075435_100396973 3300007076 Bacteria 1186
272 Ga0111539_10000209 3300009094 Bacteria 69503
273 Ga0111539_10003230 3300009094 Bacteria 21559
274 Ga0111539_10006735 3300009094 Bacteria 14781
275 Ga0111539_10015944 3300009094 Bacteria 9336
276 Ga0111539_10038679 3300009094 Bacteria 5757
277 Ga0111539_10118411 3300009094 Bacteria 3104
278 Ga0111539_10189604 3300009094 Bacteria 2399
279 Ga0111539_10270436 3300009094 Bacteria 1978
280 Ga0111539_10850366 3300009094 Unclassified 1062
281 Ga0111539_10994049 3300009094 Bacteria 975
282 Ga0105245_10006678 3300009098 Bacteria 10125
283 Ga0105245_10129724 3300009098 Bacteria 2364
284 Ga0105245_10571867 3300009098 Bacteria 1154
285 Ga0105247_10209312 3300009101 Bacteria 1315
286 Ga0105247_10517135 3300009101 Bacteria 872
287 Ga0114129_10000309 3300009147 Bacteria 56974
288 Ga0114129_10001185 3300009147 Bacteria 34615
289 Ga0114129_10025101 3300009147 Bacteria 8447
290 Ga0114129_10035504 3300009147 Bacteria 7042
291 Ga0114129_10099947 3300009147 Bacteria 4014
292 Ga0114129_10119879 3300009147 Bacteria 3623
293 Ga0114129_10123283 3300009147 Bacteria 3564
294 Ga0114129_10158806 3300009147 Bacteria 3091
295 Ga0114129_10196654 3300009147 Unclassified 2734
296 Ga0114129_10222575 3300009147 Bacteria 2545
297 Ga0114129_10688671 3300009147 Bacteria 1315
298 Ga0105243_10012393 3300009148 Bacteria 6445
299 Ga0105243_10110065 3300009148 Bacteria 2302
300 Ga0105241_10181093 3300009174 Bacteria 1748
301 Ga0105242_10001630 3300009176 Bacteria 17704
302 Ga0105242_10007066 3300009176 Bacteria 8672
303 Ga0105242_10069064 3300009176 Bacteria 2925
304 Ga0105242_10316030 3300009176 Unclassified 1431
305 Ga0105248_10004829 3300009177 Bacteria 14918
306 Ga0105248_10009873 3300009177 Bacteria 10511
307 Ga0105248_10017302 3300009177 Bacteria 7944
308 Ga0105238_10040683 3300009551 Bacteria 4710
309 Ga0105249_10012526 3300009553 Bacteria 7475
310 Ga0105249_10024992 3300009553 Bacteria 5375
311 Ga0105249_10277058 3300009553 Bacteria 1673
312 Ga0105249_11050022 3300009553 Bacteria 884
313 Ga0105246_10072760 3300011119 Bacteria 2424
314 Ga0105246_10084874 3300011119 Bacteria 2266
315 Ga0105246_10085052 3300011119 Unclassified 2264
316 Ga0105246_10212793 3300011119 Bacteria 1510
317 Ga0157374_10075683 3300013296 Bacteria 3181
318 Ga0157378_10128835 3300013297 Bacteria 2340
319 Ga0163162_10032108 3300013306 Bacteria 5213
320 Ga0163162_10187514 3300013306 Bacteria 2195
321 Ga0163162_10190440 3300013306 Bacteria 2179
322 Ga0163162_10419254 3300013306 Bacteria 1471
323 Ga0157372_10784043 3300013307 Bacteria 1108
324 Ga0157375_10031155 3300013308 Bacteria 5035
325 Ga0157375_10039647 3300013308 Bacteria 4535
326 Ga0157375_10653607 3300013308 Bacteria 1207
327 Ga0157375_11090489 3300013308 Bacteria 934
328 Ga0157375_11220765 3300013308 Bacteria 882
329 Ga0163163_10002201 3300014325 Bacteria 16409
330 Ga0163163_10013073 3300014325 Bacteria 7583
331 Ga0163163_10053532 3300014325 Bacteria 3984
332 Ga0163163_10074258 3300014325 Bacteria 3392
333 Ga0163163_10109330 3300014325 Bacteria 2792
334 Ga0157380_10000640 3300014326 Bacteria 21595
335 Ga0157380_10021267 3300014326 Bacteria 4864
336 Ga0157380_10070507 3300014326 Bacteria 2824
337 Ga0157380_10122927 3300014326 Bacteria 2201
338 Ga0157380_10180610 3300014326 Unclassified 1853
339 Ga0157380_10200404 3300014326 Bacteria 1770
340 Ga0157380_10233687 3300014326 Unclassified 1653
341 Ga0157380_10238244 3300014326 Bacteria 1639
342 Ga0157377_10012292 3300014745 Bacteria 4300
343 Ga0157377_10026869 3300014745 Bacteria 3084
344 Ga0157377_10059552 3300014745 Bacteria 2177
345 Ga0157379_10011668 3300014968 Bacteria 7671
346 Ga0157379_10057619 3300014968 Bacteria 3472
347 Ga0157379_10074141 3300014968 Bacteria 3046
348 Ga0157376_10004449 3300014969 Bacteria 9766
349 Ga0157376_10050638 3300014969 Bacteria 3446
350 Ga0157376_10063353 3300014969 Unclassified 3114
351 Ga0157376_10173640 3300014969 Bacteria 1964
352 Ga0157376_10370654 3300014969 Bacteria 1376
353 Ga0163161_10161475 3300017792 Bacteria 1709
354 Ga0163161_10222937 3300017792 Bacteria 1461
355 Ga0207697_10002368 3300025315 Bacteria 9822
356 Ga0207697_10026920 3300025315 Bacteria 2352
357 Ga0207682_10006724 3300025893 Bacteria 4619
358 Ga0207682_10009016 3300025893 Bacteria 3942
359 Ga0207642_10027654 3300025899 Bacteria 2324
360 Ga0207642_10045183 3300025899 Bacteria 1954
361 Ga0207710_10097647 3300025900 Bacteria 1382
362 Ga0207688_10005823 3300025901 Bacteria 6706
363 Ga0207680_10150081 3300025903 Bacteria 1553
364 Ga0207680_10251423 3300025903 Bacteria 1221
365 Ga0207699_10061895 3300025906 Bacteria 2254
366 Ga0207645_10003156 3300025907 Bacteria 12617
367 Ga0207645_10016881 3300025907 Bacteria 4824
368 Ga0207645_10041570 3300025907 Bacteria 2942
369 Ga0207645_10086950 3300025907 Unclassified 2008
370 Ga0207645_10294926 3300025907 Bacteria 1079
371 Ga0207645_10402067 3300025907 Bacteria 921
372 Ga0207643_10000878 3300025908 Bacteria 18132
373 Ga0207643_10002907 3300025908 Bacteria 9254
374 Ga0207643_10170142 3300025908 Bacteria 1315
375 Ga0207643_10222538 3300025908 Unclassified 1155
376 Ga0207643_10286698 3300025908 Bacteria 1022
377 Ga0207705_10366269 3300025909 Bacteria 1112
378 Ga0207684_10684983 3300025910 Bacteria 872
379 Ga0207707_10107532 3300025912 Unclassified 2438
380 Ga0207660_10087189 3300025917 Bacteria 2306
381 Ga0207660_10614328 3300025917 Bacteria 886
382 Ga0207662_10003687 3300025918 Bacteria 7936
383 Ga0207662_10012997 3300025918 Bacteria 4650
384 Ga0207662_10018441 3300025918 Bacteria 3960
385 Ga0207662_10303486 3300025918 Bacteria 1062
386 Ga0207657_10357565 3300025919 Bacteria 1151
387 Ga0207649_10008255 3300025920 Bacteria 5672
388 Ga0207649_10114002 3300025920 Unclassified 1811
389 Ga0207646_10487447 3300025922 Bacteria 1111
390 Ga0207681_10006537 3300025923 Bacteria 7149
391 Ga0207681_10193523 3300025923 Bacteria 1557
392 Ga0207681_10619437 3300025923 Bacteria 895
393 Ga0207650_10002729 3300025925 Bacteria 12192
394 Ga0207650_10004533 3300025925 Bacteria 9497
395 Ga0207650_10125264 3300025925 Bacteria 2005
396 Ga0207650_10313585 3300025925 Unclassified 1283
397 Ga0207659_10001990 3300025926 Bacteria 12091
398 Ga0207659_10003457 3300025926 Bacteria 9469
399 Ga0207659_10005005 3300025926 Bacteria 8032
400 Ga0207659_10022455 3300025926 Bacteria 4201
401 Ga0207659_10025092 3300025926 Bacteria 4000
402 Ga0207659_10049283 3300025926 Bacteria 2987
403 Ga0207659_10100773 3300025926 Bacteria 2177
404 Ga0207659_10120200 3300025926 Bacteria 2012
405 Ga0207659_10178141 3300025926 Bacteria 1682
406 Ga0207659_10192954 3300025926 Bacteria 1622
407 Ga0207690_10080953 3300025932 Bacteria 2268
408 Ga0207706_10060355 3300025933 Bacteria 3339
409 Ga0207706_10365089 3300025933 Bacteria 1254
410 Ga0207686_10003289 3300025934 Bacteria 8688
411 Ga0207686_10021858 3300025934 Bacteria 3677
412 Ga0207670_10004349 3300025936 Bacteria 7613
413 Ga0207670_10010420 3300025936 Bacteria 5355
414 Ga0207670_10655587 3300025936 Bacteria 866
415 Ga0207669_10017352 3300025937 Bacteria 3689
416 Ga0207669_10036132 3300025937 Bacteria 2820
417 Ga0207669_10212441 3300025937 Bacteria 1413
418 Ga0207669_10300723 3300025937 Bacteria 1219
419 Ga0207704_10028495 3300025938 Bacteria 3099
420 Ga0207704_10033395 3300025938 Bacteria 2925
421 Ga0207704_10119251 3300025938 Bacteria 1801
422 Ga0207691_10004961 3300025940 Bacteria 12841
423 Ga0207691_10035706 3300025940 Bacteria 4611
424 Ga0207691_10041376 3300025940 Bacteria 4255
425 Ga0207691_10064697 3300025940 Bacteria 3312
426 Ga0207691_10141529 3300025940 Bacteria 2120
427 Ga0207691_10167833 3300025940 Bacteria 1923
428 Ga0207691_10537147 3300025940 Bacteria 992
429 Ga0207711_10022315 3300025941 Bacteria 5292
430 Ga0207711_10032122 3300025941 Bacteria 4438
431 Ga0207711_10110267 3300025941 Bacteria 2447
432 Ga0207711_10144596 3300025941 Bacteria 2142
433 Ga0207711_10227056 3300025941 Bacteria 1709
434 Ga0207711_10286593 3300025941 Bacteria 1517
435 Ga0207689_10003535 3300025942 Bacteria 14285
436 Ga0207689_10019126 3300025942 Bacteria 5775
437 Ga0207689_10030425 3300025942 Bacteria 4499
438 Ga0207689_10259056 3300025942 Bacteria 1439
439 Ga0207689_10722890 3300025942 Bacteria 840
440 Ga0207661_10010511 3300025944 Bacteria 6665
441 Ga0207661_10993794 3300025944 Bacteria 773
442 Ga0207679_10009142 3300025945 Bacteria 6335
443 Ga0207679_10149582 3300025945 Bacteria 1898
444 Ga0207679_10154409 3300025945 Bacteria 1872
445 Ga0207679_10246858 3300025945 Bacteria 1515
446 Ga0207679_10264215 3300025945 Bacteria 1469
447 Ga0207679_10339824 3300025945 Unclassified 1305
448 Ga0207679_10543359 3300025945 Bacteria 1042
449 Ga0207679_10777633 3300025945 Bacteria 872
450 Ga0207651_10146425 3300025960 Unclassified 1832
451 Ga0207651_10203155 3300025960 Bacteria 1589
452 Ga0207651_10310167 3300025960 Unclassified 1315
453 Ga0207712_10012246 3300025961 Bacteria 5480
454 Ga0207712_10073023 3300025961 Bacteria 2473
455 Ga0207712_10322632 3300025961 Bacteria 1275
456 Ga0207668_10008918 3300025972 Bacteria 5999
457 Ga0207668_10067983 3300025972 Bacteria 2531
458 Ga0207668_10134391 3300025972 Unclassified 1893
459 Ga0207640_10321477 3300025981 Bacteria 1232
460 Ga0207640_10328943 3300025981 Bacteria 1220
461 Ga0207658_10065931 3300025986 Bacteria 2722
462 Ga0207658_10164912 3300025986 Bacteria 1819
463 Ga0207658_10421237 3300025986 Bacteria 1177
464 Ga0207658_10489183 3300025986 Bacteria 1094
465 Ga0207677_10050028 3300026023 Bacteria 2825
466 Ga0207677_10246835 3300026023 Bacteria 1447
467 Ga0207677_10737318 3300026023 Bacteria 877
468 Ga0207703_10039298 3300026035 Bacteria 3781
469 Ga0207703_10043255 3300026035 Unclassified 3615
470 Ga0207703_10110811 3300026035 Bacteria 2342
471 Ga0207703_10404534 3300026035 Bacteria 1267
472 Ga0207703_10545584 3300026035 Bacteria 1093
473 Ga0207639_10141934 3300026041 Bacteria 2002
474 Ga0207678_10014347 3300026067 Bacteria 6967
475 Ga0207678_10127547 3300026067 Bacteria 2170
476 Ga0207678_10579401 3300026067 Bacteria 983
477 Ga0207708_10010516 3300026075 Bacteria 6869
478 Ga0207708_10032281 3300026075 Bacteria 3977
479 Ga0207708_10081686 3300026075 Unclassified 2484
480 Ga0207708_10307713 3300026075 Bacteria 1290
481 Ga0207708_10434373 3300026075 Bacteria 1091
482 Ga0207702_10427735 3300026078 Bacteria 1281
483 Ga0207641_10132072 3300026088 Bacteria 2243
484 Ga0207641_10459747 3300026088 Bacteria 1231
485 Ga0207648_10000280 3300026089 Bacteria 55313
486 Ga0207648_10000778 3300026089 Bacteria 35949
487 Ga0207648_10018022 3300026089 Bacteria 6399
488 Ga0207648_10162233 3300026089 Bacteria 1974
489 Ga0207648_10268412 3300026089 Bacteria 1524
490 Ga0207648_10381426 3300026089 Bacteria 1275
491 Ga0207676_10027184 3300026095 Bacteria 4260
492 Ga0207676_10037412 3300026095 Bacteria 3698
493 Ga0207676_10037691 3300026095 Bacteria 3686
494 Ga0207676_10040382 3300026095 Bacteria 3576
495 Ga0207676_10092237 3300026095 Bacteria 2490
496 Ga0207676_10111571 3300026095 Bacteria 2289
497 Ga0207674_10017958 3300026116 Bacteria 7708
498 Ga0207674_10066332 3300026116 Unclassified 3636
499 Ga0207674_10088236 3300026116 Bacteria 3095
500 Ga0207674_10503767 3300026116 Bacteria 1170
501 Ga0207675_100002901 3300026118 Bacteria 16866
502 Ga0207675_100034720 3300026118 Bacteria 4704
503 Ga0207675_100067463 3300026118 Bacteria 3344
504 Ga0207675_100130103 3300026118 Bacteria 2386
505 Ga0207675_100169446 3300026118 Bacteria 2086
506 Ga0207675_100193106 3300026118 Bacteria 1953
507 Ga0207675_100215078 3300026118 Bacteria 1850
508 Ga0207683_10019564 3300026121 Bacteria 5782
509 Ga0207683_10035674 3300026121 Bacteria 4326
510 Ga0207683_10041927 3300026121 Bacteria 3997
511 Ga0207683_10054824 3300026121 Bacteria 3496
512 Ga0207683_10160606 3300026121 Bacteria 2031
513 Ga0207683_10233392 3300026121 Bacteria 1678
514 Ga0207698_11411908 3300026142 Bacteria 711
515 Ga0207428_10000022 3300027907 Bacteria 273333
516 Ga0207428_10001397 3300027907 Bacteria 25490
517 Ga0207428_10007184 3300027907 Bacteria 10184
518 Ga0207428_10010593 3300027907 Bacteria 8228
519 Ga0207428_10019846 3300027907 Bacteria 5725
520 Ga0207428_10317760 3300027907 Bacteria 1150
521 Ga0268266_10015025 3300028379 Bacteria 6646
522 Ga0268266_10138229 3300028379 Bacteria 2184
523 Ga0268266_10293059 3300028379 Unclassified 1516
524 Ga0268266_10363892 3300028379 Bacteria 1361
525 Ga0268265_10001623 3300028380 Bacteria 18519
526 Ga0268265_10008325 3300028380 Bacteria 7003
527 Ga0268265_10051253 3300028380 Bacteria 3115
528 Ga0268265_10118101 3300028380 Bacteria 2180
529 Ga0268264_10008876 3300028381 Bacteria 8334
530 Ga0268264_10135525 3300028381 Bacteria 2189
531 Ga0268264_10501908 3300028381 Bacteria 1183
532 Ga0268264_10641645 3300028381 Bacteria 1050
533 Ga0307408_100026292 3300031548 Bacteria 3996
534 Ga0307408_100163988 3300031548 Bacteria 1768
535 Ga0307405_10071187 3300031731 Bacteria 2236
536 Ga0307413_10005048 3300031824 Bacteria 5832
537 Ga0307413_10005363 3300031824 Bacteria 5715
538 Ga0307410_10003410 3300031852 Bacteria 7970
539 Ga0307410_10011541 3300031852 Bacteria 5057
540 Ga0307410_10012078 3300031852 Bacteria 4972
541 Ga0307406_10039508 3300031901 Bacteria 2928
542 Ga0307406_10063857 3300031901 Bacteria 2387
543 Ga0307407_10001198 3300031903 Bacteria 9174
544 Ga0307407_10006195 3300031903 Bacteria 5286
545 Ga0307409_100004583 3300031995 Bacteria 7791
546 Ga0307409_100025886 3300031995 Bacteria 4125
547 Ga0307409_100149996 3300031995 Bacteria 2022
548 Ga0307416_100045960 3300032002 Bacteria 3442
549 Ga0307416_100113870 3300032002 Bacteria 2391
550 Ga0307416_100177362 3300032002 Bacteria 1993
551 Ga0307416_100350620 3300032002 Bacteria 1493
552 Ga0307416_100730217 3300032002 Bacteria 1082
553 Ga0307414_10005547 3300032004 Bacteria 6959
554 Ga0307411_10113128 3300032005 Bacteria 1947
555 Ga0307411_10156756 3300032005 Bacteria 1699
556 Ga0307411_10166797 3300032005 Bacteria 1656
557 Ga0307411_10636025 3300032005 Bacteria 922
558 Ga0307415_100245014 3300032126 Bacteria 1452
559 Ga0373938_0118143 3300034957 Unclassified 681
560 Ga0373929_0055768 3300035085 Bacteria 914
561 Ga0373939_0094673 3300035114 Bacteria 1015
562 Ga0373941_0020572 3300035115 Bacteria 1852
563 Ga0373943_0239791 3300035170 Bacteria 1016
564 Ga0373961_0020190 3300035241 Unclassified 1759
565 Ga0373931_0018714 3300035691 Bacteria 3447
566 Ga0373933_0224781 3300035724 Unclassified 1205
567 Ga0373937_0161995 3300036401 Bacteria 2097
568 Ga0373937_0270438 3300036401 Bacteria 1604
569 Ga0395905_0921495 3300037471 Bacteria 777
570 Ga0439439_0007425 3300041406 Unclassified 2565
571 Ga0451807_0061681 3300041486 Bacteria 1003
572 Ga0451807_2181220 3300041486 Bacteria 1084
573 Ga0451577_0218352 3300042876 Bacteria 1723
574 Ga0451576_0010069 3300045051 Bacteria 10884
575 Ga0451576_0049022 3300045051 Bacteria 4432
576 Ga0451576_0069196 3300045051 Unclassified 3673
577 Ga0451576_0145324 3300045051 Unclassified 2473
578 Ga0451576_0185472 3300045051 Bacteria 2172
579 Ga0451576_1129085 3300045051 Bacteria 820
580 Ga0495580_0388995 3300046472 Bacteria 941
581 Ga0495580_0564098 3300046472 Bacteria 755
582 Ga0495584_0065472 3300046491 Bacteria 1828
583 Ga0495594_0080351 3300046499 Bacteria 1820
584 Ga0495628_0131674 3300046516 Unclassified 1912
585 Ga0495628_0144644 3300046516 Bacteria 1813
586 Ga0495642_0225321 3300046528 Bacteria 819
587 Ga0495640_0071961 3300046533 Bacteria 2318
588 Ga0495586_0259284 3300046535 Bacteria 993
589 Ga0495609_0213259 3300046538 Bacteria 804
590 Ga0495621_0142814 3300046539 Bacteria 938
591 Ga0495645_0003480 3300046543 Bacteria 10675
592 Ga0495656_0224162 3300046615 Bacteria 941
593 Ga0495634_0068608 3300046642 Bacteria 2342
594 Ga0495659_0020718 3300046664 Bacteria 2211
595 Ga0495659_0060861 3300046664 Bacteria 1394
596 Ga0495588_0058902 3300046674 Bacteria 1985
597 Ga0495588_0227822 3300046674 Bacteria 983
598 Ga0495599_0071939 3300046678 Bacteria 2158
599 Ga0495658_0015015 3300046683 Bacteria 3968
600 Ga0495658_0570489 3300046683 Bacteria 725
601 Ga0495670_0136275 3300046691 Bacteria 1282
602 Ga0495600_0050389 3300046809 Bacteria 2717
603 Ga0495674_0090842 3300047319 Bacteria 2609
604 Ga0495677_0132978 3300047445 Bacteria 953
605 Ga0495684_0030503 3300047471 Bacteria 4140
606 Ga0496104_0008765 3300048907 Bacteria 8992
607 Ga0496105_0418621 3300048908 Bacteria 1061
608 Ga0496108_0007098 3300048911 Bacteria 9072
609 Ga0496109_0091093 3300048912 Bacteria 2820
610 Ga0496109_0139146 3300048912 Bacteria 2270
611 Ga0496110_0104425 3300048913 Bacteria 2542
612 Ga0496112_0018261 3300048915 Bacteria 6602
613 Ga0496113_0007138 3300048916 Bacteria 7156
614 Ga0496113_0489389 3300048916 Bacteria 988
615 Ga0496114_0011233 3300048917 Bacteria 7150
616 Ga0496115_0015208 3300048918 Bacteria 5833
617 Ga0501303_007326 3300049526 Bacteria 982
618 Ga0501031_0459080 3300049568 Unclassified 823
619 Ga0501036_0107564 3300049572 Unclassified 2358
620 Ga0501041_0054307 3300049577 Unclassified 2444
621 Ga0501046_0261044 3300049580 Bacteria 1273
622 Ga0501068_0103743 3300049584 Bacteria 1764
623 Ga0501071_0499720 3300049587 Bacteria 933
624 Ga0501072_0075652 3300049588 Bacteria 2663
625 Ga0501072_0119688 3300049588 Bacteria 2098
626 Ga0501072_0637285 3300049588 Bacteria 839
627 Ga0501073_0002699 3300049589 Bacteria 13289
628 Ga0501074_0019879 3300049590 Bacteria 4878
629 Ga0501076_0480045 3300049592 Unclassified 1024
630 Ga0501079_0696374 3300049741 Bacteria 800
631 Ga0501080_0808779 3300049742 Bacteria 822
632 nmdc:mga06z11_195946_c1 3300050494 Bacteria 1171
633 nmdc:mga05p37_111992_c1 3300050507 Bacteria 3356
634 nmdc:mga05p37_114433_c1 3300050507 Unclassified 3316
635 nmdc:mga05p37_11462_c1 3300050507 Bacteria 10560
636 nmdc:mga05p37_130396_c1 3300050507 Bacteria 3084
637 nmdc:mga05p37_202950_c1 3300050507 Unclassified 2400
638 nmdc:mga05p37_26387_c1 3300050507 Bacteria 7065
639 nmdc:mga05p37_265571_c1 3300050507 Unclassified 2052
640 nmdc:mga05p37_293891_c1 3300050507 Bacteria 1933
641 nmdc:mga05p37_35057_c1 3300050507 Bacteria 6152
642 nmdc:mga05p37_41380_c1 3300050507 Bacteria 5657
643 nmdc:mga05p37_549206_c1 3300050507 Bacteria 1315
644 nmdc:mga05p37_7600_c1 3300050507 Bacteria 12787
645 nmdc:mga09592_102941_c1 3300050508 Bacteria 2446
646 nmdc:mga09592_200578_c1 3300050508 Bacteria 1728
647 nmdc:mga09592_233608_c1 3300050508 Bacteria 1593
648 nmdc:mga09592_32419_c1 3300050508 Bacteria 4356
649 nmdc:mga09592_3452_c1 3300050508 Bacteria 12770
650 nmdc:mga09592_39434_c1 3300050508 Bacteria 2025
651 nmdc:mga09592_649055_c1 3300050508 Bacteria 901
652 nmdc:mga0qj67_163596_c1 3300050509 Bacteria 1806
653 nmdc:mga0qj67_341441_c1 3300050509 Unclassified 1211
654 nmdc:mga0qj67_37509_c1 3300050509 Bacteria 3797
655 nmdc:mga0qj67_59988_c1 3300050509 Bacteria 3018
656 nmdc:mga06r32_2304_c1 3300050510 Bacteria 17078
657 nmdc:mga06r32_325142_c1 3300050510 Bacteria 1523
658 nmdc:mga06r32_5315_c1 3300050510 Bacteria 11591
659 nmdc:mga08y16_11843_c1 3300050511 Bacteria 9161
660 nmdc:mga08y16_131867_c1 3300050511 Bacteria 2598
661 nmdc:mga08y16_132825_c1 3300050511 Bacteria 2588
662 nmdc:mga08y16_21_c1 3300050511 Bacteria 254790
663 nmdc:mga08y16_283247_c1 3300050511 Bacteria 1709
664 nmdc:mga08y16_454511_c1 3300050511 Bacteria 1306
665 nmdc:mga08y16_61672_c1 3300050511 Bacteria 3915
666 nmdc:mga08y16_6615_c1 3300050511 Bacteria 12155
667 nmdc:mga08y16_8735_c1 3300050511 Bacteria 10626
668 nmdc:mga0n895_165869_c1 3300050512 Bacteria 2240
669 nmdc:mga0n895_39993_c1 3300050512 Unclassified 4554
670 nmdc:mga0n895_544893_c1 3300050512 Unclassified 1166
671 nmdc:mga0n895_7821_c1 3300050512 Bacteria 9213
672 nmdc:mga0rr50_113287_c1 3300050513 Bacteria 2149
673 nmdc:mga0rr50_188287_c1 3300050513 Bacteria 1690
674 nmdc:mga0rr50_230950_c1 3300050513 Bacteria 1531
675 nmdc:mga08x19_161149_c1 3300050514 Unclassified 1523
676 nmdc:mga08x19_6459_c1 3300050514 Bacteria 6940
677 nmdc:mga0a205_130717_c1 3300050515 Bacteria 2411
678 nmdc:mga0a205_145789_c1 3300050515 Bacteria 2267
679 nmdc:mga0a205_28830_c1 3300050515 Bacteria 5308
680 nmdc:mga0a205_887429_c1 3300050515 Bacteria 739
681 Ga0495601_0099816 3300053077 Unclassified 1874
682 Ga0495619_0026822 3300053085 Bacteria 3709
683 Ga0495619_0072564 3300053085 Bacteria 2306
684 Ga0501084_0042402 3300054114 Bacteria 3807
685 Ga0501084_0094048 3300054114 Bacteria 2517
686 Ga0530510_0075032 3300061734 Bacteria 2456
687 Ga0070698_100086918
688 JGI24746J21847_1000314
689 Ga0065714_10103660
690 Ga0065704_10217738
691 Ga0065712_10080773
692 Ga0065712_10142082
693 Ga0065712_10201811
694 Ga0065715_10003675
695 Ga0065715_10160142
696 Ga0065715_10225521
697 Ga0065715_10345293
698 Ga0065707_10037487
699 Ga0065707_10082648
700 Ga0065707_10082970
701 Ga0065707_10146304
702 Ga0065707_10152956
703 Ga0065707_10202371
704 Ga0065707_10409691
705 Ga0070658_10469621
706 Ga0070676_10087863
707 Ga0070676_10198210
708 Ga0070676_10260754
709 Ga0070676_10290765
710 Ga0070676_10441757
711 Ga0070690_100036357
712 Ga0070690_100223456
713 Ga0070670_100004662
714 Ga0070670_100006826
715 Ga0070670_100162434
716 Ga0070670_100250297
717 Ga0070670_100882286
718 Ga0070677_10006567
719 Ga0070677_10026033
720 Ga0068869_100017866
721 Ga0068869_100025712
722 Ga0068869_100029939
723 Ga0068869_100077907
724 Ga0068869_100263602
725 Ga0068869_100393069
726 Ga0070666_10093264
727 Ga0070666_10178946
728 Ga0070666_10252513
729 Ga0070680_100711903
730 Ga0068868_100016487
731 Ga0068868_100028951
732 Ga0068868_100304720
733 Ga0068868_100872011
734 Ga0070689_100023510
735 Ga0070689_100035750
736 Ga0070689_100042056
737 Ga0070687_100004680
738 Ga0070687_100006827
739 Ga0070687_100124365
740 Ga0070687_100279529
741 Ga0070661_100018357
742 Ga0070661_100235568
743 Ga0070661_100296387
744 Ga0070661_100657596
745 Ga0070692_10001904
746 Ga0070692_10057038
747 Ga0070692_10206464
748 Ga0070668_100049514
749 Ga0070668_100087260
750 Ga0070669_100001115
751 Ga0070669_100009454
752 Ga0070669_100228796
753 Ga0070675_100000497
754 Ga0070675_100001310
755 Ga0070675_100004012
756 Ga0070675_100068115
757 Ga0070675_100068759
758 Ga0070675_100106872
759 Ga0070675_100362887
760 Ga0070671_100765075
761 Ga0070674_100008926
762 Ga0070674_100009259
763 Ga0070674_100055252
764 Ga0070674_100061120
765 Ga0070674_100427225
766 Ga0070673_100009954
767 Ga0070673_100097540
768 Ga0070673_100144955
769 Ga0070673_100196230
770 Ga0070688_100043103
771 Ga0070688_100192782
772 Ga0070688_100238322
773 Ga0070688_100252569
774 Ga0070659_100056452
775 Ga0070667_100027422
776 Ga0070667_100148800
777 Ga0070667_100241140
778 Ga0070667_100380949
779 Ga0070709_10402595
780 Ga0070701_10002679
781 Ga0070705_100063634
782 Ga0070700_100145505
783 Ga0070700_100249550
784 Ga0070700_100257984
785 Ga0070694_100020930
786 Ga0070708_100543682
787 Ga0070708_100628458
788 Ga0070663_100004122
789 Ga0070663_100289454
790 Ga0070663_100996259
791 Ga0070678_100065462
792 Ga0070678_100171857
793 Ga0070678_100570699
794 Ga0070662_100128442
795 Ga0070662_100187782
796 Ga0070662_100613769
797 Ga0070681_10165157
798 Ga0070681_10181309
799 Ga0068867_100012791
800 Ga0068867_100021519
801 Ga0068867_100132765
802 Ga0068867_100419694
803 Ga0068867_100628415
804 Ga0070685_10022171
805 Ga0070685_10039593
806 Ga0070685_10055721
807 Ga0070685_10183754
808 Ga0070698_100005417
809 Ga0070698_100026499
810 Ga0070698_100074062
811 Ga0070698_100398570
812 Ga0070699_100001199
813 Ga0070699_100024426
814 Ga0070684_100390922
815 Ga0070684_100771559
816 Ga0070672_100023083
817 Ga0070672_100165393
818 Ga0070672_100188870
819 Ga0070672_100198177
820 Ga0070672_100659079
821 Ga0070686_100103334
822 Ga0070686_100196236
823 Ga0070695_100419256
824 Ga0070696_100014822
825 Ga0070696_100251828
826 Ga0070696_100359549
827 Ga0070665_100004450
828 Ga0070665_100005752
829 Ga0070665_100300689
830 Ga0070665_100458200
831 Ga0070704_100002402
832 Ga0070704_100016349
833 Ga0070704_100024994
834 Ga0070704_100104206
835 Ga0070704_100147437
836 Ga0070704_100237439
837 Ga0070664_100007557
838 Ga0070664_100010479
839 Ga0070664_100036735
840 Ga0070664_100271563
841 Ga0070664_100279283
842 Ga0070664_100574288
843 Ga0070664_100584879
844 Ga0070664_100630999
845 Ga0070664_101034010
846 Ga0068857_100003685
847 Ga0068857_100023288
848 Ga0068857_100109475
849 Ga0068857_101152238
850 Ga0068854_100047009
851 Ga0068854_100791052
852 Ga0068856_100577506
853 Ga0070702_100213107
854 Ga0068852_100061422
855 Ga0068859_100010997
856 Ga0068859_100050529
857 Ga0068859_100147074
858 Ga0068859_100329115
859 Ga0068859_100389721
860 Ga0068859_100440896
861 Ga0068859_100506749
862 Ga0068859_101179336
863 Ga0068864_100037782
864 Ga0068864_100103862
865 Ga0068864_100108818
866 Ga0068864_100114950
867 Ga0068864_100116504
868 Ga0068864_100122581
869 Ga0068864_100187039
870 Ga0068864_100416209
871 Ga0068866_10031930
872 Ga0068866_10036229
873 Ga0068861_100031578
874 Ga0068861_100048372
875 Ga0068861_100086065
876 Ga0068861_100133215
877 Ga0068851_10120684
878 Ga0068870_10003258
879 Ga0068870_10005338
880 Ga0068870_10253039
881 Ga0068870_10378653
882 Ga0068863_100025268
883 Ga0068863_100047359
884 Ga0068863_100075155
885 Ga0068863_100286948
886 Ga0068863_100291034
887 Ga0068863_100463217
888 Ga0068863_101074901
889 Ga0068858_100010977
890 Ga0068858_100012439
891 Ga0068858_100020848
892 Ga0068858_100228373
893 Ga0068858_100287326
894 Ga0068858_100435879
895 Ga0068860_100017937
896 Ga0068860_100042754
897 Ga0068860_100614617
898 Ga0068862_100011733
899 Ga0068862_100020096
900 Ga0068862_100109072
901 Ga0068862_100197227
902 Ga0068862_100198211
903 Ga0068862_100435394
904 Ga0081539_10008804
905 Ga0075367_10197800
906 Ga0097621_100000858
907 Ga0097621_100022040
908 Ga0097621_100051725
909 Ga0097621_100077788
910 Ga0097621_100094410
911 Ga0097621_100118611
912 Ga0068871_100036689
913 Ga0068871_100047522
914 Ga0068871_100055047
915 Ga0068871_100351113
916 Ga0068871_100495372
917 Ga0068871_100558049
918 Ga0075428_100000007
919 Ga0075428_100001453
920 Ga0075428_100011190
921 Ga0075428_100038578
922 Ga0075428_100049534
923 Ga0075428_100235690
924 Ga0075428_100297084
925 Ga0075430_100001584
926 Ga0075430_100002399
927 Ga0075431_100000913
928 Ga0075431_100026894
929 Ga0075431_100069440
930 Ga0075433_10008301
931 Ga0075433_10100916
932 Ga0075433_10112159
933 Ga0075434_100003684
934 Ga0075434_100108510
935 Ga0075434_100479860
936 Ga0075434_100778878
937 Ga0075429_100001862
938 Ga0075429_100004557
939 Ga0075429_100037349
940 Ga0075429_100138040
941 Ga0075429_100470845
942 Ga0068865_100009020
943 Ga0068865_100042091
944 Ga0097620_100010997
945 Ga0097620_100050530
946 Ga0097620_100147076
947 Ga0097620_100329121
948 Ga0097620_100389729
949 Ga0097620_100440915
950 Ga0097620_100506671
951 Ga0097620_100690327
952 Ga0097620_101179432
953 Ga0075435_100002223
954 Ga0075435_100022941
955 Ga0075435_100050863
956 Ga0075435_100170078
957 Ga0075435_100396973
958 Ga0111539_10000209
959 Ga0111539_10003230
960 Ga0111539_10006735
961 Ga0111539_10015944
962 Ga0111539_10038679
963 Ga0111539_10118411
964 Ga0111539_10189604
965 Ga0111539_10270436
966 Ga0111539_10850366
967 Ga0111539_10994049
968 Ga0105245_10006678
969 Ga0105245_10129724
970 Ga0105245_10571867
971 Ga0105247_10209312
972 Ga0105247_10517135
973 Ga0114129_10000309
974 Ga0114129_10001185
975 Ga0114129_10025101
976 Ga0114129_10035504
977 Ga0114129_10099947
978 Ga0114129_10119879
979 Ga0114129_10123283
980 Ga0114129_10158806
981 Ga0114129_10196654
982 Ga0114129_10222575
983 Ga0114129_10688671
984 Ga0105243_10012393
985 Ga0105243_10110065
986 Ga0105241_10181093
987 Ga0105242_10001630
988 Ga0105242_10007066
989 Ga0105242_10069064
990 Ga0105242_10316030
991 Ga0105248_10004829
992 Ga0105248_10009873
993 Ga0105248_10017302
994 Ga0105238_10040683
995 Ga0105249_10012526
996 Ga0105249_10024992
997 Ga0105249_10277058
998 Ga0105249_11050022
999 Ga0105246_10072760
1000 Ga0105246_10084874
1001 Ga0105246_10085052
1002 Ga0105246_10212793
1003 Ga0157374_10075683
1004 Ga0157378_10128835
1005 Ga0163162_10032108
1006 Ga0163162_10187514
1007 Ga0163162_10190440
1008 Ga0163162_10419254
1009 Ga0157372_10784043
1010 Ga0157375_10031155
1011 Ga0157375_10039647
1012 Ga0157375_10653607
1013 Ga0157375_11090489
1014 Ga0157375_11220765
1015 Ga0163163_10002201
1016 Ga0163163_10013073
1017 Ga0163163_10053532
1018 Ga0163163_10074258
1019 Ga0163163_10109330
1020 Ga0157380_10000640
1021 Ga0157380_10021267
1022 Ga0157380_10070507
1023 Ga0157380_10122927
1024 Ga0157380_10180610
1025 Ga0157380_10200404
1026 Ga0157380_10233687
1027 Ga0157380_10238244
1028 Ga0157377_10012292
1029 Ga0157377_10026869
1030 Ga0157377_10059552
1031 Ga0157379_10011668
1032 Ga0157379_10057619
1033 Ga0157379_10074141
1034 Ga0157376_10004449
1035 Ga0157376_10050638
1036 Ga0157376_10063353
1037 Ga0157376_10173640
1038 Ga0157376_10370654
1039 Ga0163161_10161475
1040 Ga0163161_10222937
1041 Ga0207697_10002368
1042 Ga0207697_10026920
1043 Ga0207682_10006724
1044 Ga0207682_10009016
1045 Ga0207642_10027654
1046 Ga0207642_10045183
1047 Ga0207710_10097647
1048 Ga0207688_10005823
1049 Ga0207680_10150081
1050 Ga0207680_10251423
1051 Ga0207699_10061895
1052 Ga0207645_10003156
1053 Ga0207645_10016881
1054 Ga0207645_10041570
1055 Ga0207645_10086950
1056 Ga0207645_10294926
1057 Ga0207645_10402067
1058 Ga0207643_10000878
1059 Ga0207643_10002907
1060 Ga0207643_10170142
1061 Ga0207643_10222538
1062 Ga0207643_10286698
1063 Ga0207705_10366269
1064 Ga0207684_10684983
1065 Ga0207707_10107532
1066 Ga0207660_10087189
1067 Ga0207660_10614328
1068 Ga0207662_10003687
1069 Ga0207662_10012997
1070 Ga0207662_10018441
1071 Ga0207662_10303486
1072 Ga0207657_10357565
1073 Ga0207649_10008255
1074 Ga0207649_10114002
1075 Ga0207646_10487447
1076 Ga0207681_10006537
1077 Ga0207681_10193523
1078 Ga0207681_10619437
1079 Ga0207650_10002729
1080 Ga0207650_10004533
1081 Ga0207650_10125264
1082 Ga0207650_10313585
1083 Ga0207659_10001990
1084 Ga0207659_10003457
1085 Ga0207659_10005005
1086 Ga0207659_10022455
1087 Ga0207659_10025092
1088 Ga0207659_10049283
1089 Ga0207659_10100773
1090 Ga0207659_10120200
1091 Ga0207659_10178141
1092 Ga0207659_10192954
1093 Ga0207690_10080953
1094 Ga0207706_10060355
1095 Ga0207706_10365089
1096 Ga0207686_10003289
1097 Ga0207686_10021858
1098 Ga0207670_10004349
1099 Ga0207670_10010420
1100 Ga0207670_10655587
1101 Ga0207669_10017352
1102 Ga0207669_10036132
1103 Ga0207669_10212441
1104 Ga0207669_10300723
1105 Ga0207704_10028495
1106 Ga0207704_10033395
1107 Ga0207704_10119251
1108 Ga0207691_10004961
1109 Ga0207691_10035706
1110 Ga0207691_10041376
1111 Ga0207691_10064697
1112 Ga0207691_10141529
1113 Ga0207691_10167833
1114 Ga0207691_10537147
1115 Ga0207711_10022315
1116 Ga0207711_10032122
1117 Ga0207711_10110267
1118 Ga0207711_10144596
1119 Ga0207711_10227056
1120 Ga0207711_10286593
1121 Ga0207689_10003535
1122 Ga0207689_10019126
1123 Ga0207689_10030425
1124 Ga0207689_10259056
1125 Ga0207689_10722890
1126 Ga0207661_10010511
1127 Ga0207661_10993794
1128 Ga0207679_10009142
1129 Ga0207679_10149582
1130 Ga0207679_10154409
1131 Ga0207679_10246858
1132 Ga0207679_10264215
1133 Ga0207679_10339824
1134 Ga0207679_10543359
1135 Ga0207679_10777633
1136 Ga0207651_10146425
1137 Ga0207651_10203155
1138 Ga0207651_10310167
1139 Ga0207712_10012246
1140 Ga0207712_10073023
1141 Ga0207712_10322632
1142 Ga0207668_10008918
1143 Ga0207668_10067983
1144 Ga0207668_10134391
1145 Ga0207640_10321477
1146 Ga0207640_10328943
1147 Ga0207658_10065931
1148 Ga0207658_10164912
1149 Ga0207658_10421237
1150 Ga0207658_10489183
1151 Ga0207677_10050028
1152 Ga0207677_10246835
1153 Ga0207677_10737318
1154 Ga0207703_10039298
1155 Ga0207703_10043255
1156 Ga0207703_10110811
1157 Ga0207703_10404534
1158 Ga0207703_10545584
1159 Ga0207639_10141934
1160 Ga0207678_10014347
1161 Ga0207678_10127547
1162 Ga0207678_10579401
1163 Ga0207708_10010516
1164 Ga0207708_10032281
1165 Ga0207708_10081686
1166 Ga0207708_10307713
1167 Ga0207708_10434373
1168 Ga0207702_10427735
1169 Ga0207641_10132072
1170 Ga0207641_10459747
1171 Ga0207648_10000280
1172 Ga0207648_10000778
1173 Ga0207648_10018022
1174 Ga0207648_10162233
1175 Ga0207648_10268412
1176 Ga0207648_10381426
1177 Ga0207676_10027184
1178 Ga0207676_10037412
1179 Ga0207676_10037691
1180 Ga0207676_10040382
1181 Ga0207676_10092237
1182 Ga0207676_10111571
1183 Ga0207674_10017958
1184 Ga0207674_10066332
1185 Ga0207674_10088236
1186 Ga0207674_10503767
1187 Ga0207675_100002901
1188 Ga0207675_100034720
1189 Ga0207675_100067463
1190 Ga0207675_100130103
1191 Ga0207675_100169446
1192 Ga0207675_100193106
1193 Ga0207675_100215078
1194 Ga0207683_10019564
1195 Ga0207683_10035674
1196 Ga0207683_10041927
1197 Ga0207683_10054824
1198 Ga0207683_10160606
1199 Ga0207683_10233392
1200 Ga0207698_11411908
1201 Ga0207428_10000022
1202 Ga0207428_10001397
1203 Ga0207428_10007184
1204 Ga0207428_10010593
1205 Ga0207428_10019846
1206 Ga0207428_10317760
1207 Ga0268266_10015025
1208 Ga0268266_10138229
1209 Ga0268266_10293059
1210 Ga0268266_10363892
1211 Ga0268265_10001623
1212 Ga0268265_10008325
1213 Ga0268265_10051253
1214 Ga0268265_10118101
1215 Ga0268264_10008876
1216 Ga0268264_10135525
1217 Ga0268264_10501908
1218 Ga0268264_10641645
1219 Ga0307408_100026292
1220 Ga0307408_100163988
1221 Ga0307405_10071187
1222 Ga0307413_10005048
1223 Ga0307413_10005363
1224 Ga0307410_10003410
1225 Ga0307410_10011541
1226 Ga0307410_10012078
1227 Ga0307406_10039508
1228 Ga0307406_10063857
1229 Ga0307407_10001198
1230 Ga0307407_10006195
1231 Ga0307409_100004583
1232 Ga0307409_100025886
1233 Ga0307409_100149996
1234 Ga0307416_100045960
1235 Ga0307416_100113870
1236 Ga0307416_100177362
1237 Ga0307416_100350620
1238 Ga0307416_100730217
1239 Ga0307414_10005547
1240 Ga0307411_10113128
1241 Ga0307411_10156756
1242 Ga0307411_10166797
1243 Ga0307411_10636025
1244 Ga0307415_100245014
1245 Ga0373938_0118143
1246 Ga0373929_0055768
1247 Ga0373939_0094673
1248 Ga0373941_0020572
1249 Ga0373943_0239791
1250 Ga0373961_0020190
1251 Ga0373931_0018714
1252 Ga0373933_0224781
1253 Ga0373937_0161995
1254 Ga0373937_0270438
1255 Ga0395905_0921495
1256 Ga0439439_0007425
1257 Ga0451807_0061681
1258 Ga0451807_2181220
1259 Ga0451577_0218352
1260 Ga0451576_0010069
1261 Ga0451576_0049022
1262 Ga0451576_0069196
1263 Ga0451576_0145324
1264 Ga0451576_0185472
1265 Ga0451576_1129085
1266 Ga0495580_0388995
1267 Ga0495580_0564098
1268 Ga0495584_0065472
1269 Ga0495594_0080351
1270 Ga0495628_0131674
1271 Ga0495628_0144644
1272 Ga0495642_0225321
1273 Ga0495640_0071961
1274 Ga0495586_0259284
1275 Ga0495609_0213259
1276 Ga0495621_0142814
1277 Ga0495645_0003480
1278 Ga0495656_0224162
1279 Ga0495634_0068608
1280 Ga0495659_0020718
1281 Ga0495659_0060861
1282 Ga0495588_0058902
1283 Ga0495588_0227822
1284 Ga0495599_0071939
1285 Ga0495658_0015015
1286 Ga0495658_0570489
1287 Ga0495670_0136275
1288 Ga0495600_0050389
1289 Ga0495674_0090842
1290 Ga0495677_0132978
1291 Ga0495684_0030503
1292 Ga0496104_0008765
1293 Ga0496105_0418621
1294 Ga0496108_0007098
1295 Ga0496109_0091093
1296 Ga0496109_0139146
1297 Ga0496110_0104425
1298 Ga0496112_0018261
1299 Ga0496113_0007138
1300 Ga0496113_0489389
1301 Ga0496114_0011233
1302 Ga0496115_0015208
1303 Ga0501303_007326
1304 Ga0501031_0459080
1305 Ga0501036_0107564
1306 Ga0501041_0054307
1307 Ga0501046_0261044
1308 Ga0501068_0103743
1309 Ga0501071_0499720
1310 Ga0501072_0075652
1311 Ga0501072_0119688
1312 Ga0501072_0637285
1313 Ga0501073_0002699
1314 Ga0501074_0019879
1315 Ga0501076_0480045
1316 Ga0501079_0696374
1317 Ga0501080_0808779
1318 nmdc:mga06z11_195946_c1
1319 nmdc:mga05p37_111992_c1
1320 nmdc:mga05p37_114433_c1
1321 nmdc:mga05p37_11462_c1
1322 nmdc:mga05p37_130396_c1
1323 nmdc:mga05p37_202950_c1
1324 nmdc:mga05p37_26387_c1
1325 nmdc:mga05p37_265571_c1
1326 nmdc:mga05p37_293891_c1
1327 nmdc:mga05p37_35057_c1
1328 nmdc:mga05p37_41380_c1
1329 nmdc:mga05p37_549206_c1
1330 nmdc:mga05p37_7600_c1
1331 nmdc:mga09592_102941_c1
1332 nmdc:mga09592_200578_c1
1333 nmdc:mga09592_233608_c1
1334 nmdc:mga09592_32419_c1
1335 nmdc:mga09592_3452_c1
1336 nmdc:mga09592_39434_c1
1337 nmdc:mga09592_649055_c1
1338 nmdc:mga0qj67_163596_c1
1339 nmdc:mga0qj67_341441_c1
1340 nmdc:mga0qj67_37509_c1
1341 nmdc:mga0qj67_59988_c1
1342 nmdc:mga06r32_2304_c1
1343 nmdc:mga06r32_325142_c1
1344 nmdc:mga06r32_5315_c1
1345 nmdc:mga08y16_11843_c1
1346 nmdc:mga08y16_131867_c1
1347 nmdc:mga08y16_132825_c1
1348 nmdc:mga08y16_21_c1
1349 nmdc:mga08y16_283247_c1
1350 nmdc:mga08y16_454511_c1
1351 nmdc:mga08y16_61672_c1
1352 nmdc:mga08y16_6615_c1
1353 nmdc:mga08y16_8735_c1
1354 nmdc:mga0n895_165869_c1
1355 nmdc:mga0n895_39993_c1
1356 nmdc:mga0n895_544893_c1
1357 nmdc:mga0n895_7821_c1
1358 nmdc:mga0rr50_113287_c1
1359 nmdc:mga0rr50_188287_c1
1360 nmdc:mga0rr50_230950_c1
1361 nmdc:mga08x19_161149_c1
1362 nmdc:mga08x19_6459_c1
1363 nmdc:mga0a205_130717_c1
1364 nmdc:mga0a205_145789_c1
1365 nmdc:mga0a205_28830_c1
1366 nmdc:mga0a205_887429_c1
1367 Ga0495601_0099816
1368 Ga0495619_0026822
1369 Ga0495619_0072564
1370 Ga0501084_0042402
1371 Ga0501084_0094048
1372 Ga0530510_0075032

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

8

143

0.92

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

138

203

0.85

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

25

135

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xf4-assembly1.cif.gz_A-2 crystal structure of salmonella enterica serovar typhimurium ycbl 0.9463 1 210
2xf4-assembly1.cif.gz_A-2 crystal structure of salmonella enterica serovar typhimurium ycbl 0.9332 1 210
7l0b-assembly1.cif.gz_A crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme 0.9229 2 210
7l0b-assembly3.cif.gz_C crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme 0.9139 2 210
7l0b-assembly4.cif.gz_D crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme 0.9134 1 210
ID Description Score Start End Superfamily
2xf4A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9463 1 210 3.60.15.10
2xf4A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9332 1 210 3.60.15.10
2zwrB00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9132 1 210 3.60.15.10
af_Q2FY29_1_207_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9057 1 210 3.60.15.10
af_P9WMW3_3_221_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.895 3 210 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A317HRS6-F1-model_v4 MBL fold metallo-hydrolase 0.9919 1 210 GO:0016787
AF-A0A2W4S250-F1-model_v4 MBL fold metallo-hydrolase 0.9865 3 212 GO:0016787
AF-A0A317HRS6-F1-model_v4 MBL fold metallo-hydrolase 0.978 1 210 GO:0016787
AF-A0A3N5X9R8-F1-model_v4 MBL fold metallo-hydrolase 0.9771 2 210 GO:0016787
AF-A0A1G3AY94-F1-model_v4 MBL fold metallo-hydrolase 0.9719 1 210 GO:0016787

Map