F475136
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 685 | 270 | 1370 | 186 |
Family's Representative Sequence
| Representative Sequence | 3300031901|Ga0307406_10033049|Ga0307406_100330492 |
| Length | 222 |
| Sequence | VSLTQYYTATTLDGFIADPDNSLDWLFTRKRDEDGPLNYDDFIVGIGAMAMGSTTYEWILDHEFAGKDPAEWKWPYDIPCWVFTHRQLPVIPDSQVEFTSADVAGVHKEMVAAAGDRNVWIVGGGDLAGQFADVGLLDEVIVSIAPVTLGEGASLLPRRIELRLDELGRNGDFACAKFSVVRPRLTCLLQEAAKSVGFEDAIVDSRSGRGHVFRGESSAPAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 159 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 160 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 163 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 165 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 166 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 167 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 168 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 169 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 170 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 171 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 172 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 207 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 208 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 209 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 210 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 211 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 212 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 215 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 216 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 217 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 218 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 219 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 220 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 221 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 268 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 269 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 270 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.56 |
| Metatranscriptomes | 0 |
| Isolates | 0.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.13 |
| Rhizosphere | 93.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307406_10033049 | 3300031901 | Bacteria | 3163 |
| 2 | 2214737450 | 2209111006 | Bacteria | 985 |
| 3 | ARCol0yngRDRAFT_1004541 | 3300000652 | Bacteria | 1005 |
| 4 | JGI24742J22300_10010015 | 3300002244 | Unclassified | 1566 |
| 5 | JGI24742J22300_10027888 | 3300002244 | Bacteria | 979 |
| 6 | JGI25407J50210_10006502 | 3300003373 | Bacteria | 2911 |
| 7 | Ga0070676_10414336 | 3300005328 | Bacteria | 940 |
| 8 | Ga0070683_100096504 | 3300005329 | Bacteria | 2780 |
| 9 | Ga0070683_100685576 | 3300005329 | Bacteria | 981 |
| 10 | Ga0070683_100705827 | 3300005329 | Bacteria | 966 |
| 11 | Ga0070683_100731223 | 3300005329 | Bacteria | 948 |
| 12 | Ga0070690_100220631 | 3300005330 | Bacteria | 1328 |
| 13 | Ga0068869_100271021 | 3300005334 | Bacteria | 1362 |
| 14 | Ga0070680_100072186 | 3300005336 | Bacteria | 2837 |
| 15 | Ga0070682_100024068 | 3300005337 | Bacteria | 3621 |
| 16 | Ga0070682_100241624 | 3300005337 | Bacteria | 1296 |
| 17 | Ga0068868_100157956 | 3300005338 | Bacteria | 1871 |
| 18 | Ga0070660_100079336 | 3300005339 | Bacteria | 2575 |
| 19 | Ga0070689_100045667 | 3300005340 | Bacteria | 3373 |
| 20 | Ga0070691_10057287 | 3300005341 | Bacteria | 1869 |
| 21 | Ga0070687_100566686 | 3300005343 | Bacteria | 775 |
| 22 | Ga0070661_101094464 | 3300005344 | Bacteria | 664 |
| 23 | Ga0070692_10030160 | 3300005345 | Bacteria | 2710 |
| 24 | Ga0070692_10243671 | 3300005345 | Bacteria | 1073 |
| 25 | Ga0070668_100072621 | 3300005347 | Bacteria | 2681 |
| 26 | Ga0070668_101134083 | 3300005347 | Bacteria | 707 |
| 27 | Ga0070671_100141005 | 3300005355 | Bacteria | 2034 |
| 28 | Ga0070671_100226950 | 3300005355 | Bacteria | 1585 |
| 29 | Ga0070674_100076053 | 3300005356 | Bacteria | 2386 |
| 30 | Ga0070674_100467047 | 3300005356 | Bacteria | 1045 |
| 31 | Ga0070688_100007933 | 3300005365 | Bacteria | 5742 |
| 32 | Ga0070659_100082858 | 3300005366 | Bacteria | 2563 |
| 33 | Ga0070709_10022813 | 3300005434 | Bacteria | 3667 |
| 34 | Ga0070709_10497454 | 3300005434 | Bacteria | 925 |
| 35 | Ga0070714_100028631 | 3300005435 | Bacteria | 4624 |
| 36 | Ga0070714_100405791 | 3300005435 | Bacteria | 1289 |
| 37 | Ga0070713_100003604 | 3300005436 | Bacteria | 10234 |
| 38 | Ga0070713_100379486 | 3300005436 | Bacteria | 1317 |
| 39 | Ga0070710_10004250 | 3300005437 | Bacteria | 6789 |
| 40 | Ga0070710_10772600 | 3300005437 | Bacteria | 684 |
| 41 | Ga0070711_100139850 | 3300005439 | Bacteria | 1814 |
| 42 | Ga0070711_100989509 | 3300005439 | Bacteria | 721 |
| 43 | Ga0070705_100010591 | 3300005440 | Bacteria | 4621 |
| 44 | Ga0070705_100097030 | 3300005440 | Bacteria | 1852 |
| 45 | Ga0070705_100824952 | 3300005440 | Bacteria | 740 |
| 46 | Ga0070700_100001973 | 3300005441 | Bacteria | 10413 |
| 47 | Ga0070694_100096438 | 3300005444 | Bacteria | 2084 |
| 48 | Ga0070694_100249847 | 3300005444 | Bacteria | 1341 |
| 49 | Ga0070708_100009720 | 3300005445 | Bacteria | 7762 |
| 50 | Ga0070708_100016741 | 3300005445 | Bacteria | 6092 |
| 51 | Ga0070708_100269088 | 3300005445 | Bacteria | 1603 |
| 52 | Ga0070663_100117302 | 3300005455 | Bacteria | 2007 |
| 53 | Ga0070663_100147577 | 3300005455 | Bacteria | 1801 |
| 54 | Ga0070663_100548430 | 3300005455 | Bacteria | 966 |
| 55 | Ga0070678_100001257 | 3300005456 | Bacteria | 13440 |
| 56 | Ga0070678_100003776 | 3300005456 | Bacteria | 8491 |
| 57 | Ga0070662_100081937 | 3300005457 | Bacteria | 2405 |
| 58 | Ga0070681_10087496 | 3300005458 | Bacteria | 3068 |
| 59 | Ga0070681_10220040 | 3300005458 | Bacteria | 1814 |
| 60 | Ga0068867_100002991 | 3300005459 | Bacteria | 11912 |
| 61 | Ga0068867_100030029 | 3300005459 | Bacteria | 3920 |
| 62 | Ga0070685_10001367 | 3300005466 | Bacteria | 12809 |
| 63 | Ga0070706_100037504 | 3300005467 | Bacteria | 4476 |
| 64 | Ga0070707_100013757 | 3300005468 | Bacteria | 7578 |
| 65 | Ga0070707_100205038 | 3300005468 | Bacteria | 1922 |
| 66 | Ga0070707_100308627 | 3300005468 | Bacteria | 1537 |
| 67 | Ga0070707_100467954 | 3300005468 | Bacteria | 1222 |
| 68 | Ga0070698_100011998 | 3300005471 | Bacteria | 9188 |
| 69 | Ga0070698_100216877 | 3300005471 | Bacteria | 1847 |
| 70 | Ga0070698_100305238 | 3300005471 | Bacteria | 1522 |
| 71 | Ga0070699_100036286 | 3300005518 | Bacteria | 4265 |
| 72 | Ga0070699_100308796 | 3300005518 | Bacteria | 1420 |
| 73 | Ga0070679_100006758 | 3300005530 | Bacteria | 10697 |
| 74 | Ga0070684_100001756 | 3300005535 | Bacteria | 15805 |
| 75 | Ga0070697_100330165 | 3300005536 | Bacteria | 1315 |
| 76 | Ga0070672_100160081 | 3300005543 | Bacteria | 1867 |
| 77 | Ga0070686_100003662 | 3300005544 | Bacteria | 8435 |
| 78 | Ga0070686_100017307 | 3300005544 | Bacteria | 4210 |
| 79 | Ga0070695_100204704 | 3300005545 | Bacteria | 1413 |
| 80 | Ga0070696_100010694 | 3300005546 | Bacteria | 6148 |
| 81 | Ga0070693_100019090 | 3300005547 | Bacteria | 3588 |
| 82 | Ga0070693_100043603 | 3300005547 | Bacteria | 2534 |
| 83 | Ga0070665_100282510 | 3300005548 | Bacteria | 1662 |
| 84 | Ga0070704_100041616 | 3300005549 | Bacteria | 3172 |
| 85 | Ga0068855_100186153 | 3300005563 | Bacteria | 2345 |
| 86 | Ga0068855_101155719 | 3300005563 | Bacteria | 807 |
| 87 | Ga0070664_100502047 | 3300005564 | Bacteria | 1118 |
| 88 | Ga0068857_100003952 | 3300005577 | Bacteria | 12481 |
| 89 | Ga0068854_100096921 | 3300005578 | Bacteria | 2204 |
| 90 | Ga0070702_100001118 | 3300005615 | Bacteria | 10768 |
| 91 | Ga0070702_100048238 | 3300005615 | Bacteria | 2423 |
| 92 | Ga0068852_100002120 | 3300005616 | Bacteria | 13586 |
| 93 | Ga0068852_100914427 | 3300005616 | Bacteria | 895 |
| 94 | Ga0068859_100132251 | 3300005617 | Bacteria | 2567 |
| 95 | Ga0068866_10003386 | 3300005718 | Bacteria | 6541 |
| 96 | Ga0068866_10021614 | 3300005718 | Bacteria | 2966 |
| 97 | Ga0068866_10090005 | 3300005718 | Bacteria | 1669 |
| 98 | Ga0068866_10620235 | 3300005718 | Bacteria | 733 |
| 99 | Ga0068866_10712765 | 3300005718 | Bacteria | 689 |
| 100 | Ga0068861_100000835 | 3300005719 | Bacteria | 18614 |
| 101 | Ga0068861_100328249 | 3300005719 | Bacteria | 1335 |
| 102 | Ga0068858_100196821 | 3300005842 | Bacteria | 1905 |
| 103 | Ga0068860_100045304 | 3300005843 | Bacteria | 4194 |
| 104 | Ga0068860_100085495 | 3300005843 | Bacteria | 3002 |
| 105 | Ga0068862_100743289 | 3300005844 | Bacteria | 954 |
| 106 | Ga0081455_10013939 | 3300005937 | Bacteria | 7902 |
| 107 | Ga0081455_10029119 | 3300005937 | Bacteria | 5037 |
| 108 | Ga0081455_10421801 | 3300005937 | Unclassified | 920 |
| 109 | Ga0081538_10000676 | 3300005981 | Bacteria | 37492 |
| 110 | Ga0081540_1007225 | 3300005983 | Bacteria | 7963 |
| 111 | Ga0070717_10207430 | 3300006028 | Bacteria | 1719 |
| 112 | Ga0075432_10000256 | 3300006058 | Bacteria | 14544 |
| 113 | Ga0070716_100038686 | 3300006173 | Bacteria | 2642 |
| 114 | Ga0070716_100064336 | 3300006173 | Bacteria | 2132 |
| 115 | Ga0070712_100008432 | 3300006175 | Bacteria | 6485 |
| 116 | Ga0070712_100043180 | 3300006175 | Bacteria | 3103 |
| 117 | Ga0097621_100027655 | 3300006237 | Bacteria | 4463 |
| 118 | Ga0097621_100064712 | 3300006237 | Bacteria | 3008 |
| 119 | Ga0068871_100006996 | 3300006358 | Bacteria | 8040 |
| 120 | Ga0068871_100422289 | 3300006358 | Bacteria | 1191 |
| 121 | Ga0068871_100487070 | 3300006358 | Bacteria | 1110 |
| 122 | Ga0075428_100003661 | 3300006844 | Bacteria | 16849 |
| 123 | Ga0075428_100221958 | 3300006844 | Bacteria | 2041 |
| 124 | Ga0075428_100251508 | 3300006844 | Bacteria | 1905 |
| 125 | Ga0075428_100432560 | 3300006844 | Bacteria | 1410 |
| 126 | Ga0075433_10076841 | 3300006852 | Bacteria | 2941 |
| 127 | Ga0075434_100569579 | 3300006871 | Unclassified | 1152 |
| 128 | Ga0075429_100027667 | 3300006880 | Bacteria | 4922 |
| 129 | Ga0075429_100400128 | 3300006880 | Bacteria | 1203 |
| 130 | Ga0068865_100020257 | 3300006881 | Bacteria | 4313 |
| 131 | Ga0068865_100032914 | 3300006881 | Bacteria | 3468 |
| 132 | Ga0097620_100132253 | 3300006931 | Bacteria | 2567 |
| 133 | Ga0075435_100174683 | 3300007076 | Bacteria | 1814 |
| 134 | Ga0111539_10159984 | 3300009094 | Bacteria | 2634 |
| 135 | Ga0111539_10236466 | 3300009094 | Bacteria | 2127 |
| 136 | Ga0111539_10373815 | 3300009094 | Bacteria | 1659 |
| 137 | Ga0111539_11241792 | 3300009094 | Bacteria | 865 |
| 138 | Ga0105245_10106653 | 3300009098 | Unclassified | 2600 |
| 139 | Ga0105245_10222041 | 3300009098 | Bacteria | 1824 |
| 140 | Ga0105245_10228447 | 3300009098 | Bacteria | 1799 |
| 141 | Ga0105245_10287418 | 3300009098 | Bacteria | 1609 |
| 142 | Ga0105247_10005193 | 3300009101 | Bacteria | 8234 |
| 143 | Ga0114129_10001306 | 3300009147 | Bacteria | 33269 |
| 144 | Ga0114129_10100464 | 3300009147 | Bacteria | 4003 |
| 145 | Ga0114129_10193391 | 3300009147 | Bacteria | 2761 |
| 146 | Ga0105243_10002101 | 3300009148 | Bacteria | 16849 |
| 147 | Ga0105243_10018799 | 3300009148 | Bacteria | 5236 |
| 148 | Ga0105243_10073201 | 3300009148 | Bacteria | 2776 |
| 149 | Ga0105243_10478881 | 3300009148 | Bacteria | 1174 |
| 150 | Ga0105243_11012391 | 3300009148 | Bacteria | 834 |
| 151 | Ga0105241_10031254 | 3300009174 | Bacteria | 3987 |
| 152 | Ga0105242_10003872 | 3300009176 | Bacteria | 11631 |
| 153 | Ga0105242_10006050 | 3300009176 | Bacteria | 9325 |
| 154 | Ga0105242_10840318 | 3300009176 | Bacteria | 913 |
| 155 | Ga0105242_11279103 | 3300009176 | Bacteria | 756 |
| 156 | Ga0105248_10003745 | 3300009177 | Bacteria | 16866 |
| 157 | Ga0105248_10137648 | 3300009177 | Bacteria | 2755 |
| 158 | Ga0105237_10731473 | 3300009545 | Bacteria | 996 |
| 159 | Ga0105249_10002268 | 3300009553 | Bacteria | 16680 |
| 160 | Ga0105249_10152982 | 3300009553 | Bacteria | 2222 |
| 161 | Ga0105239_10027772 | 3300010375 | Bacteria | 6227 |
| 162 | Ga0105239_10046162 | 3300010375 | Bacteria | 4773 |
| 163 | Ga0105239_11248209 | 3300010375 | Bacteria | 857 |
| 164 | Ga0105246_10337869 | 3300011119 | Bacteria | 1230 |
| 165 | Ga0157370_10536111 | 3300013104 | Bacteria | 1073 |
| 166 | Ga0157374_10112114 | 3300013296 | Bacteria | 2624 |
| 167 | Ga0157378_10002234 | 3300013297 | Bacteria | 17171 |
| 168 | Ga0157378_10015405 | 3300013297 | Bacteria | 6695 |
| 169 | Ga0157378_10518083 | 3300013297 | Bacteria | 1194 |
| 170 | Ga0163162_10010521 | 3300013306 | Bacteria | 8998 |
| 171 | Ga0163162_10624068 | 3300013306 | Bacteria | 1203 |
| 172 | Ga0157372_10081512 | 3300013307 | Bacteria | 3662 |
| 173 | Ga0157375_10567543 | 3300013308 | Bacteria | 1296 |
| 174 | Ga0157375_10675019 | 3300013308 | Bacteria | 1188 |
| 175 | Ga0157375_11249307 | 3300013308 | Bacteria | 872 |
| 176 | Ga0157380_10135037 | 3300014326 | Bacteria | 2111 |
| 177 | Ga0157380_10847413 | 3300014326 | Bacteria | 935 |
| 178 | Ga0157379_10282950 | 3300014968 | Bacteria | 1509 |
| 179 | Ga0157376_10058289 | 3300014969 | Bacteria | 3234 |
| 180 | Ga0163161_10905461 | 3300017792 | Bacteria | 748 |
| 181 | Ga0207692_10004664 | 3300025898 | Bacteria | 5435 |
| 182 | Ga0207642_10002257 | 3300025899 | Bacteria | 5994 |
| 183 | Ga0207642_10027983 | 3300025899 | Bacteria | 2315 |
| 184 | Ga0207710_10088798 | 3300025900 | Bacteria | 1444 |
| 185 | Ga0207688_10043219 | 3300025901 | Bacteria | 2509 |
| 186 | Ga0207688_10046069 | 3300025901 | Bacteria | 2434 |
| 187 | Ga0207685_10034334 | 3300025905 | Bacteria | 1842 |
| 188 | Ga0207685_10192092 | 3300025905 | Bacteria | 954 |
| 189 | Ga0207684_10015975 | 3300025910 | Bacteria | 6451 |
| 190 | Ga0207684_10042274 | 3300025910 | Bacteria | 3863 |
| 191 | Ga0207654_10282486 | 3300025911 | Bacteria | 1123 |
| 192 | Ga0207707_10190001 | 3300025912 | Bacteria | 1792 |
| 193 | Ga0207671_10031469 | 3300025914 | Bacteria | 3953 |
| 194 | Ga0207693_10240341 | 3300025915 | Bacteria | 1422 |
| 195 | Ga0207693_10502205 | 3300025915 | Bacteria | 947 |
| 196 | Ga0207660_10721573 | 3300025917 | Bacteria | 813 |
| 197 | Ga0207662_10187914 | 3300025918 | Bacteria | 1332 |
| 198 | Ga0207657_10070856 | 3300025919 | Bacteria | 2953 |
| 199 | Ga0207657_10210965 | 3300025919 | Bacteria | 1559 |
| 200 | Ga0207652_10495668 | 3300025921 | Bacteria | 1100 |
| 201 | Ga0207646_10003166 | 3300025922 | Bacteria | 18831 |
| 202 | Ga0207646_10349946 | 3300025922 | Bacteria | 1335 |
| 203 | Ga0207687_10082954 | 3300025927 | Bacteria | 2320 |
| 204 | Ga0207687_10183520 | 3300025927 | Unclassified | 1623 |
| 205 | Ga0207687_10315957 | 3300025927 | Bacteria | 1263 |
| 206 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 207 | Ga0207664_10007480 | 3300025929 | Bacteria | 7574 |
| 208 | Ga0207664_10620604 | 3300025929 | Bacteria | 971 |
| 209 | Ga0207644_10113153 | 3300025931 | Bacteria | 2055 |
| 210 | Ga0207644_10269453 | 3300025931 | Bacteria | 1364 |
| 211 | Ga0207690_10009765 | 3300025932 | Bacteria | 5702 |
| 212 | Ga0207690_10268640 | 3300025932 | Bacteria | 1324 |
| 213 | Ga0207706_10017695 | 3300025933 | Bacteria | 6421 |
| 214 | Ga0207706_10025900 | 3300025933 | Bacteria | 5252 |
| 215 | Ga0207706_10164810 | 3300025933 | Bacteria | 1948 |
| 216 | Ga0207686_10002915 | 3300025934 | Bacteria | 9222 |
| 217 | Ga0207686_10011488 | 3300025934 | Bacteria | 4851 |
| 218 | Ga0207686_10368337 | 3300025934 | Bacteria | 1086 |
| 219 | Ga0207709_10007420 | 3300025935 | Bacteria | 6109 |
| 220 | Ga0207709_10035624 | 3300025935 | Bacteria | 2944 |
| 221 | Ga0207709_10703651 | 3300025935 | Bacteria | 809 |
| 222 | Ga0207670_10072894 | 3300025936 | Bacteria | 2379 |
| 223 | Ga0207669_10004798 | 3300025937 | Bacteria | 5998 |
| 224 | Ga0207669_10337146 | 3300025937 | Bacteria | 1160 |
| 225 | Ga0207704_10004162 | 3300025938 | Bacteria | 6598 |
| 226 | Ga0207704_10032143 | 3300025938 | Bacteria | 2966 |
| 227 | Ga0207665_10008736 | 3300025939 | Bacteria | 6666 |
| 228 | Ga0207665_10044506 | 3300025939 | Bacteria | 2970 |
| 229 | Ga0207691_10092564 | 3300025940 | Bacteria | 2707 |
| 230 | Ga0207711_10055710 | 3300025941 | Bacteria | 3395 |
| 231 | Ga0207689_10439086 | 3300025942 | Bacteria | 1090 |
| 232 | Ga0207661_10041201 | 3300025944 | Bacteria | 3634 |
| 233 | Ga0207679_10184649 | 3300025945 | Bacteria | 1728 |
| 234 | Ga0207667_11033882 | 3300025949 | Bacteria | 807 |
| 235 | Ga0207712_10018688 | 3300025961 | Bacteria | 4517 |
| 236 | Ga0207712_10437367 | 3300025961 | Bacteria | 1107 |
| 237 | Ga0207668_10037468 | 3300025972 | Bacteria | 3246 |
| 238 | Ga0207668_10054335 | 3300025972 | Bacteria | 2780 |
| 239 | Ga0207668_10128109 | 3300025972 | Bacteria | 1934 |
| 240 | Ga0207640_10544147 | 3300025981 | Bacteria | 974 |
| 241 | Ga0207640_11185333 | 3300025981 | Bacteria | 678 |
| 242 | Ga0207658_10128199 | 3300025986 | Bacteria | 2034 |
| 243 | Ga0207677_10006932 | 3300026023 | Bacteria | 6230 |
| 244 | Ga0207677_11425208 | 3300026023 | Bacteria | 638 |
| 245 | Ga0207703_10034951 | 3300026035 | Bacteria | 3992 |
| 246 | Ga0207678_10007583 | 3300026067 | Bacteria | 9588 |
| 247 | Ga0207678_10243650 | 3300026067 | Bacteria | 1540 |
| 248 | Ga0207708_10000352 | 3300026075 | Bacteria | 36059 |
| 249 | Ga0207708_10021692 | 3300026075 | Bacteria | 4845 |
| 250 | Ga0207702_10005699 | 3300026078 | Bacteria | 10859 |
| 251 | Ga0207702_10024434 | 3300026078 | Bacteria | 5015 |
| 252 | Ga0207648_10000454 | 3300026089 | Bacteria | 45454 |
| 253 | Ga0207648_10033192 | 3300026089 | Bacteria | 4553 |
| 254 | Ga0207674_10000884 | 3300026116 | Bacteria | 39178 |
| 255 | Ga0207675_100005637 | 3300026118 | Bacteria | 11985 |
| 256 | Ga0207683_10000215 | 3300026121 | Bacteria | 50395 |
| 257 | Ga0207683_10000598 | 3300026121 | Bacteria | 33267 |
| 258 | Ga0207683_10029743 | 3300026121 | Bacteria | 4730 |
| 259 | Ga0207698_10024666 | 3300026142 | Bacteria | 4225 |
| 260 | Ga0207698_10084263 | 3300026142 | Bacteria | 2576 |
| 261 | Ga0207428_10000536 | 3300027907 | Bacteria | 45269 |
| 262 | Ga0207428_10144766 | 3300027907 | Bacteria | 1812 |
| 263 | Ga0268266_10125100 | 3300028379 | Bacteria | 2293 |
| 264 | Ga0268265_10429580 | 3300028380 | Bacteria | 1229 |
| 265 | Ga0268265_10809231 | 3300028380 | Bacteria | 914 |
| 266 | Ga0268264_10083396 | 3300028381 | Bacteria | 2738 |
| 267 | Ga0268264_10201932 | 3300028381 | Bacteria | 1819 |
| 268 | Ga0307408_100452363 | 3300031548 | Bacteria | 1114 |
| 269 | Ga0307412_10081596 | 3300031911 | Bacteria | 2237 |
| 270 | Ga0307409_100295095 | 3300031995 | Bacteria | 1505 |
| 271 | Ga0307409_100397048 | 3300031995 | Bacteria | 1316 |
| 272 | Ga0307416_100003646 | 3300032002 | Bacteria | 9102 |
| 273 | Ga0307416_100160851 | 3300032002 | Bacteria | 2075 |
| 274 | Ga0307415_100000337 | 3300032126 | Bacteria | 20222 |
| 275 | Ga0373941_0038176 | 3300035115 | Bacteria | 1469 |
| 276 | Ga0373931_0429161 | 3300035691 | Bacteria | 842 |
| 277 | Ga0373935_0120982 | 3300035692 | Unclassified | 1749 |
| 278 | Ga0373935_0202760 | 3300035692 | Bacteria | 1371 |
| 279 | Ga0373935_0274716 | 3300035692 | Unclassified | 1185 |
| 280 | Ga0373947_0116553 | 3300035725 | Bacteria | 1694 |
| 281 | Ga0373947_0324660 | 3300035725 | Bacteria | 1030 |
| 282 | Ga0373947_0607345 | 3300035725 | Bacteria | 745 |
| 283 | Ga0373925_0087311 | 3300037068 | Bacteria | 2381 |
| 284 | Ga0395899_0016012 | 3300037312 | Bacteria | 5718 |
| 285 | Ga0395899_0017934 | 3300037312 | Bacteria | 5386 |
| 286 | Ga0395899_0025447 | 3300037312 | Bacteria | 4468 |
| 287 | Ga0395899_0033236 | 3300037312 | Bacteria | 3874 |
| 288 | Ga0395899_0100859 | 3300037312 | Bacteria | 2084 |
| 289 | Ga0395899_0128772 | 3300037312 | Bacteria | 1809 |
| 290 | Ga0395899_0180273 | 3300037312 | Bacteria | 1483 |
| 291 | Ga0395899_0250542 | 3300037312 | Bacteria | 1215 |
| 292 | Ga0395899_0717465 | 3300037312 | Bacteria | 625 |
| 293 | Ga0395900_0001791 | 3300037418 | Bacteria | 24637 |
| 294 | Ga0395900_0002072 | 3300037418 | Bacteria | 22505 |
| 295 | Ga0395900_0007340 | 3300037418 | Bacteria | 11400 |
| 296 | Ga0395900_0009877 | 3300037418 | Bacteria | 9775 |
| 297 | Ga0395900_0028613 | 3300037418 | Bacteria | 5711 |
| 298 | Ga0395900_0033029 | 3300037418 | Bacteria | 5326 |
| 299 | Ga0395900_0070415 | 3300037418 | Bacteria | 3595 |
| 300 | Ga0395900_0149566 | 3300037418 | Bacteria | 2386 |
| 301 | Ga0395900_0250042 | 3300037418 | Bacteria | 1774 |
| 302 | Ga0395900_0276823 | 3300037418 | Bacteria | 1671 |
| 303 | Ga0395900_0613301 | 3300037418 | Bacteria | 1027 |
| 304 | Ga0395900_0627029 | 3300037418 | Bacteria | 1013 |
| 305 | Ga0395900_0760898 | 3300037418 | Bacteria | 898 |
| 306 | Ga0395900_0775696 | 3300037418 | Bacteria | 888 |
| 307 | Ga0395900_0836957 | 3300037418 | Bacteria | 846 |
| 308 | Ga0395900_1351357 | 3300037418 | Bacteria | 626 |
| 309 | Ga0395898_0001986 | 3300037466 | Bacteria | 25723 |
| 310 | Ga0395898_0004603 | 3300037466 | Bacteria | 15058 |
| 311 | Ga0395898_0015283 | 3300037466 | Bacteria | 7876 |
| 312 | Ga0395898_0022640 | 3300037466 | Bacteria | 6362 |
| 313 | Ga0395898_0024775 | 3300037466 | Bacteria | 6049 |
| 314 | Ga0395898_0042756 | 3300037466 | Bacteria | 4469 |
| 315 | Ga0395898_0081905 | 3300037466 | Bacteria | 3111 |
| 316 | Ga0395898_0138050 | 3300037466 | Bacteria | 2334 |
| 317 | Ga0395898_0276709 | 3300037466 | Bacteria | 1601 |
| 318 | Ga0395898_0349595 | 3300037466 | Bacteria | 1410 |
| 319 | Ga0395898_0780036 | 3300037466 | Bacteria | 896 |
| 320 | Ga0395898_0952163 | 3300037466 | Bacteria | 795 |
| 321 | Ga0395905_0002836 | 3300037471 | Bacteria | 18983 |
| 322 | Ga0395905_0003878 | 3300037471 | Bacteria | 15779 |
| 323 | Ga0395905_0007962 | 3300037471 | Bacteria | 10478 |
| 324 | Ga0395905_0008903 | 3300037471 | Bacteria | 9860 |
| 325 | Ga0395905_0035450 | 3300037471 | Bacteria | 4685 |
| 326 | Ga0395905_0072997 | 3300037471 | Bacteria | 3216 |
| 327 | Ga0395905_0129833 | 3300037471 | Bacteria | 2370 |
| 328 | Ga0395905_0160720 | 3300037471 | Bacteria | 2111 |
| 329 | Ga0395905_0661561 | 3300037471 | Bacteria | 946 |
| 330 | Ga0395905_0893172 | 3300037471 | Bacteria | 791 |
| 331 | Ga0395901_0001774 | 3300038443 | Bacteria | 22253 |
| 332 | Ga0395901_0012910 | 3300038443 | Bacteria | 8472 |
| 333 | Ga0395901_0020180 | 3300038443 | Bacteria | 6820 |
| 334 | Ga0395901_0023176 | 3300038443 | Bacteria | 6364 |
| 335 | Ga0395901_0028303 | 3300038443 | Bacteria | 5764 |
| 336 | Ga0395901_0038841 | 3300038443 | Bacteria | 4923 |
| 337 | Ga0395901_0065959 | 3300038443 | Bacteria | 3770 |
| 338 | Ga0395901_0069452 | 3300038443 | Bacteria | 3669 |
| 339 | Ga0395901_0087314 | 3300038443 | Bacteria | 3261 |
| 340 | Ga0395901_0092634 | 3300038443 | Bacteria | 3163 |
| 341 | Ga0395901_0122389 | 3300038443 | Bacteria | 2734 |
| 342 | Ga0395901_0152848 | 3300038443 | Bacteria | 2424 |
| 343 | Ga0395901_0248600 | 3300038443 | Bacteria | 1853 |
| 344 | Ga0395901_0866100 | 3300038443 | Bacteria | 887 |
| 345 | Ga0395901_0866798 | 3300038443 | Bacteria | 887 |
| 346 | Ga0439438_039104 | 3300041405 | Bacteria | 1237 |
| 347 | Ga0439445_0053354 | 3300042004 | Bacteria | 1095 |
| 348 | Ga0439434_0008004 | 3300042435 | Bacteria | 3097 |
| 349 | Ga0495603_0010232 | 3300046455 | Bacteria | 5678 |
| 350 | Ga0495603_0042602 | 3300046455 | Bacteria | 2713 |
| 351 | Ga0495603_0042763 | 3300046455 | Bacteria | 2708 |
| 352 | Ga0495603_0153623 | 3300046455 | Bacteria | 1336 |
| 353 | Ga0495603_0211357 | 3300046455 | Bacteria | 1120 |
| 354 | Ga0495590_0194597 | 3300046457 | Bacteria | 744 |
| 355 | Ga0495641_0022666 | 3300046461 | Unclassified | 3136 |
| 356 | Ga0495641_0045517 | 3300046461 | Bacteria | 2020 |
| 357 | Ga0495641_0054181 | 3300046461 | Bacteria | 1823 |
| 358 | Ga0495641_0087049 | 3300046461 | Bacteria | 1398 |
| 359 | Ga0495580_0505610 | 3300046472 | Bacteria | 806 |
| 360 | Ga0495582_0008170 | 3300046473 | Bacteria | 5777 |
| 361 | Ga0495582_0046457 | 3300046473 | Bacteria | 2391 |
| 362 | Ga0495582_0050178 | 3300046473 | Bacteria | 2299 |
| 363 | Ga0495582_0052024 | 3300046473 | Bacteria | 2259 |
| 364 | Ga0495582_0088371 | 3300046473 | Bacteria | 1726 |
| 365 | Ga0495605_0141509 | 3300046474 | Bacteria | 1079 |
| 366 | Ga0495639_0029577 | 3300046475 | Unclassified | 2432 |
| 367 | Ga0495639_0065584 | 3300046475 | Bacteria | 1670 |
| 368 | Ga0495584_0032978 | 3300046491 | Bacteria | 2620 |
| 369 | Ga0495584_0068803 | 3300046491 | Bacteria | 1779 |
| 370 | Ga0495584_0153619 | 3300046491 | Bacteria | 1169 |
| 371 | Ga0495584_0325403 | 3300046491 | Bacteria | 781 |
| 372 | Ga0495594_0061634 | 3300046499 | Bacteria | 2076 |
| 373 | Ga0495596_0018413 | 3300046500 | Bacteria | 2879 |
| 374 | Ga0495596_0096624 | 3300046500 | Unclassified | 1147 |
| 375 | Ga0495607_0383556 | 3300046501 | Bacteria | 642 |
| 376 | Ga0495616_0041965 | 3300046513 | Bacteria | 2331 |
| 377 | Ga0495618_0406078 | 3300046514 | Bacteria | 832 |
| 378 | Ga0495630_0479672 | 3300046517 | Unclassified | 953 |
| 379 | Ga0495631_0079747 | 3300046518 | Bacteria | 1413 |
| 380 | Ga0495663_0019891 | 3300046525 | Unclassified | 1925 |
| 381 | Ga0495642_0054626 | 3300046528 | Unclassified | 1647 |
| 382 | Ga0495665_0036930 | 3300046531 | Bacteria | 2608 |
| 383 | Ga0495665_0060583 | 3300046531 | Unclassified | 1998 |
| 384 | Ga0495598_0076769 | 3300046537 | Bacteria | 1064 |
| 385 | Ga0495598_0112640 | 3300046537 | Bacteria | 914 |
| 386 | Ga0495656_0195163 | 3300046615 | Bacteria | 1002 |
| 387 | Ga0495656_0204580 | 3300046615 | Bacteria | 981 |
| 388 | Ga0495656_0242835 | 3300046615 | Bacteria | 907 |
| 389 | Ga0495635_0317605 | 3300046663 | Bacteria | 1043 |
| 390 | Ga0495659_0013152 | 3300046664 | Bacteria | 2692 |
| 391 | Ga0495659_0058745 | 3300046664 | Bacteria | 1416 |
| 392 | Ga0495588_0011717 | 3300046674 | Bacteria | 4122 |
| 393 | Ga0495588_0141106 | 3300046674 | Bacteria | 1273 |
| 394 | Ga0495588_0217225 | 3300046674 | Bacteria | 1009 |
| 395 | Ga0495647_0109625 | 3300046681 | Bacteria | 1151 |
| 396 | Ga0495647_0149218 | 3300046681 | Bacteria | 1001 |
| 397 | Ga0495658_0027818 | 3300046683 | Bacteria | 3046 |
| 398 | Ga0495658_0071690 | 3300046683 | Bacteria | 2013 |
| 399 | Ga0495613_0023422 | 3300046689 | Bacteria | 4600 |
| 400 | Ga0495613_0187011 | 3300046689 | Unclassified | 1465 |
| 401 | Ga0495624_0061663 | 3300046690 | Bacteria | 2349 |
| 402 | Ga0495589_0036432 | 3300046794 | Bacteria | 2466 |
| 403 | Ga0495581_0003346 | 3300047315 | Bacteria | 9210 |
| 404 | Ga0495581_0004944 | 3300047315 | Bacteria | 7715 |
| 405 | Ga0495581_0100696 | 3300047315 | Bacteria | 1678 |
| 406 | Ga0495581_0434876 | 3300047315 | Bacteria | 764 |
| 407 | Ga0495636_0069024 | 3300047318 | Bacteria | 1506 |
| 408 | Ga0495676_0043546 | 3300047321 | Bacteria | 3671 |
| 409 | Ga0495676_0051111 | 3300047321 | Bacteria | 3309 |
| 410 | Ga0495676_0080259 | 3300047321 | Bacteria | 2478 |
| 411 | Ga0495676_0115433 | 3300047321 | Bacteria | 1963 |
| 412 | Ga0495677_0031837 | 3300047445 | Bacteria | 1920 |
| 413 | Ga0496100_0004515 | 3300048903 | Bacteria | 7390 |
| 414 | Ga0496101_0012099 | 3300048904 | Bacteria | 5751 |
| 415 | Ga0496101_0040326 | 3300048904 | Bacteria | 3325 |
| 416 | Ga0496101_0408643 | 3300048904 | Bacteria | 1069 |
| 417 | Ga0496102_0003640 | 3300048905 | Bacteria | 13031 |
| 418 | Ga0496102_0026127 | 3300048905 | Bacteria | 5204 |
| 419 | Ga0496103_0002529 | 3300048906 | Bacteria | 11459 |
| 420 | Ga0496103_0037900 | 3300048906 | Bacteria | 2956 |
| 421 | Ga0496104_0024087 | 3300048907 | Bacteria | 5601 |
| 422 | Ga0496104_0073571 | 3300048907 | Bacteria | 3251 |
| 423 | Ga0496104_0079456 | 3300048907 | Bacteria | 3126 |
| 424 | Ga0496104_0111531 | 3300048907 | Bacteria | 2622 |
| 425 | Ga0496105_0005517 | 3300048908 | Bacteria | 9601 |
| 426 | Ga0496105_0033994 | 3300048908 | Bacteria | 4191 |
| 427 | Ga0496105_0050761 | 3300048908 | Bacteria | 3427 |
| 428 | Ga0496105_0064957 | 3300048908 | Bacteria | 3012 |
| 429 | Ga0496106_0000909 | 3300048909 | Bacteria | 21550 |
| 430 | Ga0496106_0015697 | 3300048909 | Bacteria | 5603 |
| 431 | Ga0496106_0041996 | 3300048909 | Bacteria | 3428 |
| 432 | Ga0496107_0004522 | 3300048910 | Bacteria | 9421 |
| 433 | Ga0496107_0006455 | 3300048910 | Bacteria | 8065 |
| 434 | Ga0496108_0132634 | 3300048911 | Bacteria | 2141 |
| 435 | Ga0496108_0208793 | 3300048911 | Bacteria | 1695 |
| 436 | Ga0496109_0045034 | 3300048912 | Bacteria | 4004 |
| 437 | Ga0496109_0094429 | 3300048912 | Bacteria | 2768 |
| 438 | Ga0496110_0224292 | 3300048913 | Bacteria | 1709 |
| 439 | Ga0496111_0047613 | 3300048914 | Bacteria | 3088 |
| 440 | Ga0496111_0187408 | 3300048914 | Unclassified | 1538 |
| 441 | Ga0496111_0500055 | 3300048914 | Bacteria | 895 |
| 442 | Ga0496111_0604512 | 3300048914 | Bacteria | 803 |
| 443 | Ga0496112_0008919 | 3300048915 | Bacteria | 9002 |
| 444 | Ga0496112_0054971 | 3300048915 | Bacteria | 3912 |
| 445 | Ga0496112_0609117 | 3300048915 | Bacteria | 1024 |
| 446 | Ga0496113_0065291 | 3300048916 | Bacteria | 2754 |
| 447 | Ga0496113_0256676 | 3300048916 | Bacteria | 1396 |
| 448 | Ga0496114_0004323 | 3300048917 | Bacteria | 10994 |
| 449 | Ga0496114_0050549 | 3300048917 | Bacteria | 3460 |
| 450 | Ga0496114_0071486 | 3300048917 | Bacteria | 2916 |
| 451 | Ga0496114_0389372 | 3300048917 | Bacteria | 1234 |
| 452 | Ga0496115_0004519 | 3300048918 | Bacteria | 10061 |
| 453 | Ga0496115_0041516 | 3300048918 | Bacteria | 3661 |
| 454 | Ga0496115_0118638 | 3300048918 | Bacteria | 2176 |
| 455 | Ga0496126_0805954 | 3300048929 | Bacteria | 720 |
| 456 | Ga0501031_0002949 | 3300049568 | Bacteria | 10889 |
| 457 | Ga0501031_0010365 | 3300049568 | Bacteria | 6069 |
| 458 | Ga0501031_0024701 | 3300049568 | Bacteria | 3917 |
| 459 | Ga0501032_0003494 | 3300049569 | Bacteria | 12015 |
| 460 | Ga0501032_0052585 | 3300049569 | Bacteria | 2744 |
| 461 | Ga0501033_0000208 | 3300049570 | Bacteria | 56046 |
| 462 | Ga0501033_0025623 | 3300049570 | Bacteria | 4443 |
| 463 | Ga0501033_0037415 | 3300049570 | Bacteria | 3632 |
| 464 | Ga0501033_0460247 | 3300049570 | Bacteria | 883 |
| 465 | Ga0501033_0699473 | 3300049570 | Bacteria | 690 |
| 466 | Ga0501034_0007404 | 3300049571 | Bacteria | 11685 |
| 467 | Ga0501034_1025812 | 3300049571 | Bacteria | 708 |
| 468 | Ga0501036_0000085 | 3300049572 | Bacteria | 58421 |
| 469 | Ga0501036_0003245 | 3300049572 | Bacteria | 12965 |
| 470 | Ga0501036_0024163 | 3300049572 | Bacteria | 5122 |
| 471 | Ga0501036_0031210 | 3300049572 | Bacteria | 4502 |
| 472 | Ga0501036_0078804 | 3300049572 | Bacteria | 2786 |
| 473 | Ga0501036_0128551 | 3300049572 | Bacteria | 2139 |
| 474 | Ga0501037_0001998 | 3300049573 | Bacteria | 14799 |
| 475 | Ga0501037_0022575 | 3300049573 | Bacteria | 4654 |
| 476 | Ga0501037_0092400 | 3300049573 | Bacteria | 2188 |
| 477 | Ga0501037_0411650 | 3300049573 | Bacteria | 926 |
| 478 | Ga0501038_0019326 | 3300049574 | Bacteria | 6144 |
| 479 | Ga0501038_0021979 | 3300049574 | Bacteria | 5721 |
| 480 | Ga0501038_0036559 | 3300049574 | Bacteria | 4309 |
| 481 | Ga0501038_0074838 | 3300049574 | Bacteria | 2864 |
| 482 | Ga0501038_0146510 | 3300049574 | Bacteria | 1927 |
| 483 | Ga0501038_0335420 | 3300049574 | Bacteria | 1180 |
| 484 | Ga0501039_0000171 | 3300049575 | Bacteria | 45473 |
| 485 | Ga0501039_0006841 | 3300049575 | Bacteria | 8675 |
| 486 | Ga0501039_0022482 | 3300049575 | Bacteria | 4840 |
| 487 | Ga0501039_0029387 | 3300049575 | Bacteria | 4233 |
| 488 | Ga0501039_0055992 | 3300049575 | Bacteria | 3054 |
| 489 | Ga0501039_0223141 | 3300049575 | Bacteria | 1481 |
| 490 | Ga0501039_0347988 | 3300049575 | Bacteria | 1165 |
| 491 | Ga0501040_0000094 | 3300049576 | Bacteria | 44554 |
| 492 | Ga0501040_0007610 | 3300049576 | Bacteria | 7011 |
| 493 | Ga0501040_0014951 | 3300049576 | Bacteria | 5125 |
| 494 | Ga0501040_0028446 | 3300049576 | Bacteria | 3769 |
| 495 | Ga0501040_0072078 | 3300049576 | Bacteria | 2385 |
| 496 | Ga0501040_0207345 | 3300049576 | Bacteria | 1393 |
| 497 | Ga0501041_0003831 | 3300049577 | Bacteria | 8661 |
| 498 | Ga0501041_0004209 | 3300049577 | Bacteria | 8326 |
| 499 | Ga0501041_0011577 | 3300049577 | Bacteria | 5218 |
| 500 | Ga0501041_0014221 | 3300049577 | Bacteria | 4725 |
| 501 | Ga0501041_0024321 | 3300049577 | Bacteria | 3635 |
| 502 | Ga0501041_0034222 | 3300049577 | Bacteria | 3075 |
| 503 | Ga0501041_0286807 | 3300049577 | Bacteria | 1036 |
| 504 | Ga0501041_0412648 | 3300049577 | Bacteria | 856 |
| 505 | Ga0501042_0001242 | 3300049578 | Bacteria | 14860 |
| 506 | Ga0501042_0004579 | 3300049578 | Bacteria | 8826 |
| 507 | Ga0501042_0019571 | 3300049578 | Bacteria | 4703 |
| 508 | Ga0501042_0022773 | 3300049578 | Bacteria | 4377 |
| 509 | Ga0501042_0083670 | 3300049578 | Bacteria | 2287 |
| 510 | Ga0501042_0210385 | 3300049578 | Bacteria | 1403 |
| 511 | Ga0501042_0284435 | 3300049578 | Bacteria | 1194 |
| 512 | Ga0501043_0000295 | 3300049579 | Bacteria | 45082 |
| 513 | Ga0501043_0034370 | 3300049579 | Bacteria | 3987 |
| 514 | Ga0501043_0138415 | 3300049579 | Bacteria | 1907 |
| 515 | Ga0501043_0298250 | 3300049579 | Bacteria | 1232 |
| 516 | Ga0501046_0000999 | 3300049580 | Bacteria | 27627 |
| 517 | Ga0501046_0008252 | 3300049580 | Bacteria | 9093 |
| 518 | Ga0501046_0034637 | 3300049580 | Bacteria | 4073 |
| 519 | Ga0501046_0039040 | 3300049580 | Bacteria | 3805 |
| 520 | Ga0501046_0056277 | 3300049580 | Bacteria | 3088 |
| 521 | Ga0501046_0078414 | 3300049580 | Bacteria | 2555 |
| 522 | Ga0501046_0090895 | 3300049580 | Bacteria | 2348 |
| 523 | Ga0501047_0001721 | 3300049581 | Bacteria | 21277 |
| 524 | Ga0501047_0310157 | 3300049581 | Bacteria | 1418 |
| 525 | Ga0501047_0522343 | 3300049581 | Bacteria | 1013 |
| 526 | Ga0501048_0000212 | 3300049582 | Bacteria | 38029 |
| 527 | Ga0501048_0001705 | 3300049582 | Bacteria | 16761 |
| 528 | Ga0501048_0008060 | 3300049582 | Bacteria | 7977 |
| 529 | Ga0501048_0010970 | 3300049582 | Bacteria | 6759 |
| 530 | Ga0501048_0013342 | 3300049582 | Bacteria | 6097 |
| 531 | Ga0501048_0035911 | 3300049582 | Bacteria | 3565 |
| 532 | Ga0501048_0140096 | 3300049582 | Bacteria | 1710 |
| 533 | Ga0501048_0430397 | 3300049582 | Bacteria | 944 |
| 534 | Ga0501067_0030485 | 3300049583 | Bacteria | 2991 |
| 535 | Ga0501067_0052297 | 3300049583 | Bacteria | 2263 |
| 536 | Ga0501068_0000052 | 3300049584 | Bacteria | 45484 |
| 537 | Ga0501068_0009191 | 3300049584 | Bacteria | 5521 |
| 538 | Ga0501068_0054451 | 3300049584 | Bacteria | 2423 |
| 539 | Ga0501068_0056211 | 3300049584 | Bacteria | 2386 |
| 540 | Ga0501068_0078343 | 3300049584 | Bacteria | 2025 |
| 541 | Ga0501068_0325606 | 3300049584 | Bacteria | 985 |
| 542 | Ga0501069_0000542 | 3300049585 | Bacteria | 17276 |
| 543 | Ga0501069_0007975 | 3300049585 | Bacteria | 5560 |
| 544 | Ga0501069_0028392 | 3300049585 | Bacteria | 3067 |
| 545 | Ga0501069_0288549 | 3300049585 | Bacteria | 961 |
| 546 | Ga0501070_0001060 | 3300049586 | Bacteria | 24749 |
| 547 | Ga0501070_0006669 | 3300049586 | Bacteria | 9831 |
| 548 | Ga0501070_0028091 | 3300049586 | Bacteria | 4717 |
| 549 | Ga0501071_0001124 | 3300049587 | Bacteria | 14927 |
| 550 | Ga0501071_0002813 | 3300049587 | Bacteria | 10710 |
| 551 | Ga0501071_0004755 | 3300049587 | Bacteria | 8645 |
| 552 | Ga0501071_0009237 | 3300049587 | Bacteria | 6557 |
| 553 | Ga0501071_0015940 | 3300049587 | Bacteria | 5163 |
| 554 | Ga0501071_0056179 | 3300049587 | Bacteria | 2842 |
| 555 | Ga0501071_0077477 | 3300049587 | Bacteria | 2428 |
| 556 | Ga0501071_0134870 | 3300049587 | Bacteria | 1836 |
| 557 | Ga0501072_0000072 | 3300049588 | Bacteria | 72875 |
| 558 | Ga0501072_0003239 | 3300049588 | Bacteria | 12221 |
| 559 | Ga0501072_0024426 | 3300049588 | Bacteria | 4701 |
| 560 | Ga0501072_0029627 | 3300049588 | Bacteria | 4276 |
| 561 | Ga0501072_0054718 | 3300049588 | Bacteria | 3144 |
| 562 | Ga0501072_0102247 | 3300049588 | Bacteria | 2278 |
| 563 | Ga0501072_0148131 | 3300049588 | Bacteria | 1871 |
| 564 | Ga0501072_0204309 | 3300049588 | Bacteria | 1575 |
| 565 | Ga0501072_0407352 | 3300049588 | Bacteria | 1078 |
| 566 | Ga0501073_0002604 | 3300049589 | Bacteria | 13504 |
| 567 | Ga0501073_0025215 | 3300049589 | Bacteria | 4267 |
| 568 | Ga0501073_0074420 | 3300049589 | Bacteria | 2364 |
| 569 | Ga0501073_0139504 | 3300049589 | Bacteria | 1680 |
| 570 | Ga0501074_0008516 | 3300049590 | Bacteria | 7430 |
| 571 | Ga0501074_0012433 | 3300049590 | Bacteria | 6187 |
| 572 | Ga0501074_0013431 | 3300049590 | Bacteria | 5954 |
| 573 | Ga0501074_0046305 | 3300049590 | Bacteria | 3144 |
| 574 | Ga0501074_0108726 | 3300049590 | Bacteria | 1984 |
| 575 | Ga0501075_0000109 | 3300049591 | Bacteria | 38985 |
| 576 | Ga0501075_0004222 | 3300049591 | Bacteria | 9708 |
| 577 | Ga0501075_0018666 | 3300049591 | Bacteria | 5022 |
| 578 | Ga0501075_0038743 | 3300049591 | Bacteria | 3564 |
| 579 | Ga0501075_0113366 | 3300049591 | Bacteria | 2061 |
| 580 | Ga0501076_0000554 | 3300049592 | Bacteria | 23855 |
| 581 | Ga0501076_0010496 | 3300049592 | Bacteria | 6874 |
| 582 | Ga0501076_0010994 | 3300049592 | Bacteria | 6730 |
| 583 | Ga0501076_0011031 | 3300049592 | Bacteria | 6719 |
| 584 | Ga0501076_0014933 | 3300049592 | Bacteria | 5860 |
| 585 | Ga0501076_0022334 | 3300049592 | Bacteria | 4863 |
| 586 | Ga0501076_0022608 | 3300049592 | Bacteria | 4834 |
| 587 | Ga0501076_0782237 | 3300049592 | Bacteria | 787 |
| 588 | Ga0501077_0000809 | 3300049593 | Bacteria | 18979 |
| 589 | Ga0501077_0006994 | 3300049593 | Bacteria | 6953 |
| 590 | Ga0501077_0033016 | 3300049593 | Bacteria | 3295 |
| 591 | Ga0501077_0033947 | 3300049593 | Bacteria | 3247 |
| 592 | Ga0501077_0038727 | 3300049593 | Bacteria | 3037 |
| 593 | Ga0501077_0049873 | 3300049593 | Bacteria | 2660 |
| 594 | Ga0501077_0291313 | 3300049593 | Bacteria | 1039 |
| 595 | Ga0501079_0000099 | 3300049741 | Bacteria | 43513 |
| 596 | Ga0501079_0008226 | 3300049741 | Bacteria | 7906 |
| 597 | Ga0501079_0024980 | 3300049741 | Bacteria | 4583 |
| 598 | Ga0501079_0055896 | 3300049741 | Bacteria | 3045 |
| 599 | Ga0501079_0211588 | 3300049741 | Bacteria | 1514 |
| 600 | Ga0501079_0260480 | 3300049741 | Bacteria | 1355 |
| 601 | Ga0501079_0266329 | 3300049741 | Bacteria | 1339 |
| 602 | Ga0501080_0051601 | 3300049742 | Bacteria | 3827 |
| 603 | Ga0501080_0063926 | 3300049742 | Bacteria | 3424 |
| 604 | Ga0501080_0065679 | 3300049742 | Bacteria | 3375 |
| 605 | Ga0501080_0107814 | 3300049742 | Bacteria | 2581 |
| 606 | Ga0501080_0110863 | 3300049742 | Bacteria | 2543 |
| 607 | Ga0501080_0129243 | 3300049742 | Bacteria | 2338 |
| 608 | Ga0501080_0478487 | 3300049742 | Bacteria | 1114 |
| 609 | Ga0501081_0001992 | 3300049743 | Bacteria | 12738 |
| 610 | Ga0501081_0009326 | 3300049743 | Bacteria | 6394 |
| 611 | Ga0501081_0010341 | 3300049743 | Bacteria | 6091 |
| 612 | Ga0501081_0060521 | 3300049743 | Bacteria | 2624 |
| 613 | Ga0501081_0061001 | 3300049743 | Bacteria | 2614 |
| 614 | Ga0501081_0071037 | 3300049743 | Bacteria | 2426 |
| 615 | Ga0501081_0126758 | 3300049743 | Bacteria | 1821 |
| 616 | Ga0501081_0142548 | 3300049743 | Bacteria | 1718 |
| 617 | Ga0501081_0148744 | 3300049743 | Bacteria | 1681 |
| 618 | Ga0501083_0001781 | 3300049744 | Bacteria | 14716 |
| 619 | Ga0501083_0026883 | 3300049744 | Bacteria | 3975 |
| 620 | Ga0501083_0077849 | 3300049744 | Bacteria | 2200 |
| 621 | Ga0501035_0001297 | 3300049822 | Bacteria | 25816 |
| 622 | Ga0501035_0002978 | 3300049822 | Bacteria | 16287 |
| 623 | Ga0501035_0013570 | 3300049822 | Bacteria | 7518 |
| 624 | Ga0501035_0023004 | 3300049822 | Bacteria | 5720 |
| 625 | Ga0501035_0147874 | 3300049822 | Bacteria | 2040 |
| 626 | Ga0501035_0722147 | 3300049822 | Bacteria | 802 |
| 627 | Ga0501044_0021292 | 3300049823 | Bacteria | 6919 |
| 628 | Ga0501044_0026520 | 3300049823 | Bacteria | 6133 |
| 629 | Ga0501044_0087411 | 3300049823 | Bacteria | 3148 |
| 630 | Ga0501044_0593536 | 3300049823 | Bacteria | 1001 |
| 631 | Ga0501045_0002382 | 3300049824 | Bacteria | 12761 |
| 632 | Ga0501045_0003471 | 3300049824 | Bacteria | 10789 |
| 633 | Ga0501045_0008005 | 3300049824 | Bacteria | 7363 |
| 634 | Ga0501045_0009225 | 3300049824 | Bacteria | 6897 |
| 635 | Ga0501045_0036104 | 3300049824 | Bacteria | 3588 |
| 636 | Ga0501045_0043354 | 3300049824 | Bacteria | 3276 |
| 637 | Ga0501045_0043537 | 3300049824 | Bacteria | 3269 |
| 638 | Ga0501045_0085425 | 3300049824 | Bacteria | 2329 |
| 639 | nmdc:mga05p37_1267279_c1 | 3300050507 | Bacteria | 755 |
| 640 | nmdc:mga05p37_2685_c1 | 3300050507 | Bacteria | 20688 |
| 641 | nmdc:mga05p37_676826_c1 | 3300050507 | Bacteria | 1151 |
| 642 | nmdc:mga05p37_833064_c1 | 3300050507 | Bacteria | 1004 |
| 643 | nmdc:mga09592_545113_c1 | 3300050508 | Bacteria | 996 |
| 644 | nmdc:mga09592_577611_c1 | 3300050508 | Bacteria | 964 |
| 645 | nmdc:mga09592_8889_c1 | 3300050508 | Bacteria | 8167 |
| 646 | nmdc:mga0qj67_107716_c1 | 3300050509 | Bacteria | 2248 |
| 647 | nmdc:mga08y16_326172_c1 | 3300050511 | Bacteria | 1580 |
| 648 | nmdc:mga08y16_459097_c1 | 3300050511 | Bacteria | 1298 |
| 649 | nmdc:mga08y16_7755_c1 | 3300050511 | Bacteria | 11244 |
| 650 | nmdc:mga0n895_362118_c1 | 3300050512 | Bacteria | 1468 |
| 651 | nmdc:mga0a205_303837_c1 | 3300050515 | Bacteria | 1468 |
| 652 | nmdc:mga0a205_30887_c1 | 3300050515 | Bacteria | 5131 |
| 653 | nmdc:mga0a205_456151_c1 | 3300050515 | Bacteria | 1138 |
| 654 | Ga0495601_0003546 | 3300053077 | Bacteria | 8972 |
| 655 | Ga0495612_0001908 | 3300053078 | Bacteria | 8579 |
| 656 | Ga0495655_0008712 | 3300053083 | Bacteria | 1939 |
| 657 | Ga0495595_0127070 | 3300053084 | Bacteria | 1244 |
| 658 | Ga0495595_0207442 | 3300053084 | Bacteria | 976 |
| 659 | Ga0495619_0057932 | 3300053085 | Bacteria | 2571 |
| 660 | Ga0501084_0001093 | 3300054114 | Bacteria | 21105 |
| 661 | Ga0501084_0014311 | 3300054114 | Bacteria | 6572 |
| 662 | Ga0501084_0021204 | 3300054114 | Bacteria | 5418 |
| 663 | Ga0501084_0029568 | 3300054114 | Bacteria | 4583 |
| 664 | Ga0501084_0037986 | 3300054114 | Bacteria | 4024 |
| 665 | Ga0501084_0057619 | 3300054114 | Bacteria | 3250 |
| 666 | Ga0501084_0059559 | 3300054114 | Bacteria | 3196 |
| 667 | Ga0501084_0071760 | 3300054114 | Bacteria | 2900 |
| 668 | Ga0501084_0159426 | 3300054114 | Bacteria | 1903 |
| 669 | Ga0501082_0000655 | 3300060353 | Bacteria | 30539 |
| 670 | Ga0501082_0031374 | 3300060353 | Bacteria | 4581 |
| 671 | Ga0501082_0034568 | 3300060353 | Bacteria | 4356 |
| 672 | Ga0501082_0126594 | 3300060353 | Bacteria | 2215 |
| 673 | Ga0501082_0157430 | 3300060353 | Bacteria | 1973 |
| 674 | Ga0501082_0187895 | 3300060353 | Bacteria | 1797 |
| 675 | Ga0530510_0003150 | 3300061734 | Bacteria | 11326 |
| 676 | Ga0530510_0005743 | 3300061734 | Bacteria | 8596 |
| 677 | Ga0530510_0008670 | 3300061734 | Bacteria | 7106 |
| 678 | Ga0530510_0025673 | 3300061734 | Bacteria | 4213 |
| 679 | Ga0530510_0030971 | 3300061734 | Bacteria | 3844 |
| 680 | Ga0530510_0066171 | 3300061734 | Bacteria | 2619 |
| 681 | Ga0530510_0218910 | 3300061734 | Bacteria | 1415 |
| 682 | Ga0530510_0591041 | 3300061734 | Bacteria | 844 |
| 683 | 2852679567 | 2852677369 | Bacteria | 3768884 |
| 684 | 2857720216 | 2857720070 | Bacteria | 3189373 |
| 685 | 2928091946 | 2928090899 | Bacteria | 3158267 |
| 686 | Ga0307406_10033049 | |||
| 687 | 2214737450 | |||
| 688 | ARCol0yngRDRAFT_1004541 | |||
| 689 | JGI24742J22300_10010015 | |||
| 690 | JGI24742J22300_10027888 | |||
| 691 | JGI25407J50210_10006502 | |||
| 692 | Ga0070676_10414336 | |||
| 693 | Ga0070683_100096504 | |||
| 694 | Ga0070683_100685576 | |||
| 695 | Ga0070683_100705827 | |||
| 696 | Ga0070683_100731223 | |||
| 697 | Ga0070690_100220631 | |||
| 698 | Ga0068869_100271021 | |||
| 699 | Ga0070680_100072186 | |||
| 700 | Ga0070682_100024068 | |||
| 701 | Ga0070682_100241624 | |||
| 702 | Ga0068868_100157956 | |||
| 703 | Ga0070660_100079336 | |||
| 704 | Ga0070689_100045667 | |||
| 705 | Ga0070691_10057287 | |||
| 706 | Ga0070687_100566686 | |||
| 707 | Ga0070661_101094464 | |||
| 708 | Ga0070692_10030160 | |||
| 709 | Ga0070692_10243671 | |||
| 710 | Ga0070668_100072621 | |||
| 711 | Ga0070668_101134083 | |||
| 712 | Ga0070671_100141005 | |||
| 713 | Ga0070671_100226950 | |||
| 714 | Ga0070674_100076053 | |||
| 715 | Ga0070674_100467047 | |||
| 716 | Ga0070688_100007933 | |||
| 717 | Ga0070659_100082858 | |||
| 718 | Ga0070709_10022813 | |||
| 719 | Ga0070709_10497454 | |||
| 720 | Ga0070714_100028631 | |||
| 721 | Ga0070714_100405791 | |||
| 722 | Ga0070713_100003604 | |||
| 723 | Ga0070713_100379486 | |||
| 724 | Ga0070710_10004250 | |||
| 725 | Ga0070710_10772600 | |||
| 726 | Ga0070711_100139850 | |||
| 727 | Ga0070711_100989509 | |||
| 728 | Ga0070705_100010591 | |||
| 729 | Ga0070705_100097030 | |||
| 730 | Ga0070705_100824952 | |||
| 731 | Ga0070700_100001973 | |||
| 732 | Ga0070694_100096438 | |||
| 733 | Ga0070694_100249847 | |||
| 734 | Ga0070708_100009720 | |||
| 735 | Ga0070708_100016741 | |||
| 736 | Ga0070708_100269088 | |||
| 737 | Ga0070663_100117302 | |||
| 738 | Ga0070663_100147577 | |||
| 739 | Ga0070663_100548430 | |||
| 740 | Ga0070678_100001257 | |||
| 741 | Ga0070678_100003776 | |||
| 742 | Ga0070662_100081937 | |||
| 743 | Ga0070681_10087496 | |||
| 744 | Ga0070681_10220040 | |||
| 745 | Ga0068867_100002991 | |||
| 746 | Ga0068867_100030029 | |||
| 747 | Ga0070685_10001367 | |||
| 748 | Ga0070706_100037504 | |||
| 749 | Ga0070707_100013757 | |||
| 750 | Ga0070707_100205038 | |||
| 751 | Ga0070707_100308627 | |||
| 752 | Ga0070707_100467954 | |||
| 753 | Ga0070698_100011998 | |||
| 754 | Ga0070698_100216877 | |||
| 755 | Ga0070698_100305238 | |||
| 756 | Ga0070699_100036286 | |||
| 757 | Ga0070699_100308796 | |||
| 758 | Ga0070679_100006758 | |||
| 759 | Ga0070684_100001756 | |||
| 760 | Ga0070697_100330165 | |||
| 761 | Ga0070672_100160081 | |||
| 762 | Ga0070686_100003662 | |||
| 763 | Ga0070686_100017307 | |||
| 764 | Ga0070695_100204704 | |||
| 765 | Ga0070696_100010694 | |||
| 766 | Ga0070693_100019090 | |||
| 767 | Ga0070693_100043603 | |||
| 768 | Ga0070665_100282510 | |||
| 769 | Ga0070704_100041616 | |||
| 770 | Ga0068855_100186153 | |||
| 771 | Ga0068855_101155719 | |||
| 772 | Ga0070664_100502047 | |||
| 773 | Ga0068857_100003952 | |||
| 774 | Ga0068854_100096921 | |||
| 775 | Ga0070702_100001118 | |||
| 776 | Ga0070702_100048238 | |||
| 777 | Ga0068852_100002120 | |||
| 778 | Ga0068852_100914427 | |||
| 779 | Ga0068859_100132251 | |||
| 780 | Ga0068866_10003386 | |||
| 781 | Ga0068866_10021614 | |||
| 782 | Ga0068866_10090005 | |||
| 783 | Ga0068866_10620235 | |||
| 784 | Ga0068866_10712765 | |||
| 785 | Ga0068861_100000835 | |||
| 786 | Ga0068861_100328249 | |||
| 787 | Ga0068858_100196821 | |||
| 788 | Ga0068860_100045304 | |||
| 789 | Ga0068860_100085495 | |||
| 790 | Ga0068862_100743289 | |||
| 791 | Ga0081455_10013939 | |||
| 792 | Ga0081455_10029119 | |||
| 793 | Ga0081455_10421801 | |||
| 794 | Ga0081538_10000676 | |||
| 795 | Ga0081540_1007225 | |||
| 796 | Ga0070717_10207430 | |||
| 797 | Ga0075432_10000256 | |||
| 798 | Ga0070716_100038686 | |||
| 799 | Ga0070716_100064336 | |||
| 800 | Ga0070712_100008432 | |||
| 801 | Ga0070712_100043180 | |||
| 802 | Ga0097621_100027655 | |||
| 803 | Ga0097621_100064712 | |||
| 804 | Ga0068871_100006996 | |||
| 805 | Ga0068871_100422289 | |||
| 806 | Ga0068871_100487070 | |||
| 807 | Ga0075428_100003661 | |||
| 808 | Ga0075428_100221958 | |||
| 809 | Ga0075428_100251508 | |||
| 810 | Ga0075428_100432560 | |||
| 811 | Ga0075433_10076841 | |||
| 812 | Ga0075434_100569579 | |||
| 813 | Ga0075429_100027667 | |||
| 814 | Ga0075429_100400128 | |||
| 815 | Ga0068865_100020257 | |||
| 816 | Ga0068865_100032914 | |||
| 817 | Ga0097620_100132253 | |||
| 818 | Ga0075435_100174683 | |||
| 819 | Ga0111539_10159984 | |||
| 820 | Ga0111539_10236466 | |||
| 821 | Ga0111539_10373815 | |||
| 822 | Ga0111539_11241792 | |||
| 823 | Ga0105245_10106653 | |||
| 824 | Ga0105245_10222041 | |||
| 825 | Ga0105245_10228447 | |||
| 826 | Ga0105245_10287418 | |||
| 827 | Ga0105247_10005193 | |||
| 828 | Ga0114129_10001306 | |||
| 829 | Ga0114129_10100464 | |||
| 830 | Ga0114129_10193391 | |||
| 831 | Ga0105243_10002101 | |||
| 832 | Ga0105243_10018799 | |||
| 833 | Ga0105243_10073201 | |||
| 834 | Ga0105243_10478881 | |||
| 835 | Ga0105243_11012391 | |||
| 836 | Ga0105241_10031254 | |||
| 837 | Ga0105242_10003872 | |||
| 838 | Ga0105242_10006050 | |||
| 839 | Ga0105242_10840318 | |||
| 840 | Ga0105242_11279103 | |||
| 841 | Ga0105248_10003745 | |||
| 842 | Ga0105248_10137648 | |||
| 843 | Ga0105237_10731473 | |||
| 844 | Ga0105249_10002268 | |||
| 845 | Ga0105249_10152982 | |||
| 846 | Ga0105239_10027772 | |||
| 847 | Ga0105239_10046162 | |||
| 848 | Ga0105239_11248209 | |||
| 849 | Ga0105246_10337869 | |||
| 850 | Ga0157370_10536111 | |||
| 851 | Ga0157374_10112114 | |||
| 852 | Ga0157378_10002234 | |||
| 853 | Ga0157378_10015405 | |||
| 854 | Ga0157378_10518083 | |||
| 855 | Ga0163162_10010521 | |||
| 856 | Ga0163162_10624068 | |||
| 857 | Ga0157372_10081512 | |||
| 858 | Ga0157375_10567543 | |||
| 859 | Ga0157375_10675019 | |||
| 860 | Ga0157375_11249307 | |||
| 861 | Ga0157380_10135037 | |||
| 862 | Ga0157380_10847413 | |||
| 863 | Ga0157379_10282950 | |||
| 864 | Ga0157376_10058289 | |||
| 865 | Ga0163161_10905461 | |||
| 866 | Ga0207692_10004664 | |||
| 867 | Ga0207642_10002257 | |||
| 868 | Ga0207642_10027983 | |||
| 869 | Ga0207710_10088798 | |||
| 870 | Ga0207688_10043219 | |||
| 871 | Ga0207688_10046069 | |||
| 872 | Ga0207685_10034334 | |||
| 873 | Ga0207685_10192092 | |||
| 874 | Ga0207684_10015975 | |||
| 875 | Ga0207684_10042274 | |||
| 876 | Ga0207654_10282486 | |||
| 877 | Ga0207707_10190001 | |||
| 878 | Ga0207671_10031469 | |||
| 879 | Ga0207693_10240341 | |||
| 880 | Ga0207693_10502205 | |||
| 881 | Ga0207660_10721573 | |||
| 882 | Ga0207662_10187914 | |||
| 883 | Ga0207657_10070856 | |||
| 884 | Ga0207657_10210965 | |||
| 885 | Ga0207652_10495668 | |||
| 886 | Ga0207646_10003166 | |||
| 887 | Ga0207646_10349946 | |||
| 888 | Ga0207687_10082954 | |||
| 889 | Ga0207687_10183520 | |||
| 890 | Ga0207687_10315957 | |||
| 891 | Ga0207700_10000001 | |||
| 892 | Ga0207664_10007480 | |||
| 893 | Ga0207664_10620604 | |||
| 894 | Ga0207644_10113153 | |||
| 895 | Ga0207644_10269453 | |||
| 896 | Ga0207690_10009765 | |||
| 897 | Ga0207690_10268640 | |||
| 898 | Ga0207706_10017695 | |||
| 899 | Ga0207706_10025900 | |||
| 900 | Ga0207706_10164810 | |||
| 901 | Ga0207686_10002915 | |||
| 902 | Ga0207686_10011488 | |||
| 903 | Ga0207686_10368337 | |||
| 904 | Ga0207709_10007420 | |||
| 905 | Ga0207709_10035624 | |||
| 906 | Ga0207709_10703651 | |||
| 907 | Ga0207670_10072894 | |||
| 908 | Ga0207669_10004798 | |||
| 909 | Ga0207669_10337146 | |||
| 910 | Ga0207704_10004162 | |||
| 911 | Ga0207704_10032143 | |||
| 912 | Ga0207665_10008736 | |||
| 913 | Ga0207665_10044506 | |||
| 914 | Ga0207691_10092564 | |||
| 915 | Ga0207711_10055710 | |||
| 916 | Ga0207689_10439086 | |||
| 917 | Ga0207661_10041201 | |||
| 918 | Ga0207679_10184649 | |||
| 919 | Ga0207667_11033882 | |||
| 920 | Ga0207712_10018688 | |||
| 921 | Ga0207712_10437367 | |||
| 922 | Ga0207668_10037468 | |||
| 923 | Ga0207668_10054335 | |||
| 924 | Ga0207668_10128109 | |||
| 925 | Ga0207640_10544147 | |||
| 926 | Ga0207640_11185333 | |||
| 927 | Ga0207658_10128199 | |||
| 928 | Ga0207677_10006932 | |||
| 929 | Ga0207677_11425208 | |||
| 930 | Ga0207703_10034951 | |||
| 931 | Ga0207678_10007583 | |||
| 932 | Ga0207678_10243650 | |||
| 933 | Ga0207708_10000352 | |||
| 934 | Ga0207708_10021692 | |||
| 935 | Ga0207702_10005699 | |||
| 936 | Ga0207702_10024434 | |||
| 937 | Ga0207648_10000454 | |||
| 938 | Ga0207648_10033192 | |||
| 939 | Ga0207674_10000884 | |||
| 940 | Ga0207675_100005637 | |||
| 941 | Ga0207683_10000215 | |||
| 942 | Ga0207683_10000598 | |||
| 943 | Ga0207683_10029743 | |||
| 944 | Ga0207698_10024666 | |||
| 945 | Ga0207698_10084263 | |||
| 946 | Ga0207428_10000536 | |||
| 947 | Ga0207428_10144766 | |||
| 948 | Ga0268266_10125100 | |||
| 949 | Ga0268265_10429580 | |||
| 950 | Ga0268265_10809231 | |||
| 951 | Ga0268264_10083396 | |||
| 952 | Ga0268264_10201932 | |||
| 953 | Ga0307408_100452363 | |||
| 954 | Ga0307412_10081596 | |||
| 955 | Ga0307409_100295095 | |||
| 956 | Ga0307409_100397048 | |||
| 957 | Ga0307416_100003646 | |||
| 958 | Ga0307416_100160851 | |||
| 959 | Ga0307415_100000337 | |||
| 960 | Ga0373941_0038176 | |||
| 961 | Ga0373931_0429161 | |||
| 962 | Ga0373935_0120982 | |||
| 963 | Ga0373935_0202760 | |||
| 964 | Ga0373935_0274716 | |||
| 965 | Ga0373947_0116553 | |||
| 966 | Ga0373947_0324660 | |||
| 967 | Ga0373947_0607345 | |||
| 968 | Ga0373925_0087311 | |||
| 969 | Ga0395899_0016012 | |||
| 970 | Ga0395899_0017934 | |||
| 971 | Ga0395899_0025447 | |||
| 972 | Ga0395899_0033236 | |||
| 973 | Ga0395899_0100859 | |||
| 974 | Ga0395899_0128772 | |||
| 975 | Ga0395899_0180273 | |||
| 976 | Ga0395899_0250542 | |||
| 977 | Ga0395899_0717465 | |||
| 978 | Ga0395900_0001791 | |||
| 979 | Ga0395900_0002072 | |||
| 980 | Ga0395900_0007340 | |||
| 981 | Ga0395900_0009877 | |||
| 982 | Ga0395900_0028613 | |||
| 983 | Ga0395900_0033029 | |||
| 984 | Ga0395900_0070415 | |||
| 985 | Ga0395900_0149566 | |||
| 986 | Ga0395900_0250042 | |||
| 987 | Ga0395900_0276823 | |||
| 988 | Ga0395900_0613301 | |||
| 989 | Ga0395900_0627029 | |||
| 990 | Ga0395900_0760898 | |||
| 991 | Ga0395900_0775696 | |||
| 992 | Ga0395900_0836957 | |||
| 993 | Ga0395900_1351357 | |||
| 994 | Ga0395898_0001986 | |||
| 995 | Ga0395898_0004603 | |||
| 996 | Ga0395898_0015283 | |||
| 997 | Ga0395898_0022640 | |||
| 998 | Ga0395898_0024775 | |||
| 999 | Ga0395898_0042756 | |||
| 1000 | Ga0395898_0081905 | |||
| 1001 | Ga0395898_0138050 | |||
| 1002 | Ga0395898_0276709 | |||
| 1003 | Ga0395898_0349595 | |||
| 1004 | Ga0395898_0780036 | |||
| 1005 | Ga0395898_0952163 | |||
| 1006 | Ga0395905_0002836 | |||
| 1007 | Ga0395905_0003878 | |||
| 1008 | Ga0395905_0007962 | |||
| 1009 | Ga0395905_0008903 | |||
| 1010 | Ga0395905_0035450 | |||
| 1011 | Ga0395905_0072997 | |||
| 1012 | Ga0395905_0129833 | |||
| 1013 | Ga0395905_0160720 | |||
| 1014 | Ga0395905_0661561 | |||
| 1015 | Ga0395905_0893172 | |||
| 1016 | Ga0395901_0001774 | |||
| 1017 | Ga0395901_0012910 | |||
| 1018 | Ga0395901_0020180 | |||
| 1019 | Ga0395901_0023176 | |||
| 1020 | Ga0395901_0028303 | |||
| 1021 | Ga0395901_0038841 | |||
| 1022 | Ga0395901_0065959 | |||
| 1023 | Ga0395901_0069452 | |||
| 1024 | Ga0395901_0087314 | |||
| 1025 | Ga0395901_0092634 | |||
| 1026 | Ga0395901_0122389 | |||
| 1027 | Ga0395901_0152848 | |||
| 1028 | Ga0395901_0248600 | |||
| 1029 | Ga0395901_0866100 | |||
| 1030 | Ga0395901_0866798 | |||
| 1031 | Ga0439438_039104 | |||
| 1032 | Ga0439445_0053354 | |||
| 1033 | Ga0439434_0008004 | |||
| 1034 | Ga0495603_0010232 | |||
| 1035 | Ga0495603_0042602 | |||
| 1036 | Ga0495603_0042763 | |||
| 1037 | Ga0495603_0153623 | |||
| 1038 | Ga0495603_0211357 | |||
| 1039 | Ga0495590_0194597 | |||
| 1040 | Ga0495641_0022666 | |||
| 1041 | Ga0495641_0045517 | |||
| 1042 | Ga0495641_0054181 | |||
| 1043 | Ga0495641_0087049 | |||
| 1044 | Ga0495580_0505610 | |||
| 1045 | Ga0495582_0008170 | |||
| 1046 | Ga0495582_0046457 | |||
| 1047 | Ga0495582_0050178 | |||
| 1048 | Ga0495582_0052024 | |||
| 1049 | Ga0495582_0088371 | |||
| 1050 | Ga0495605_0141509 | |||
| 1051 | Ga0495639_0029577 | |||
| 1052 | Ga0495639_0065584 | |||
| 1053 | Ga0495584_0032978 | |||
| 1054 | Ga0495584_0068803 | |||
| 1055 | Ga0495584_0153619 | |||
| 1056 | Ga0495584_0325403 | |||
| 1057 | Ga0495594_0061634 | |||
| 1058 | Ga0495596_0018413 | |||
| 1059 | Ga0495596_0096624 | |||
| 1060 | Ga0495607_0383556 | |||
| 1061 | Ga0495616_0041965 | |||
| 1062 | Ga0495618_0406078 | |||
| 1063 | Ga0495630_0479672 | |||
| 1064 | Ga0495631_0079747 | |||
| 1065 | Ga0495663_0019891 | |||
| 1066 | Ga0495642_0054626 | |||
| 1067 | Ga0495665_0036930 | |||
| 1068 | Ga0495665_0060583 | |||
| 1069 | Ga0495598_0076769 | |||
| 1070 | Ga0495598_0112640 | |||
| 1071 | Ga0495656_0195163 | |||
| 1072 | Ga0495656_0204580 | |||
| 1073 | Ga0495656_0242835 | |||
| 1074 | Ga0495635_0317605 | |||
| 1075 | Ga0495659_0013152 | |||
| 1076 | Ga0495659_0058745 | |||
| 1077 | Ga0495588_0011717 | |||
| 1078 | Ga0495588_0141106 | |||
| 1079 | Ga0495588_0217225 | |||
| 1080 | Ga0495647_0109625 | |||
| 1081 | Ga0495647_0149218 | |||
| 1082 | Ga0495658_0027818 | |||
| 1083 | Ga0495658_0071690 | |||
| 1084 | Ga0495613_0023422 | |||
| 1085 | Ga0495613_0187011 | |||
| 1086 | Ga0495624_0061663 | |||
| 1087 | Ga0495589_0036432 | |||
| 1088 | Ga0495581_0003346 | |||
| 1089 | Ga0495581_0004944 | |||
| 1090 | Ga0495581_0100696 | |||
| 1091 | Ga0495581_0434876 | |||
| 1092 | Ga0495636_0069024 | |||
| 1093 | Ga0495676_0043546 | |||
| 1094 | Ga0495676_0051111 | |||
| 1095 | Ga0495676_0080259 | |||
| 1096 | Ga0495676_0115433 | |||
| 1097 | Ga0495677_0031837 | |||
| 1098 | Ga0496100_0004515 | |||
| 1099 | Ga0496101_0012099 | |||
| 1100 | Ga0496101_0040326 | |||
| 1101 | Ga0496101_0408643 | |||
| 1102 | Ga0496102_0003640 | |||
| 1103 | Ga0496102_0026127 | |||
| 1104 | Ga0496103_0002529 | |||
| 1105 | Ga0496103_0037900 | |||
| 1106 | Ga0496104_0024087 | |||
| 1107 | Ga0496104_0073571 | |||
| 1108 | Ga0496104_0079456 | |||
| 1109 | Ga0496104_0111531 | |||
| 1110 | Ga0496105_0005517 | |||
| 1111 | Ga0496105_0033994 | |||
| 1112 | Ga0496105_0050761 | |||
| 1113 | Ga0496105_0064957 | |||
| 1114 | Ga0496106_0000909 | |||
| 1115 | Ga0496106_0015697 | |||
| 1116 | Ga0496106_0041996 | |||
| 1117 | Ga0496107_0004522 | |||
| 1118 | Ga0496107_0006455 | |||
| 1119 | Ga0496108_0132634 | |||
| 1120 | Ga0496108_0208793 | |||
| 1121 | Ga0496109_0045034 | |||
| 1122 | Ga0496109_0094429 | |||
| 1123 | Ga0496110_0224292 | |||
| 1124 | Ga0496111_0047613 | |||
| 1125 | Ga0496111_0187408 | |||
| 1126 | Ga0496111_0500055 | |||
| 1127 | Ga0496111_0604512 | |||
| 1128 | Ga0496112_0008919 | |||
| 1129 | Ga0496112_0054971 | |||
| 1130 | Ga0496112_0609117 | |||
| 1131 | Ga0496113_0065291 | |||
| 1132 | Ga0496113_0256676 | |||
| 1133 | Ga0496114_0004323 | |||
| 1134 | Ga0496114_0050549 | |||
| 1135 | Ga0496114_0071486 | |||
| 1136 | Ga0496114_0389372 | |||
| 1137 | Ga0496115_0004519 | |||
| 1138 | Ga0496115_0041516 | |||
| 1139 | Ga0496115_0118638 | |||
| 1140 | Ga0496126_0805954 | |||
| 1141 | Ga0501031_0002949 | |||
| 1142 | Ga0501031_0010365 | |||
| 1143 | Ga0501031_0024701 | |||
| 1144 | Ga0501032_0003494 | |||
| 1145 | Ga0501032_0052585 | |||
| 1146 | Ga0501033_0000208 | |||
| 1147 | Ga0501033_0025623 | |||
| 1148 | Ga0501033_0037415 | |||
| 1149 | Ga0501033_0460247 | |||
| 1150 | Ga0501033_0699473 | |||
| 1151 | Ga0501034_0007404 | |||
| 1152 | Ga0501034_1025812 | |||
| 1153 | Ga0501036_0000085 | |||
| 1154 | Ga0501036_0003245 | |||
| 1155 | Ga0501036_0024163 | |||
| 1156 | Ga0501036_0031210 | |||
| 1157 | Ga0501036_0078804 | |||
| 1158 | Ga0501036_0128551 | |||
| 1159 | Ga0501037_0001998 | |||
| 1160 | Ga0501037_0022575 | |||
| 1161 | Ga0501037_0092400 | |||
| 1162 | Ga0501037_0411650 | |||
| 1163 | Ga0501038_0019326 | |||
| 1164 | Ga0501038_0021979 | |||
| 1165 | Ga0501038_0036559 | |||
| 1166 | Ga0501038_0074838 | |||
| 1167 | Ga0501038_0146510 | |||
| 1168 | Ga0501038_0335420 | |||
| 1169 | Ga0501039_0000171 | |||
| 1170 | Ga0501039_0006841 | |||
| 1171 | Ga0501039_0022482 | |||
| 1172 | Ga0501039_0029387 | |||
| 1173 | Ga0501039_0055992 | |||
| 1174 | Ga0501039_0223141 | |||
| 1175 | Ga0501039_0347988 | |||
| 1176 | Ga0501040_0000094 | |||
| 1177 | Ga0501040_0007610 | |||
| 1178 | Ga0501040_0014951 | |||
| 1179 | Ga0501040_0028446 | |||
| 1180 | Ga0501040_0072078 | |||
| 1181 | Ga0501040_0207345 | |||
| 1182 | Ga0501041_0003831 | |||
| 1183 | Ga0501041_0004209 | |||
| 1184 | Ga0501041_0011577 | |||
| 1185 | Ga0501041_0014221 | |||
| 1186 | Ga0501041_0024321 | |||
| 1187 | Ga0501041_0034222 | |||
| 1188 | Ga0501041_0286807 | |||
| 1189 | Ga0501041_0412648 | |||
| 1190 | Ga0501042_0001242 | |||
| 1191 | Ga0501042_0004579 | |||
| 1192 | Ga0501042_0019571 | |||
| 1193 | Ga0501042_0022773 | |||
| 1194 | Ga0501042_0083670 | |||
| 1195 | Ga0501042_0210385 | |||
| 1196 | Ga0501042_0284435 | |||
| 1197 | Ga0501043_0000295 | |||
| 1198 | Ga0501043_0034370 | |||
| 1199 | Ga0501043_0138415 | |||
| 1200 | Ga0501043_0298250 | |||
| 1201 | Ga0501046_0000999 | |||
| 1202 | Ga0501046_0008252 | |||
| 1203 | Ga0501046_0034637 | |||
| 1204 | Ga0501046_0039040 | |||
| 1205 | Ga0501046_0056277 | |||
| 1206 | Ga0501046_0078414 | |||
| 1207 | Ga0501046_0090895 | |||
| 1208 | Ga0501047_0001721 | |||
| 1209 | Ga0501047_0310157 | |||
| 1210 | Ga0501047_0522343 | |||
| 1211 | Ga0501048_0000212 | |||
| 1212 | Ga0501048_0001705 | |||
| 1213 | Ga0501048_0008060 | |||
| 1214 | Ga0501048_0010970 | |||
| 1215 | Ga0501048_0013342 | |||
| 1216 | Ga0501048_0035911 | |||
| 1217 | Ga0501048_0140096 | |||
| 1218 | Ga0501048_0430397 | |||
| 1219 | Ga0501067_0030485 | |||
| 1220 | Ga0501067_0052297 | |||
| 1221 | Ga0501068_0000052 | |||
| 1222 | Ga0501068_0009191 | |||
| 1223 | Ga0501068_0054451 | |||
| 1224 | Ga0501068_0056211 | |||
| 1225 | Ga0501068_0078343 | |||
| 1226 | Ga0501068_0325606 | |||
| 1227 | Ga0501069_0000542 | |||
| 1228 | Ga0501069_0007975 | |||
| 1229 | Ga0501069_0028392 | |||
| 1230 | Ga0501069_0288549 | |||
| 1231 | Ga0501070_0001060 | |||
| 1232 | Ga0501070_0006669 | |||
| 1233 | Ga0501070_0028091 | |||
| 1234 | Ga0501071_0001124 | |||
| 1235 | Ga0501071_0002813 | |||
| 1236 | Ga0501071_0004755 | |||
| 1237 | Ga0501071_0009237 | |||
| 1238 | Ga0501071_0015940 | |||
| 1239 | Ga0501071_0056179 | |||
| 1240 | Ga0501071_0077477 | |||
| 1241 | Ga0501071_0134870 | |||
| 1242 | Ga0501072_0000072 | |||
| 1243 | Ga0501072_0003239 | |||
| 1244 | Ga0501072_0024426 | |||
| 1245 | Ga0501072_0029627 | |||
| 1246 | Ga0501072_0054718 | |||
| 1247 | Ga0501072_0102247 | |||
| 1248 | Ga0501072_0148131 | |||
| 1249 | Ga0501072_0204309 | |||
| 1250 | Ga0501072_0407352 | |||
| 1251 | Ga0501073_0002604 | |||
| 1252 | Ga0501073_0025215 | |||
| 1253 | Ga0501073_0074420 | |||
| 1254 | Ga0501073_0139504 | |||
| 1255 | Ga0501074_0008516 | |||
| 1256 | Ga0501074_0012433 | |||
| 1257 | Ga0501074_0013431 | |||
| 1258 | Ga0501074_0046305 | |||
| 1259 | Ga0501074_0108726 | |||
| 1260 | Ga0501075_0000109 | |||
| 1261 | Ga0501075_0004222 | |||
| 1262 | Ga0501075_0018666 | |||
| 1263 | Ga0501075_0038743 | |||
| 1264 | Ga0501075_0113366 | |||
| 1265 | Ga0501076_0000554 | |||
| 1266 | Ga0501076_0010496 | |||
| 1267 | Ga0501076_0010994 | |||
| 1268 | Ga0501076_0011031 | |||
| 1269 | Ga0501076_0014933 | |||
| 1270 | Ga0501076_0022334 | |||
| 1271 | Ga0501076_0022608 | |||
| 1272 | Ga0501076_0782237 | |||
| 1273 | Ga0501077_0000809 | |||
| 1274 | Ga0501077_0006994 | |||
| 1275 | Ga0501077_0033016 | |||
| 1276 | Ga0501077_0033947 | |||
| 1277 | Ga0501077_0038727 | |||
| 1278 | Ga0501077_0049873 | |||
| 1279 | Ga0501077_0291313 | |||
| 1280 | Ga0501079_0000099 | |||
| 1281 | Ga0501079_0008226 | |||
| 1282 | Ga0501079_0024980 | |||
| 1283 | Ga0501079_0055896 | |||
| 1284 | Ga0501079_0211588 | |||
| 1285 | Ga0501079_0260480 | |||
| 1286 | Ga0501079_0266329 | |||
| 1287 | Ga0501080_0051601 | |||
| 1288 | Ga0501080_0063926 | |||
| 1289 | Ga0501080_0065679 | |||
| 1290 | Ga0501080_0107814 | |||
| 1291 | Ga0501080_0110863 | |||
| 1292 | Ga0501080_0129243 | |||
| 1293 | Ga0501080_0478487 | |||
| 1294 | Ga0501081_0001992 | |||
| 1295 | Ga0501081_0009326 | |||
| 1296 | Ga0501081_0010341 | |||
| 1297 | Ga0501081_0060521 | |||
| 1298 | Ga0501081_0061001 | |||
| 1299 | Ga0501081_0071037 | |||
| 1300 | Ga0501081_0126758 | |||
| 1301 | Ga0501081_0142548 | |||
| 1302 | Ga0501081_0148744 | |||
| 1303 | Ga0501083_0001781 | |||
| 1304 | Ga0501083_0026883 | |||
| 1305 | Ga0501083_0077849 | |||
| 1306 | Ga0501035_0001297 | |||
| 1307 | Ga0501035_0002978 | |||
| 1308 | Ga0501035_0013570 | |||
| 1309 | Ga0501035_0023004 | |||
| 1310 | Ga0501035_0147874 | |||
| 1311 | Ga0501035_0722147 | |||
| 1312 | Ga0501044_0021292 | |||
| 1313 | Ga0501044_0026520 | |||
| 1314 | Ga0501044_0087411 | |||
| 1315 | Ga0501044_0593536 | |||
| 1316 | Ga0501045_0002382 | |||
| 1317 | Ga0501045_0003471 | |||
| 1318 | Ga0501045_0008005 | |||
| 1319 | Ga0501045_0009225 | |||
| 1320 | Ga0501045_0036104 | |||
| 1321 | Ga0501045_0043354 | |||
| 1322 | Ga0501045_0043537 | |||
| 1323 | Ga0501045_0085425 | |||
| 1324 | nmdc:mga05p37_1267279_c1 | |||
| 1325 | nmdc:mga05p37_2685_c1 | |||
| 1326 | nmdc:mga05p37_676826_c1 | |||
| 1327 | nmdc:mga05p37_833064_c1 | |||
| 1328 | nmdc:mga09592_545113_c1 | |||
| 1329 | nmdc:mga09592_577611_c1 | |||
| 1330 | nmdc:mga09592_8889_c1 | |||
| 1331 | nmdc:mga0qj67_107716_c1 | |||
| 1332 | nmdc:mga08y16_326172_c1 | |||
| 1333 | nmdc:mga08y16_459097_c1 | |||
| 1334 | nmdc:mga08y16_7755_c1 | |||
| 1335 | nmdc:mga0n895_362118_c1 | |||
| 1336 | nmdc:mga0a205_303837_c1 | |||
| 1337 | nmdc:mga0a205_30887_c1 | |||
| 1338 | nmdc:mga0a205_456151_c1 | |||
| 1339 | Ga0495601_0003546 | |||
| 1340 | Ga0495612_0001908 | |||
| 1341 | Ga0495655_0008712 | |||
| 1342 | Ga0495595_0127070 | |||
| 1343 | Ga0495595_0207442 | |||
| 1344 | Ga0495619_0057932 | |||
| 1345 | Ga0501084_0001093 | |||
| 1346 | Ga0501084_0014311 | |||
| 1347 | Ga0501084_0021204 | |||
| 1348 | Ga0501084_0029568 | |||
| 1349 | Ga0501084_0037986 | |||
| 1350 | Ga0501084_0057619 | |||
| 1351 | Ga0501084_0059559 | |||
| 1352 | Ga0501084_0071760 | |||
| 1353 | Ga0501084_0159426 | |||
| 1354 | Ga0501082_0000655 | |||
| 1355 | Ga0501082_0031374 | |||
| 1356 | Ga0501082_0034568 | |||
| 1357 | Ga0501082_0126594 | |||
| 1358 | Ga0501082_0157430 | |||
| 1359 | Ga0501082_0187895 | |||
| 1360 | Ga0530510_0003150 | |||
| 1361 | Ga0530510_0005743 | |||
| 1362 | Ga0530510_0008670 | |||
| 1363 | Ga0530510_0025673 | |||
| 1364 | Ga0530510_0030971 | |||
| 1365 | Ga0530510_0066171 | |||
| 1366 | Ga0530510_0218910 | |||
| 1367 | Ga0530510_0591041 | |||
| 1368 | 2852679567 | |||
| 1369 | 2857720216 | |||
| 1370 | 2928091946 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2xw7-assembly1.cif.gz_B | structure of mycobacterium smegmatis putative reductase ms0308 | 0.9329 | 2 | 184 |
| 2xw7-assembly1.cif.gz_B | structure of mycobacterium smegmatis putative reductase ms0308 | 0.9173 | 2 | 184 |
| 7xh2-assembly1.cif.gz_A | dihydrofolate reductase-like protein sach in safracin biosynthesis | 0.913 | 1 | 180 |
| 7xh2-assembly1.cif.gz_A | dihydrofolate reductase-like protein sach in safracin biosynthesis | 0.908 | 1 | 180 |
| 3jtw-assembly2.cif.gz_B-3 | crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution | 0.8451 | 1 | 179 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2xw7B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.9329 | 2 | 184 | 3.40.430.10 |
| 2xw7B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.9173 | 2 | 184 | 3.40.430.10 |
| 3jtwB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.84 | 1 | 179 | 3.40.430.10 |
| 3jtwB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8264 | 1 | 179 | 3.40.430.10 |
| 3ky8B01 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8102 | 4 | 179 | 3.40.430.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538FUY3-F1-model_v4 | Dihydrofolate reductase | 0.992 | 2 | 180 |
GO:0008703
GO:0009231 |
| AF-A0A538KY34-F1-model_v4 | Dihydrofolate reductase | 0.9913 | 17 | 180 |
GO:0008703
GO:0009231 |
| AF-A0A6I2FCZ9-F1-model_v4 | Dihydrofolate reductase | 0.9731 | 2 | 185 |
GO:0008703
GO:0009231 |
| AF-A0A6I2FU62-F1-model_v4 | Dihydrofolate reductase | 0.9707 | 1 | 181 |
GO:0008703
GO:0009231 |
| AF-A0A1Q3L9T1-F1-model_v4 | Deaminase | 0.9687 | 3 | 185 |
GO:0008703
GO:0009231 |