F475136

General Info

Members Datasets Scaffolds Average Seq Length
685 270 1370 186

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10033049|Ga0307406_100330492
Length 222
Sequence VSLTQYYTATTLDGFIADPDNSLDWLFTRKRDEDGPLNYDDFIVGIGAMAMGSTTYEWILDHEFAGKDPAEWKWPYDIPCWVFTHRQLPVIPDSQVEFTSADVAGVHKEMVAAAGDRNVWIVGGGDLAGQFADVGLLDEVIVSIAPVTLGEGASLLPRRIELRLDELGRNGDFACAKFSVVRPRLTCLLQEAAKSVGFEDAIVDSRSGRGHVFRGESSAPAV

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
170 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
171 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
174 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
182 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
183 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
187 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
188 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
195 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
262 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
268 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
269 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
270 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.13
Rhizosphere 93.58
Stem 0
Stem Tuber 0
Unclassified 2.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10033049 3300031901 Bacteria 3163
2 2214737450 2209111006 Bacteria 985
3 ARCol0yngRDRAFT_1004541 3300000652 Bacteria 1005
4 JGI24742J22300_10010015 3300002244 Unclassified 1566
5 JGI24742J22300_10027888 3300002244 Bacteria 979
6 JGI25407J50210_10006502 3300003373 Bacteria 2911
7 Ga0070676_10414336 3300005328 Bacteria 940
8 Ga0070683_100096504 3300005329 Bacteria 2780
9 Ga0070683_100685576 3300005329 Bacteria 981
10 Ga0070683_100705827 3300005329 Bacteria 966
11 Ga0070683_100731223 3300005329 Bacteria 948
12 Ga0070690_100220631 3300005330 Bacteria 1328
13 Ga0068869_100271021 3300005334 Bacteria 1362
14 Ga0070680_100072186 3300005336 Bacteria 2837
15 Ga0070682_100024068 3300005337 Bacteria 3621
16 Ga0070682_100241624 3300005337 Bacteria 1296
17 Ga0068868_100157956 3300005338 Bacteria 1871
18 Ga0070660_100079336 3300005339 Bacteria 2575
19 Ga0070689_100045667 3300005340 Bacteria 3373
20 Ga0070691_10057287 3300005341 Bacteria 1869
21 Ga0070687_100566686 3300005343 Bacteria 775
22 Ga0070661_101094464 3300005344 Bacteria 664
23 Ga0070692_10030160 3300005345 Bacteria 2710
24 Ga0070692_10243671 3300005345 Bacteria 1073
25 Ga0070668_100072621 3300005347 Bacteria 2681
26 Ga0070668_101134083 3300005347 Bacteria 707
27 Ga0070671_100141005 3300005355 Bacteria 2034
28 Ga0070671_100226950 3300005355 Bacteria 1585
29 Ga0070674_100076053 3300005356 Bacteria 2386
30 Ga0070674_100467047 3300005356 Bacteria 1045
31 Ga0070688_100007933 3300005365 Bacteria 5742
32 Ga0070659_100082858 3300005366 Bacteria 2563
33 Ga0070709_10022813 3300005434 Bacteria 3667
34 Ga0070709_10497454 3300005434 Bacteria 925
35 Ga0070714_100028631 3300005435 Bacteria 4624
36 Ga0070714_100405791 3300005435 Bacteria 1289
37 Ga0070713_100003604 3300005436 Bacteria 10234
38 Ga0070713_100379486 3300005436 Bacteria 1317
39 Ga0070710_10004250 3300005437 Bacteria 6789
40 Ga0070710_10772600 3300005437 Bacteria 684
41 Ga0070711_100139850 3300005439 Bacteria 1814
42 Ga0070711_100989509 3300005439 Bacteria 721
43 Ga0070705_100010591 3300005440 Bacteria 4621
44 Ga0070705_100097030 3300005440 Bacteria 1852
45 Ga0070705_100824952 3300005440 Bacteria 740
46 Ga0070700_100001973 3300005441 Bacteria 10413
47 Ga0070694_100096438 3300005444 Bacteria 2084
48 Ga0070694_100249847 3300005444 Bacteria 1341
49 Ga0070708_100009720 3300005445 Bacteria 7762
50 Ga0070708_100016741 3300005445 Bacteria 6092
51 Ga0070708_100269088 3300005445 Bacteria 1603
52 Ga0070663_100117302 3300005455 Bacteria 2007
53 Ga0070663_100147577 3300005455 Bacteria 1801
54 Ga0070663_100548430 3300005455 Bacteria 966
55 Ga0070678_100001257 3300005456 Bacteria 13440
56 Ga0070678_100003776 3300005456 Bacteria 8491
57 Ga0070662_100081937 3300005457 Bacteria 2405
58 Ga0070681_10087496 3300005458 Bacteria 3068
59 Ga0070681_10220040 3300005458 Bacteria 1814
60 Ga0068867_100002991 3300005459 Bacteria 11912
61 Ga0068867_100030029 3300005459 Bacteria 3920
62 Ga0070685_10001367 3300005466 Bacteria 12809
63 Ga0070706_100037504 3300005467 Bacteria 4476
64 Ga0070707_100013757 3300005468 Bacteria 7578
65 Ga0070707_100205038 3300005468 Bacteria 1922
66 Ga0070707_100308627 3300005468 Bacteria 1537
67 Ga0070707_100467954 3300005468 Bacteria 1222
68 Ga0070698_100011998 3300005471 Bacteria 9188
69 Ga0070698_100216877 3300005471 Bacteria 1847
70 Ga0070698_100305238 3300005471 Bacteria 1522
71 Ga0070699_100036286 3300005518 Bacteria 4265
72 Ga0070699_100308796 3300005518 Bacteria 1420
73 Ga0070679_100006758 3300005530 Bacteria 10697
74 Ga0070684_100001756 3300005535 Bacteria 15805
75 Ga0070697_100330165 3300005536 Bacteria 1315
76 Ga0070672_100160081 3300005543 Bacteria 1867
77 Ga0070686_100003662 3300005544 Bacteria 8435
78 Ga0070686_100017307 3300005544 Bacteria 4210
79 Ga0070695_100204704 3300005545 Bacteria 1413
80 Ga0070696_100010694 3300005546 Bacteria 6148
81 Ga0070693_100019090 3300005547 Bacteria 3588
82 Ga0070693_100043603 3300005547 Bacteria 2534
83 Ga0070665_100282510 3300005548 Bacteria 1662
84 Ga0070704_100041616 3300005549 Bacteria 3172
85 Ga0068855_100186153 3300005563 Bacteria 2345
86 Ga0068855_101155719 3300005563 Bacteria 807
87 Ga0070664_100502047 3300005564 Bacteria 1118
88 Ga0068857_100003952 3300005577 Bacteria 12481
89 Ga0068854_100096921 3300005578 Bacteria 2204
90 Ga0070702_100001118 3300005615 Bacteria 10768
91 Ga0070702_100048238 3300005615 Bacteria 2423
92 Ga0068852_100002120 3300005616 Bacteria 13586
93 Ga0068852_100914427 3300005616 Bacteria 895
94 Ga0068859_100132251 3300005617 Bacteria 2567
95 Ga0068866_10003386 3300005718 Bacteria 6541
96 Ga0068866_10021614 3300005718 Bacteria 2966
97 Ga0068866_10090005 3300005718 Bacteria 1669
98 Ga0068866_10620235 3300005718 Bacteria 733
99 Ga0068866_10712765 3300005718 Bacteria 689
100 Ga0068861_100000835 3300005719 Bacteria 18614
101 Ga0068861_100328249 3300005719 Bacteria 1335
102 Ga0068858_100196821 3300005842 Bacteria 1905
103 Ga0068860_100045304 3300005843 Bacteria 4194
104 Ga0068860_100085495 3300005843 Bacteria 3002
105 Ga0068862_100743289 3300005844 Bacteria 954
106 Ga0081455_10013939 3300005937 Bacteria 7902
107 Ga0081455_10029119 3300005937 Bacteria 5037
108 Ga0081455_10421801 3300005937 Unclassified 920
109 Ga0081538_10000676 3300005981 Bacteria 37492
110 Ga0081540_1007225 3300005983 Bacteria 7963
111 Ga0070717_10207430 3300006028 Bacteria 1719
112 Ga0075432_10000256 3300006058 Bacteria 14544
113 Ga0070716_100038686 3300006173 Bacteria 2642
114 Ga0070716_100064336 3300006173 Bacteria 2132
115 Ga0070712_100008432 3300006175 Bacteria 6485
116 Ga0070712_100043180 3300006175 Bacteria 3103
117 Ga0097621_100027655 3300006237 Bacteria 4463
118 Ga0097621_100064712 3300006237 Bacteria 3008
119 Ga0068871_100006996 3300006358 Bacteria 8040
120 Ga0068871_100422289 3300006358 Bacteria 1191
121 Ga0068871_100487070 3300006358 Bacteria 1110
122 Ga0075428_100003661 3300006844 Bacteria 16849
123 Ga0075428_100221958 3300006844 Bacteria 2041
124 Ga0075428_100251508 3300006844 Bacteria 1905
125 Ga0075428_100432560 3300006844 Bacteria 1410
126 Ga0075433_10076841 3300006852 Bacteria 2941
127 Ga0075434_100569579 3300006871 Unclassified 1152
128 Ga0075429_100027667 3300006880 Bacteria 4922
129 Ga0075429_100400128 3300006880 Bacteria 1203
130 Ga0068865_100020257 3300006881 Bacteria 4313
131 Ga0068865_100032914 3300006881 Bacteria 3468
132 Ga0097620_100132253 3300006931 Bacteria 2567
133 Ga0075435_100174683 3300007076 Bacteria 1814
134 Ga0111539_10159984 3300009094 Bacteria 2634
135 Ga0111539_10236466 3300009094 Bacteria 2127
136 Ga0111539_10373815 3300009094 Bacteria 1659
137 Ga0111539_11241792 3300009094 Bacteria 865
138 Ga0105245_10106653 3300009098 Unclassified 2600
139 Ga0105245_10222041 3300009098 Bacteria 1824
140 Ga0105245_10228447 3300009098 Bacteria 1799
141 Ga0105245_10287418 3300009098 Bacteria 1609
142 Ga0105247_10005193 3300009101 Bacteria 8234
143 Ga0114129_10001306 3300009147 Bacteria 33269
144 Ga0114129_10100464 3300009147 Bacteria 4003
145 Ga0114129_10193391 3300009147 Bacteria 2761
146 Ga0105243_10002101 3300009148 Bacteria 16849
147 Ga0105243_10018799 3300009148 Bacteria 5236
148 Ga0105243_10073201 3300009148 Bacteria 2776
149 Ga0105243_10478881 3300009148 Bacteria 1174
150 Ga0105243_11012391 3300009148 Bacteria 834
151 Ga0105241_10031254 3300009174 Bacteria 3987
152 Ga0105242_10003872 3300009176 Bacteria 11631
153 Ga0105242_10006050 3300009176 Bacteria 9325
154 Ga0105242_10840318 3300009176 Bacteria 913
155 Ga0105242_11279103 3300009176 Bacteria 756
156 Ga0105248_10003745 3300009177 Bacteria 16866
157 Ga0105248_10137648 3300009177 Bacteria 2755
158 Ga0105237_10731473 3300009545 Bacteria 996
159 Ga0105249_10002268 3300009553 Bacteria 16680
160 Ga0105249_10152982 3300009553 Bacteria 2222
161 Ga0105239_10027772 3300010375 Bacteria 6227
162 Ga0105239_10046162 3300010375 Bacteria 4773
163 Ga0105239_11248209 3300010375 Bacteria 857
164 Ga0105246_10337869 3300011119 Bacteria 1230
165 Ga0157370_10536111 3300013104 Bacteria 1073
166 Ga0157374_10112114 3300013296 Bacteria 2624
167 Ga0157378_10002234 3300013297 Bacteria 17171
168 Ga0157378_10015405 3300013297 Bacteria 6695
169 Ga0157378_10518083 3300013297 Bacteria 1194
170 Ga0163162_10010521 3300013306 Bacteria 8998
171 Ga0163162_10624068 3300013306 Bacteria 1203
172 Ga0157372_10081512 3300013307 Bacteria 3662
173 Ga0157375_10567543 3300013308 Bacteria 1296
174 Ga0157375_10675019 3300013308 Bacteria 1188
175 Ga0157375_11249307 3300013308 Bacteria 872
176 Ga0157380_10135037 3300014326 Bacteria 2111
177 Ga0157380_10847413 3300014326 Bacteria 935
178 Ga0157379_10282950 3300014968 Bacteria 1509
179 Ga0157376_10058289 3300014969 Bacteria 3234
180 Ga0163161_10905461 3300017792 Bacteria 748
181 Ga0207692_10004664 3300025898 Bacteria 5435
182 Ga0207642_10002257 3300025899 Bacteria 5994
183 Ga0207642_10027983 3300025899 Bacteria 2315
184 Ga0207710_10088798 3300025900 Bacteria 1444
185 Ga0207688_10043219 3300025901 Bacteria 2509
186 Ga0207688_10046069 3300025901 Bacteria 2434
187 Ga0207685_10034334 3300025905 Bacteria 1842
188 Ga0207685_10192092 3300025905 Bacteria 954
189 Ga0207684_10015975 3300025910 Bacteria 6451
190 Ga0207684_10042274 3300025910 Bacteria 3863
191 Ga0207654_10282486 3300025911 Bacteria 1123
192 Ga0207707_10190001 3300025912 Bacteria 1792
193 Ga0207671_10031469 3300025914 Bacteria 3953
194 Ga0207693_10240341 3300025915 Bacteria 1422
195 Ga0207693_10502205 3300025915 Bacteria 947
196 Ga0207660_10721573 3300025917 Bacteria 813
197 Ga0207662_10187914 3300025918 Bacteria 1332
198 Ga0207657_10070856 3300025919 Bacteria 2953
199 Ga0207657_10210965 3300025919 Bacteria 1559
200 Ga0207652_10495668 3300025921 Bacteria 1100
201 Ga0207646_10003166 3300025922 Bacteria 18831
202 Ga0207646_10349946 3300025922 Bacteria 1335
203 Ga0207687_10082954 3300025927 Bacteria 2320
204 Ga0207687_10183520 3300025927 Unclassified 1623
205 Ga0207687_10315957 3300025927 Bacteria 1263
206 Ga0207700_10000001 3300025928 Bacteria 1122509
207 Ga0207664_10007480 3300025929 Bacteria 7574
208 Ga0207664_10620604 3300025929 Bacteria 971
209 Ga0207644_10113153 3300025931 Bacteria 2055
210 Ga0207644_10269453 3300025931 Bacteria 1364
211 Ga0207690_10009765 3300025932 Bacteria 5702
212 Ga0207690_10268640 3300025932 Bacteria 1324
213 Ga0207706_10017695 3300025933 Bacteria 6421
214 Ga0207706_10025900 3300025933 Bacteria 5252
215 Ga0207706_10164810 3300025933 Bacteria 1948
216 Ga0207686_10002915 3300025934 Bacteria 9222
217 Ga0207686_10011488 3300025934 Bacteria 4851
218 Ga0207686_10368337 3300025934 Bacteria 1086
219 Ga0207709_10007420 3300025935 Bacteria 6109
220 Ga0207709_10035624 3300025935 Bacteria 2944
221 Ga0207709_10703651 3300025935 Bacteria 809
222 Ga0207670_10072894 3300025936 Bacteria 2379
223 Ga0207669_10004798 3300025937 Bacteria 5998
224 Ga0207669_10337146 3300025937 Bacteria 1160
225 Ga0207704_10004162 3300025938 Bacteria 6598
226 Ga0207704_10032143 3300025938 Bacteria 2966
227 Ga0207665_10008736 3300025939 Bacteria 6666
228 Ga0207665_10044506 3300025939 Bacteria 2970
229 Ga0207691_10092564 3300025940 Bacteria 2707
230 Ga0207711_10055710 3300025941 Bacteria 3395
231 Ga0207689_10439086 3300025942 Bacteria 1090
232 Ga0207661_10041201 3300025944 Bacteria 3634
233 Ga0207679_10184649 3300025945 Bacteria 1728
234 Ga0207667_11033882 3300025949 Bacteria 807
235 Ga0207712_10018688 3300025961 Bacteria 4517
236 Ga0207712_10437367 3300025961 Bacteria 1107
237 Ga0207668_10037468 3300025972 Bacteria 3246
238 Ga0207668_10054335 3300025972 Bacteria 2780
239 Ga0207668_10128109 3300025972 Bacteria 1934
240 Ga0207640_10544147 3300025981 Bacteria 974
241 Ga0207640_11185333 3300025981 Bacteria 678
242 Ga0207658_10128199 3300025986 Bacteria 2034
243 Ga0207677_10006932 3300026023 Bacteria 6230
244 Ga0207677_11425208 3300026023 Bacteria 638
245 Ga0207703_10034951 3300026035 Bacteria 3992
246 Ga0207678_10007583 3300026067 Bacteria 9588
247 Ga0207678_10243650 3300026067 Bacteria 1540
248 Ga0207708_10000352 3300026075 Bacteria 36059
249 Ga0207708_10021692 3300026075 Bacteria 4845
250 Ga0207702_10005699 3300026078 Bacteria 10859
251 Ga0207702_10024434 3300026078 Bacteria 5015
252 Ga0207648_10000454 3300026089 Bacteria 45454
253 Ga0207648_10033192 3300026089 Bacteria 4553
254 Ga0207674_10000884 3300026116 Bacteria 39178
255 Ga0207675_100005637 3300026118 Bacteria 11985
256 Ga0207683_10000215 3300026121 Bacteria 50395
257 Ga0207683_10000598 3300026121 Bacteria 33267
258 Ga0207683_10029743 3300026121 Bacteria 4730
259 Ga0207698_10024666 3300026142 Bacteria 4225
260 Ga0207698_10084263 3300026142 Bacteria 2576
261 Ga0207428_10000536 3300027907 Bacteria 45269
262 Ga0207428_10144766 3300027907 Bacteria 1812
263 Ga0268266_10125100 3300028379 Bacteria 2293
264 Ga0268265_10429580 3300028380 Bacteria 1229
265 Ga0268265_10809231 3300028380 Bacteria 914
266 Ga0268264_10083396 3300028381 Bacteria 2738
267 Ga0268264_10201932 3300028381 Bacteria 1819
268 Ga0307408_100452363 3300031548 Bacteria 1114
269 Ga0307412_10081596 3300031911 Bacteria 2237
270 Ga0307409_100295095 3300031995 Bacteria 1505
271 Ga0307409_100397048 3300031995 Bacteria 1316
272 Ga0307416_100003646 3300032002 Bacteria 9102
273 Ga0307416_100160851 3300032002 Bacteria 2075
274 Ga0307415_100000337 3300032126 Bacteria 20222
275 Ga0373941_0038176 3300035115 Bacteria 1469
276 Ga0373931_0429161 3300035691 Bacteria 842
277 Ga0373935_0120982 3300035692 Unclassified 1749
278 Ga0373935_0202760 3300035692 Bacteria 1371
279 Ga0373935_0274716 3300035692 Unclassified 1185
280 Ga0373947_0116553 3300035725 Bacteria 1694
281 Ga0373947_0324660 3300035725 Bacteria 1030
282 Ga0373947_0607345 3300035725 Bacteria 745
283 Ga0373925_0087311 3300037068 Bacteria 2381
284 Ga0395899_0016012 3300037312 Bacteria 5718
285 Ga0395899_0017934 3300037312 Bacteria 5386
286 Ga0395899_0025447 3300037312 Bacteria 4468
287 Ga0395899_0033236 3300037312 Bacteria 3874
288 Ga0395899_0100859 3300037312 Bacteria 2084
289 Ga0395899_0128772 3300037312 Bacteria 1809
290 Ga0395899_0180273 3300037312 Bacteria 1483
291 Ga0395899_0250542 3300037312 Bacteria 1215
292 Ga0395899_0717465 3300037312 Bacteria 625
293 Ga0395900_0001791 3300037418 Bacteria 24637
294 Ga0395900_0002072 3300037418 Bacteria 22505
295 Ga0395900_0007340 3300037418 Bacteria 11400
296 Ga0395900_0009877 3300037418 Bacteria 9775
297 Ga0395900_0028613 3300037418 Bacteria 5711
298 Ga0395900_0033029 3300037418 Bacteria 5326
299 Ga0395900_0070415 3300037418 Bacteria 3595
300 Ga0395900_0149566 3300037418 Bacteria 2386
301 Ga0395900_0250042 3300037418 Bacteria 1774
302 Ga0395900_0276823 3300037418 Bacteria 1671
303 Ga0395900_0613301 3300037418 Bacteria 1027
304 Ga0395900_0627029 3300037418 Bacteria 1013
305 Ga0395900_0760898 3300037418 Bacteria 898
306 Ga0395900_0775696 3300037418 Bacteria 888
307 Ga0395900_0836957 3300037418 Bacteria 846
308 Ga0395900_1351357 3300037418 Bacteria 626
309 Ga0395898_0001986 3300037466 Bacteria 25723
310 Ga0395898_0004603 3300037466 Bacteria 15058
311 Ga0395898_0015283 3300037466 Bacteria 7876
312 Ga0395898_0022640 3300037466 Bacteria 6362
313 Ga0395898_0024775 3300037466 Bacteria 6049
314 Ga0395898_0042756 3300037466 Bacteria 4469
315 Ga0395898_0081905 3300037466 Bacteria 3111
316 Ga0395898_0138050 3300037466 Bacteria 2334
317 Ga0395898_0276709 3300037466 Bacteria 1601
318 Ga0395898_0349595 3300037466 Bacteria 1410
319 Ga0395898_0780036 3300037466 Bacteria 896
320 Ga0395898_0952163 3300037466 Bacteria 795
321 Ga0395905_0002836 3300037471 Bacteria 18983
322 Ga0395905_0003878 3300037471 Bacteria 15779
323 Ga0395905_0007962 3300037471 Bacteria 10478
324 Ga0395905_0008903 3300037471 Bacteria 9860
325 Ga0395905_0035450 3300037471 Bacteria 4685
326 Ga0395905_0072997 3300037471 Bacteria 3216
327 Ga0395905_0129833 3300037471 Bacteria 2370
328 Ga0395905_0160720 3300037471 Bacteria 2111
329 Ga0395905_0661561 3300037471 Bacteria 946
330 Ga0395905_0893172 3300037471 Bacteria 791
331 Ga0395901_0001774 3300038443 Bacteria 22253
332 Ga0395901_0012910 3300038443 Bacteria 8472
333 Ga0395901_0020180 3300038443 Bacteria 6820
334 Ga0395901_0023176 3300038443 Bacteria 6364
335 Ga0395901_0028303 3300038443 Bacteria 5764
336 Ga0395901_0038841 3300038443 Bacteria 4923
337 Ga0395901_0065959 3300038443 Bacteria 3770
338 Ga0395901_0069452 3300038443 Bacteria 3669
339 Ga0395901_0087314 3300038443 Bacteria 3261
340 Ga0395901_0092634 3300038443 Bacteria 3163
341 Ga0395901_0122389 3300038443 Bacteria 2734
342 Ga0395901_0152848 3300038443 Bacteria 2424
343 Ga0395901_0248600 3300038443 Bacteria 1853
344 Ga0395901_0866100 3300038443 Bacteria 887
345 Ga0395901_0866798 3300038443 Bacteria 887
346 Ga0439438_039104 3300041405 Bacteria 1237
347 Ga0439445_0053354 3300042004 Bacteria 1095
348 Ga0439434_0008004 3300042435 Bacteria 3097
349 Ga0495603_0010232 3300046455 Bacteria 5678
350 Ga0495603_0042602 3300046455 Bacteria 2713
351 Ga0495603_0042763 3300046455 Bacteria 2708
352 Ga0495603_0153623 3300046455 Bacteria 1336
353 Ga0495603_0211357 3300046455 Bacteria 1120
354 Ga0495590_0194597 3300046457 Bacteria 744
355 Ga0495641_0022666 3300046461 Unclassified 3136
356 Ga0495641_0045517 3300046461 Bacteria 2020
357 Ga0495641_0054181 3300046461 Bacteria 1823
358 Ga0495641_0087049 3300046461 Bacteria 1398
359 Ga0495580_0505610 3300046472 Bacteria 806
360 Ga0495582_0008170 3300046473 Bacteria 5777
361 Ga0495582_0046457 3300046473 Bacteria 2391
362 Ga0495582_0050178 3300046473 Bacteria 2299
363 Ga0495582_0052024 3300046473 Bacteria 2259
364 Ga0495582_0088371 3300046473 Bacteria 1726
365 Ga0495605_0141509 3300046474 Bacteria 1079
366 Ga0495639_0029577 3300046475 Unclassified 2432
367 Ga0495639_0065584 3300046475 Bacteria 1670
368 Ga0495584_0032978 3300046491 Bacteria 2620
369 Ga0495584_0068803 3300046491 Bacteria 1779
370 Ga0495584_0153619 3300046491 Bacteria 1169
371 Ga0495584_0325403 3300046491 Bacteria 781
372 Ga0495594_0061634 3300046499 Bacteria 2076
373 Ga0495596_0018413 3300046500 Bacteria 2879
374 Ga0495596_0096624 3300046500 Unclassified 1147
375 Ga0495607_0383556 3300046501 Bacteria 642
376 Ga0495616_0041965 3300046513 Bacteria 2331
377 Ga0495618_0406078 3300046514 Bacteria 832
378 Ga0495630_0479672 3300046517 Unclassified 953
379 Ga0495631_0079747 3300046518 Bacteria 1413
380 Ga0495663_0019891 3300046525 Unclassified 1925
381 Ga0495642_0054626 3300046528 Unclassified 1647
382 Ga0495665_0036930 3300046531 Bacteria 2608
383 Ga0495665_0060583 3300046531 Unclassified 1998
384 Ga0495598_0076769 3300046537 Bacteria 1064
385 Ga0495598_0112640 3300046537 Bacteria 914
386 Ga0495656_0195163 3300046615 Bacteria 1002
387 Ga0495656_0204580 3300046615 Bacteria 981
388 Ga0495656_0242835 3300046615 Bacteria 907
389 Ga0495635_0317605 3300046663 Bacteria 1043
390 Ga0495659_0013152 3300046664 Bacteria 2692
391 Ga0495659_0058745 3300046664 Bacteria 1416
392 Ga0495588_0011717 3300046674 Bacteria 4122
393 Ga0495588_0141106 3300046674 Bacteria 1273
394 Ga0495588_0217225 3300046674 Bacteria 1009
395 Ga0495647_0109625 3300046681 Bacteria 1151
396 Ga0495647_0149218 3300046681 Bacteria 1001
397 Ga0495658_0027818 3300046683 Bacteria 3046
398 Ga0495658_0071690 3300046683 Bacteria 2013
399 Ga0495613_0023422 3300046689 Bacteria 4600
400 Ga0495613_0187011 3300046689 Unclassified 1465
401 Ga0495624_0061663 3300046690 Bacteria 2349
402 Ga0495589_0036432 3300046794 Bacteria 2466
403 Ga0495581_0003346 3300047315 Bacteria 9210
404 Ga0495581_0004944 3300047315 Bacteria 7715
405 Ga0495581_0100696 3300047315 Bacteria 1678
406 Ga0495581_0434876 3300047315 Bacteria 764
407 Ga0495636_0069024 3300047318 Bacteria 1506
408 Ga0495676_0043546 3300047321 Bacteria 3671
409 Ga0495676_0051111 3300047321 Bacteria 3309
410 Ga0495676_0080259 3300047321 Bacteria 2478
411 Ga0495676_0115433 3300047321 Bacteria 1963
412 Ga0495677_0031837 3300047445 Bacteria 1920
413 Ga0496100_0004515 3300048903 Bacteria 7390
414 Ga0496101_0012099 3300048904 Bacteria 5751
415 Ga0496101_0040326 3300048904 Bacteria 3325
416 Ga0496101_0408643 3300048904 Bacteria 1069
417 Ga0496102_0003640 3300048905 Bacteria 13031
418 Ga0496102_0026127 3300048905 Bacteria 5204
419 Ga0496103_0002529 3300048906 Bacteria 11459
420 Ga0496103_0037900 3300048906 Bacteria 2956
421 Ga0496104_0024087 3300048907 Bacteria 5601
422 Ga0496104_0073571 3300048907 Bacteria 3251
423 Ga0496104_0079456 3300048907 Bacteria 3126
424 Ga0496104_0111531 3300048907 Bacteria 2622
425 Ga0496105_0005517 3300048908 Bacteria 9601
426 Ga0496105_0033994 3300048908 Bacteria 4191
427 Ga0496105_0050761 3300048908 Bacteria 3427
428 Ga0496105_0064957 3300048908 Bacteria 3012
429 Ga0496106_0000909 3300048909 Bacteria 21550
430 Ga0496106_0015697 3300048909 Bacteria 5603
431 Ga0496106_0041996 3300048909 Bacteria 3428
432 Ga0496107_0004522 3300048910 Bacteria 9421
433 Ga0496107_0006455 3300048910 Bacteria 8065
434 Ga0496108_0132634 3300048911 Bacteria 2141
435 Ga0496108_0208793 3300048911 Bacteria 1695
436 Ga0496109_0045034 3300048912 Bacteria 4004
437 Ga0496109_0094429 3300048912 Bacteria 2768
438 Ga0496110_0224292 3300048913 Bacteria 1709
439 Ga0496111_0047613 3300048914 Bacteria 3088
440 Ga0496111_0187408 3300048914 Unclassified 1538
441 Ga0496111_0500055 3300048914 Bacteria 895
442 Ga0496111_0604512 3300048914 Bacteria 803
443 Ga0496112_0008919 3300048915 Bacteria 9002
444 Ga0496112_0054971 3300048915 Bacteria 3912
445 Ga0496112_0609117 3300048915 Bacteria 1024
446 Ga0496113_0065291 3300048916 Bacteria 2754
447 Ga0496113_0256676 3300048916 Bacteria 1396
448 Ga0496114_0004323 3300048917 Bacteria 10994
449 Ga0496114_0050549 3300048917 Bacteria 3460
450 Ga0496114_0071486 3300048917 Bacteria 2916
451 Ga0496114_0389372 3300048917 Bacteria 1234
452 Ga0496115_0004519 3300048918 Bacteria 10061
453 Ga0496115_0041516 3300048918 Bacteria 3661
454 Ga0496115_0118638 3300048918 Bacteria 2176
455 Ga0496126_0805954 3300048929 Bacteria 720
456 Ga0501031_0002949 3300049568 Bacteria 10889
457 Ga0501031_0010365 3300049568 Bacteria 6069
458 Ga0501031_0024701 3300049568 Bacteria 3917
459 Ga0501032_0003494 3300049569 Bacteria 12015
460 Ga0501032_0052585 3300049569 Bacteria 2744
461 Ga0501033_0000208 3300049570 Bacteria 56046
462 Ga0501033_0025623 3300049570 Bacteria 4443
463 Ga0501033_0037415 3300049570 Bacteria 3632
464 Ga0501033_0460247 3300049570 Bacteria 883
465 Ga0501033_0699473 3300049570 Bacteria 690
466 Ga0501034_0007404 3300049571 Bacteria 11685
467 Ga0501034_1025812 3300049571 Bacteria 708
468 Ga0501036_0000085 3300049572 Bacteria 58421
469 Ga0501036_0003245 3300049572 Bacteria 12965
470 Ga0501036_0024163 3300049572 Bacteria 5122
471 Ga0501036_0031210 3300049572 Bacteria 4502
472 Ga0501036_0078804 3300049572 Bacteria 2786
473 Ga0501036_0128551 3300049572 Bacteria 2139
474 Ga0501037_0001998 3300049573 Bacteria 14799
475 Ga0501037_0022575 3300049573 Bacteria 4654
476 Ga0501037_0092400 3300049573 Bacteria 2188
477 Ga0501037_0411650 3300049573 Bacteria 926
478 Ga0501038_0019326 3300049574 Bacteria 6144
479 Ga0501038_0021979 3300049574 Bacteria 5721
480 Ga0501038_0036559 3300049574 Bacteria 4309
481 Ga0501038_0074838 3300049574 Bacteria 2864
482 Ga0501038_0146510 3300049574 Bacteria 1927
483 Ga0501038_0335420 3300049574 Bacteria 1180
484 Ga0501039_0000171 3300049575 Bacteria 45473
485 Ga0501039_0006841 3300049575 Bacteria 8675
486 Ga0501039_0022482 3300049575 Bacteria 4840
487 Ga0501039_0029387 3300049575 Bacteria 4233
488 Ga0501039_0055992 3300049575 Bacteria 3054
489 Ga0501039_0223141 3300049575 Bacteria 1481
490 Ga0501039_0347988 3300049575 Bacteria 1165
491 Ga0501040_0000094 3300049576 Bacteria 44554
492 Ga0501040_0007610 3300049576 Bacteria 7011
493 Ga0501040_0014951 3300049576 Bacteria 5125
494 Ga0501040_0028446 3300049576 Bacteria 3769
495 Ga0501040_0072078 3300049576 Bacteria 2385
496 Ga0501040_0207345 3300049576 Bacteria 1393
497 Ga0501041_0003831 3300049577 Bacteria 8661
498 Ga0501041_0004209 3300049577 Bacteria 8326
499 Ga0501041_0011577 3300049577 Bacteria 5218
500 Ga0501041_0014221 3300049577 Bacteria 4725
501 Ga0501041_0024321 3300049577 Bacteria 3635
502 Ga0501041_0034222 3300049577 Bacteria 3075
503 Ga0501041_0286807 3300049577 Bacteria 1036
504 Ga0501041_0412648 3300049577 Bacteria 856
505 Ga0501042_0001242 3300049578 Bacteria 14860
506 Ga0501042_0004579 3300049578 Bacteria 8826
507 Ga0501042_0019571 3300049578 Bacteria 4703
508 Ga0501042_0022773 3300049578 Bacteria 4377
509 Ga0501042_0083670 3300049578 Bacteria 2287
510 Ga0501042_0210385 3300049578 Bacteria 1403
511 Ga0501042_0284435 3300049578 Bacteria 1194
512 Ga0501043_0000295 3300049579 Bacteria 45082
513 Ga0501043_0034370 3300049579 Bacteria 3987
514 Ga0501043_0138415 3300049579 Bacteria 1907
515 Ga0501043_0298250 3300049579 Bacteria 1232
516 Ga0501046_0000999 3300049580 Bacteria 27627
517 Ga0501046_0008252 3300049580 Bacteria 9093
518 Ga0501046_0034637 3300049580 Bacteria 4073
519 Ga0501046_0039040 3300049580 Bacteria 3805
520 Ga0501046_0056277 3300049580 Bacteria 3088
521 Ga0501046_0078414 3300049580 Bacteria 2555
522 Ga0501046_0090895 3300049580 Bacteria 2348
523 Ga0501047_0001721 3300049581 Bacteria 21277
524 Ga0501047_0310157 3300049581 Bacteria 1418
525 Ga0501047_0522343 3300049581 Bacteria 1013
526 Ga0501048_0000212 3300049582 Bacteria 38029
527 Ga0501048_0001705 3300049582 Bacteria 16761
528 Ga0501048_0008060 3300049582 Bacteria 7977
529 Ga0501048_0010970 3300049582 Bacteria 6759
530 Ga0501048_0013342 3300049582 Bacteria 6097
531 Ga0501048_0035911 3300049582 Bacteria 3565
532 Ga0501048_0140096 3300049582 Bacteria 1710
533 Ga0501048_0430397 3300049582 Bacteria 944
534 Ga0501067_0030485 3300049583 Bacteria 2991
535 Ga0501067_0052297 3300049583 Bacteria 2263
536 Ga0501068_0000052 3300049584 Bacteria 45484
537 Ga0501068_0009191 3300049584 Bacteria 5521
538 Ga0501068_0054451 3300049584 Bacteria 2423
539 Ga0501068_0056211 3300049584 Bacteria 2386
540 Ga0501068_0078343 3300049584 Bacteria 2025
541 Ga0501068_0325606 3300049584 Bacteria 985
542 Ga0501069_0000542 3300049585 Bacteria 17276
543 Ga0501069_0007975 3300049585 Bacteria 5560
544 Ga0501069_0028392 3300049585 Bacteria 3067
545 Ga0501069_0288549 3300049585 Bacteria 961
546 Ga0501070_0001060 3300049586 Bacteria 24749
547 Ga0501070_0006669 3300049586 Bacteria 9831
548 Ga0501070_0028091 3300049586 Bacteria 4717
549 Ga0501071_0001124 3300049587 Bacteria 14927
550 Ga0501071_0002813 3300049587 Bacteria 10710
551 Ga0501071_0004755 3300049587 Bacteria 8645
552 Ga0501071_0009237 3300049587 Bacteria 6557
553 Ga0501071_0015940 3300049587 Bacteria 5163
554 Ga0501071_0056179 3300049587 Bacteria 2842
555 Ga0501071_0077477 3300049587 Bacteria 2428
556 Ga0501071_0134870 3300049587 Bacteria 1836
557 Ga0501072_0000072 3300049588 Bacteria 72875
558 Ga0501072_0003239 3300049588 Bacteria 12221
559 Ga0501072_0024426 3300049588 Bacteria 4701
560 Ga0501072_0029627 3300049588 Bacteria 4276
561 Ga0501072_0054718 3300049588 Bacteria 3144
562 Ga0501072_0102247 3300049588 Bacteria 2278
563 Ga0501072_0148131 3300049588 Bacteria 1871
564 Ga0501072_0204309 3300049588 Bacteria 1575
565 Ga0501072_0407352 3300049588 Bacteria 1078
566 Ga0501073_0002604 3300049589 Bacteria 13504
567 Ga0501073_0025215 3300049589 Bacteria 4267
568 Ga0501073_0074420 3300049589 Bacteria 2364
569 Ga0501073_0139504 3300049589 Bacteria 1680
570 Ga0501074_0008516 3300049590 Bacteria 7430
571 Ga0501074_0012433 3300049590 Bacteria 6187
572 Ga0501074_0013431 3300049590 Bacteria 5954
573 Ga0501074_0046305 3300049590 Bacteria 3144
574 Ga0501074_0108726 3300049590 Bacteria 1984
575 Ga0501075_0000109 3300049591 Bacteria 38985
576 Ga0501075_0004222 3300049591 Bacteria 9708
577 Ga0501075_0018666 3300049591 Bacteria 5022
578 Ga0501075_0038743 3300049591 Bacteria 3564
579 Ga0501075_0113366 3300049591 Bacteria 2061
580 Ga0501076_0000554 3300049592 Bacteria 23855
581 Ga0501076_0010496 3300049592 Bacteria 6874
582 Ga0501076_0010994 3300049592 Bacteria 6730
583 Ga0501076_0011031 3300049592 Bacteria 6719
584 Ga0501076_0014933 3300049592 Bacteria 5860
585 Ga0501076_0022334 3300049592 Bacteria 4863
586 Ga0501076_0022608 3300049592 Bacteria 4834
587 Ga0501076_0782237 3300049592 Bacteria 787
588 Ga0501077_0000809 3300049593 Bacteria 18979
589 Ga0501077_0006994 3300049593 Bacteria 6953
590 Ga0501077_0033016 3300049593 Bacteria 3295
591 Ga0501077_0033947 3300049593 Bacteria 3247
592 Ga0501077_0038727 3300049593 Bacteria 3037
593 Ga0501077_0049873 3300049593 Bacteria 2660
594 Ga0501077_0291313 3300049593 Bacteria 1039
595 Ga0501079_0000099 3300049741 Bacteria 43513
596 Ga0501079_0008226 3300049741 Bacteria 7906
597 Ga0501079_0024980 3300049741 Bacteria 4583
598 Ga0501079_0055896 3300049741 Bacteria 3045
599 Ga0501079_0211588 3300049741 Bacteria 1514
600 Ga0501079_0260480 3300049741 Bacteria 1355
601 Ga0501079_0266329 3300049741 Bacteria 1339
602 Ga0501080_0051601 3300049742 Bacteria 3827
603 Ga0501080_0063926 3300049742 Bacteria 3424
604 Ga0501080_0065679 3300049742 Bacteria 3375
605 Ga0501080_0107814 3300049742 Bacteria 2581
606 Ga0501080_0110863 3300049742 Bacteria 2543
607 Ga0501080_0129243 3300049742 Bacteria 2338
608 Ga0501080_0478487 3300049742 Bacteria 1114
609 Ga0501081_0001992 3300049743 Bacteria 12738
610 Ga0501081_0009326 3300049743 Bacteria 6394
611 Ga0501081_0010341 3300049743 Bacteria 6091
612 Ga0501081_0060521 3300049743 Bacteria 2624
613 Ga0501081_0061001 3300049743 Bacteria 2614
614 Ga0501081_0071037 3300049743 Bacteria 2426
615 Ga0501081_0126758 3300049743 Bacteria 1821
616 Ga0501081_0142548 3300049743 Bacteria 1718
617 Ga0501081_0148744 3300049743 Bacteria 1681
618 Ga0501083_0001781 3300049744 Bacteria 14716
619 Ga0501083_0026883 3300049744 Bacteria 3975
620 Ga0501083_0077849 3300049744 Bacteria 2200
621 Ga0501035_0001297 3300049822 Bacteria 25816
622 Ga0501035_0002978 3300049822 Bacteria 16287
623 Ga0501035_0013570 3300049822 Bacteria 7518
624 Ga0501035_0023004 3300049822 Bacteria 5720
625 Ga0501035_0147874 3300049822 Bacteria 2040
626 Ga0501035_0722147 3300049822 Bacteria 802
627 Ga0501044_0021292 3300049823 Bacteria 6919
628 Ga0501044_0026520 3300049823 Bacteria 6133
629 Ga0501044_0087411 3300049823 Bacteria 3148
630 Ga0501044_0593536 3300049823 Bacteria 1001
631 Ga0501045_0002382 3300049824 Bacteria 12761
632 Ga0501045_0003471 3300049824 Bacteria 10789
633 Ga0501045_0008005 3300049824 Bacteria 7363
634 Ga0501045_0009225 3300049824 Bacteria 6897
635 Ga0501045_0036104 3300049824 Bacteria 3588
636 Ga0501045_0043354 3300049824 Bacteria 3276
637 Ga0501045_0043537 3300049824 Bacteria 3269
638 Ga0501045_0085425 3300049824 Bacteria 2329
639 nmdc:mga05p37_1267279_c1 3300050507 Bacteria 755
640 nmdc:mga05p37_2685_c1 3300050507 Bacteria 20688
641 nmdc:mga05p37_676826_c1 3300050507 Bacteria 1151
642 nmdc:mga05p37_833064_c1 3300050507 Bacteria 1004
643 nmdc:mga09592_545113_c1 3300050508 Bacteria 996
644 nmdc:mga09592_577611_c1 3300050508 Bacteria 964
645 nmdc:mga09592_8889_c1 3300050508 Bacteria 8167
646 nmdc:mga0qj67_107716_c1 3300050509 Bacteria 2248
647 nmdc:mga08y16_326172_c1 3300050511 Bacteria 1580
648 nmdc:mga08y16_459097_c1 3300050511 Bacteria 1298
649 nmdc:mga08y16_7755_c1 3300050511 Bacteria 11244
650 nmdc:mga0n895_362118_c1 3300050512 Bacteria 1468
651 nmdc:mga0a205_303837_c1 3300050515 Bacteria 1468
652 nmdc:mga0a205_30887_c1 3300050515 Bacteria 5131
653 nmdc:mga0a205_456151_c1 3300050515 Bacteria 1138
654 Ga0495601_0003546 3300053077 Bacteria 8972
655 Ga0495612_0001908 3300053078 Bacteria 8579
656 Ga0495655_0008712 3300053083 Bacteria 1939
657 Ga0495595_0127070 3300053084 Bacteria 1244
658 Ga0495595_0207442 3300053084 Bacteria 976
659 Ga0495619_0057932 3300053085 Bacteria 2571
660 Ga0501084_0001093 3300054114 Bacteria 21105
661 Ga0501084_0014311 3300054114 Bacteria 6572
662 Ga0501084_0021204 3300054114 Bacteria 5418
663 Ga0501084_0029568 3300054114 Bacteria 4583
664 Ga0501084_0037986 3300054114 Bacteria 4024
665 Ga0501084_0057619 3300054114 Bacteria 3250
666 Ga0501084_0059559 3300054114 Bacteria 3196
667 Ga0501084_0071760 3300054114 Bacteria 2900
668 Ga0501084_0159426 3300054114 Bacteria 1903
669 Ga0501082_0000655 3300060353 Bacteria 30539
670 Ga0501082_0031374 3300060353 Bacteria 4581
671 Ga0501082_0034568 3300060353 Bacteria 4356
672 Ga0501082_0126594 3300060353 Bacteria 2215
673 Ga0501082_0157430 3300060353 Bacteria 1973
674 Ga0501082_0187895 3300060353 Bacteria 1797
675 Ga0530510_0003150 3300061734 Bacteria 11326
676 Ga0530510_0005743 3300061734 Bacteria 8596
677 Ga0530510_0008670 3300061734 Bacteria 7106
678 Ga0530510_0025673 3300061734 Bacteria 4213
679 Ga0530510_0030971 3300061734 Bacteria 3844
680 Ga0530510_0066171 3300061734 Bacteria 2619
681 Ga0530510_0218910 3300061734 Bacteria 1415
682 Ga0530510_0591041 3300061734 Bacteria 844
683 2852679567 2852677369 Bacteria 3768884
684 2857720216 2857720070 Bacteria 3189373
685 2928091946 2928090899 Bacteria 3158267
686 Ga0307406_10033049
687 2214737450
688 ARCol0yngRDRAFT_1004541
689 JGI24742J22300_10010015
690 JGI24742J22300_10027888
691 JGI25407J50210_10006502
692 Ga0070676_10414336
693 Ga0070683_100096504
694 Ga0070683_100685576
695 Ga0070683_100705827
696 Ga0070683_100731223
697 Ga0070690_100220631
698 Ga0068869_100271021
699 Ga0070680_100072186
700 Ga0070682_100024068
701 Ga0070682_100241624
702 Ga0068868_100157956
703 Ga0070660_100079336
704 Ga0070689_100045667
705 Ga0070691_10057287
706 Ga0070687_100566686
707 Ga0070661_101094464
708 Ga0070692_10030160
709 Ga0070692_10243671
710 Ga0070668_100072621
711 Ga0070668_101134083
712 Ga0070671_100141005
713 Ga0070671_100226950
714 Ga0070674_100076053
715 Ga0070674_100467047
716 Ga0070688_100007933
717 Ga0070659_100082858
718 Ga0070709_10022813
719 Ga0070709_10497454
720 Ga0070714_100028631
721 Ga0070714_100405791
722 Ga0070713_100003604
723 Ga0070713_100379486
724 Ga0070710_10004250
725 Ga0070710_10772600
726 Ga0070711_100139850
727 Ga0070711_100989509
728 Ga0070705_100010591
729 Ga0070705_100097030
730 Ga0070705_100824952
731 Ga0070700_100001973
732 Ga0070694_100096438
733 Ga0070694_100249847
734 Ga0070708_100009720
735 Ga0070708_100016741
736 Ga0070708_100269088
737 Ga0070663_100117302
738 Ga0070663_100147577
739 Ga0070663_100548430
740 Ga0070678_100001257
741 Ga0070678_100003776
742 Ga0070662_100081937
743 Ga0070681_10087496
744 Ga0070681_10220040
745 Ga0068867_100002991
746 Ga0068867_100030029
747 Ga0070685_10001367
748 Ga0070706_100037504
749 Ga0070707_100013757
750 Ga0070707_100205038
751 Ga0070707_100308627
752 Ga0070707_100467954
753 Ga0070698_100011998
754 Ga0070698_100216877
755 Ga0070698_100305238
756 Ga0070699_100036286
757 Ga0070699_100308796
758 Ga0070679_100006758
759 Ga0070684_100001756
760 Ga0070697_100330165
761 Ga0070672_100160081
762 Ga0070686_100003662
763 Ga0070686_100017307
764 Ga0070695_100204704
765 Ga0070696_100010694
766 Ga0070693_100019090
767 Ga0070693_100043603
768 Ga0070665_100282510
769 Ga0070704_100041616
770 Ga0068855_100186153
771 Ga0068855_101155719
772 Ga0070664_100502047
773 Ga0068857_100003952
774 Ga0068854_100096921
775 Ga0070702_100001118
776 Ga0070702_100048238
777 Ga0068852_100002120
778 Ga0068852_100914427
779 Ga0068859_100132251
780 Ga0068866_10003386
781 Ga0068866_10021614
782 Ga0068866_10090005
783 Ga0068866_10620235
784 Ga0068866_10712765
785 Ga0068861_100000835
786 Ga0068861_100328249
787 Ga0068858_100196821
788 Ga0068860_100045304
789 Ga0068860_100085495
790 Ga0068862_100743289
791 Ga0081455_10013939
792 Ga0081455_10029119
793 Ga0081455_10421801
794 Ga0081538_10000676
795 Ga0081540_1007225
796 Ga0070717_10207430
797 Ga0075432_10000256
798 Ga0070716_100038686
799 Ga0070716_100064336
800 Ga0070712_100008432
801 Ga0070712_100043180
802 Ga0097621_100027655
803 Ga0097621_100064712
804 Ga0068871_100006996
805 Ga0068871_100422289
806 Ga0068871_100487070
807 Ga0075428_100003661
808 Ga0075428_100221958
809 Ga0075428_100251508
810 Ga0075428_100432560
811 Ga0075433_10076841
812 Ga0075434_100569579
813 Ga0075429_100027667
814 Ga0075429_100400128
815 Ga0068865_100020257
816 Ga0068865_100032914
817 Ga0097620_100132253
818 Ga0075435_100174683
819 Ga0111539_10159984
820 Ga0111539_10236466
821 Ga0111539_10373815
822 Ga0111539_11241792
823 Ga0105245_10106653
824 Ga0105245_10222041
825 Ga0105245_10228447
826 Ga0105245_10287418
827 Ga0105247_10005193
828 Ga0114129_10001306
829 Ga0114129_10100464
830 Ga0114129_10193391
831 Ga0105243_10002101
832 Ga0105243_10018799
833 Ga0105243_10073201
834 Ga0105243_10478881
835 Ga0105243_11012391
836 Ga0105241_10031254
837 Ga0105242_10003872
838 Ga0105242_10006050
839 Ga0105242_10840318
840 Ga0105242_11279103
841 Ga0105248_10003745
842 Ga0105248_10137648
843 Ga0105237_10731473
844 Ga0105249_10002268
845 Ga0105249_10152982
846 Ga0105239_10027772
847 Ga0105239_10046162
848 Ga0105239_11248209
849 Ga0105246_10337869
850 Ga0157370_10536111
851 Ga0157374_10112114
852 Ga0157378_10002234
853 Ga0157378_10015405
854 Ga0157378_10518083
855 Ga0163162_10010521
856 Ga0163162_10624068
857 Ga0157372_10081512
858 Ga0157375_10567543
859 Ga0157375_10675019
860 Ga0157375_11249307
861 Ga0157380_10135037
862 Ga0157380_10847413
863 Ga0157379_10282950
864 Ga0157376_10058289
865 Ga0163161_10905461
866 Ga0207692_10004664
867 Ga0207642_10002257
868 Ga0207642_10027983
869 Ga0207710_10088798
870 Ga0207688_10043219
871 Ga0207688_10046069
872 Ga0207685_10034334
873 Ga0207685_10192092
874 Ga0207684_10015975
875 Ga0207684_10042274
876 Ga0207654_10282486
877 Ga0207707_10190001
878 Ga0207671_10031469
879 Ga0207693_10240341
880 Ga0207693_10502205
881 Ga0207660_10721573
882 Ga0207662_10187914
883 Ga0207657_10070856
884 Ga0207657_10210965
885 Ga0207652_10495668
886 Ga0207646_10003166
887 Ga0207646_10349946
888 Ga0207687_10082954
889 Ga0207687_10183520
890 Ga0207687_10315957
891 Ga0207700_10000001
892 Ga0207664_10007480
893 Ga0207664_10620604
894 Ga0207644_10113153
895 Ga0207644_10269453
896 Ga0207690_10009765
897 Ga0207690_10268640
898 Ga0207706_10017695
899 Ga0207706_10025900
900 Ga0207706_10164810
901 Ga0207686_10002915
902 Ga0207686_10011488
903 Ga0207686_10368337
904 Ga0207709_10007420
905 Ga0207709_10035624
906 Ga0207709_10703651
907 Ga0207670_10072894
908 Ga0207669_10004798
909 Ga0207669_10337146
910 Ga0207704_10004162
911 Ga0207704_10032143
912 Ga0207665_10008736
913 Ga0207665_10044506
914 Ga0207691_10092564
915 Ga0207711_10055710
916 Ga0207689_10439086
917 Ga0207661_10041201
918 Ga0207679_10184649
919 Ga0207667_11033882
920 Ga0207712_10018688
921 Ga0207712_10437367
922 Ga0207668_10037468
923 Ga0207668_10054335
924 Ga0207668_10128109
925 Ga0207640_10544147
926 Ga0207640_11185333
927 Ga0207658_10128199
928 Ga0207677_10006932
929 Ga0207677_11425208
930 Ga0207703_10034951
931 Ga0207678_10007583
932 Ga0207678_10243650
933 Ga0207708_10000352
934 Ga0207708_10021692
935 Ga0207702_10005699
936 Ga0207702_10024434
937 Ga0207648_10000454
938 Ga0207648_10033192
939 Ga0207674_10000884
940 Ga0207675_100005637
941 Ga0207683_10000215
942 Ga0207683_10000598
943 Ga0207683_10029743
944 Ga0207698_10024666
945 Ga0207698_10084263
946 Ga0207428_10000536
947 Ga0207428_10144766
948 Ga0268266_10125100
949 Ga0268265_10429580
950 Ga0268265_10809231
951 Ga0268264_10083396
952 Ga0268264_10201932
953 Ga0307408_100452363
954 Ga0307412_10081596
955 Ga0307409_100295095
956 Ga0307409_100397048
957 Ga0307416_100003646
958 Ga0307416_100160851
959 Ga0307415_100000337
960 Ga0373941_0038176
961 Ga0373931_0429161
962 Ga0373935_0120982
963 Ga0373935_0202760
964 Ga0373935_0274716
965 Ga0373947_0116553
966 Ga0373947_0324660
967 Ga0373947_0607345
968 Ga0373925_0087311
969 Ga0395899_0016012
970 Ga0395899_0017934
971 Ga0395899_0025447
972 Ga0395899_0033236
973 Ga0395899_0100859
974 Ga0395899_0128772
975 Ga0395899_0180273
976 Ga0395899_0250542
977 Ga0395899_0717465
978 Ga0395900_0001791
979 Ga0395900_0002072
980 Ga0395900_0007340
981 Ga0395900_0009877
982 Ga0395900_0028613
983 Ga0395900_0033029
984 Ga0395900_0070415
985 Ga0395900_0149566
986 Ga0395900_0250042
987 Ga0395900_0276823
988 Ga0395900_0613301
989 Ga0395900_0627029
990 Ga0395900_0760898
991 Ga0395900_0775696
992 Ga0395900_0836957
993 Ga0395900_1351357
994 Ga0395898_0001986
995 Ga0395898_0004603
996 Ga0395898_0015283
997 Ga0395898_0022640
998 Ga0395898_0024775
999 Ga0395898_0042756
1000 Ga0395898_0081905
1001 Ga0395898_0138050
1002 Ga0395898_0276709
1003 Ga0395898_0349595
1004 Ga0395898_0780036
1005 Ga0395898_0952163
1006 Ga0395905_0002836
1007 Ga0395905_0003878
1008 Ga0395905_0007962
1009 Ga0395905_0008903
1010 Ga0395905_0035450
1011 Ga0395905_0072997
1012 Ga0395905_0129833
1013 Ga0395905_0160720
1014 Ga0395905_0661561
1015 Ga0395905_0893172
1016 Ga0395901_0001774
1017 Ga0395901_0012910
1018 Ga0395901_0020180
1019 Ga0395901_0023176
1020 Ga0395901_0028303
1021 Ga0395901_0038841
1022 Ga0395901_0065959
1023 Ga0395901_0069452
1024 Ga0395901_0087314
1025 Ga0395901_0092634
1026 Ga0395901_0122389
1027 Ga0395901_0152848
1028 Ga0395901_0248600
1029 Ga0395901_0866100
1030 Ga0395901_0866798
1031 Ga0439438_039104
1032 Ga0439445_0053354
1033 Ga0439434_0008004
1034 Ga0495603_0010232
1035 Ga0495603_0042602
1036 Ga0495603_0042763
1037 Ga0495603_0153623
1038 Ga0495603_0211357
1039 Ga0495590_0194597
1040 Ga0495641_0022666
1041 Ga0495641_0045517
1042 Ga0495641_0054181
1043 Ga0495641_0087049
1044 Ga0495580_0505610
1045 Ga0495582_0008170
1046 Ga0495582_0046457
1047 Ga0495582_0050178
1048 Ga0495582_0052024
1049 Ga0495582_0088371
1050 Ga0495605_0141509
1051 Ga0495639_0029577
1052 Ga0495639_0065584
1053 Ga0495584_0032978
1054 Ga0495584_0068803
1055 Ga0495584_0153619
1056 Ga0495584_0325403
1057 Ga0495594_0061634
1058 Ga0495596_0018413
1059 Ga0495596_0096624
1060 Ga0495607_0383556
1061 Ga0495616_0041965
1062 Ga0495618_0406078
1063 Ga0495630_0479672
1064 Ga0495631_0079747
1065 Ga0495663_0019891
1066 Ga0495642_0054626
1067 Ga0495665_0036930
1068 Ga0495665_0060583
1069 Ga0495598_0076769
1070 Ga0495598_0112640
1071 Ga0495656_0195163
1072 Ga0495656_0204580
1073 Ga0495656_0242835
1074 Ga0495635_0317605
1075 Ga0495659_0013152
1076 Ga0495659_0058745
1077 Ga0495588_0011717
1078 Ga0495588_0141106
1079 Ga0495588_0217225
1080 Ga0495647_0109625
1081 Ga0495647_0149218
1082 Ga0495658_0027818
1083 Ga0495658_0071690
1084 Ga0495613_0023422
1085 Ga0495613_0187011
1086 Ga0495624_0061663
1087 Ga0495589_0036432
1088 Ga0495581_0003346
1089 Ga0495581_0004944
1090 Ga0495581_0100696
1091 Ga0495581_0434876
1092 Ga0495636_0069024
1093 Ga0495676_0043546
1094 Ga0495676_0051111
1095 Ga0495676_0080259
1096 Ga0495676_0115433
1097 Ga0495677_0031837
1098 Ga0496100_0004515
1099 Ga0496101_0012099
1100 Ga0496101_0040326
1101 Ga0496101_0408643
1102 Ga0496102_0003640
1103 Ga0496102_0026127
1104 Ga0496103_0002529
1105 Ga0496103_0037900
1106 Ga0496104_0024087
1107 Ga0496104_0073571
1108 Ga0496104_0079456
1109 Ga0496104_0111531
1110 Ga0496105_0005517
1111 Ga0496105_0033994
1112 Ga0496105_0050761
1113 Ga0496105_0064957
1114 Ga0496106_0000909
1115 Ga0496106_0015697
1116 Ga0496106_0041996
1117 Ga0496107_0004522
1118 Ga0496107_0006455
1119 Ga0496108_0132634
1120 Ga0496108_0208793
1121 Ga0496109_0045034
1122 Ga0496109_0094429
1123 Ga0496110_0224292
1124 Ga0496111_0047613
1125 Ga0496111_0187408
1126 Ga0496111_0500055
1127 Ga0496111_0604512
1128 Ga0496112_0008919
1129 Ga0496112_0054971
1130 Ga0496112_0609117
1131 Ga0496113_0065291
1132 Ga0496113_0256676
1133 Ga0496114_0004323
1134 Ga0496114_0050549
1135 Ga0496114_0071486
1136 Ga0496114_0389372
1137 Ga0496115_0004519
1138 Ga0496115_0041516
1139 Ga0496115_0118638
1140 Ga0496126_0805954
1141 Ga0501031_0002949
1142 Ga0501031_0010365
1143 Ga0501031_0024701
1144 Ga0501032_0003494
1145 Ga0501032_0052585
1146 Ga0501033_0000208
1147 Ga0501033_0025623
1148 Ga0501033_0037415
1149 Ga0501033_0460247
1150 Ga0501033_0699473
1151 Ga0501034_0007404
1152 Ga0501034_1025812
1153 Ga0501036_0000085
1154 Ga0501036_0003245
1155 Ga0501036_0024163
1156 Ga0501036_0031210
1157 Ga0501036_0078804
1158 Ga0501036_0128551
1159 Ga0501037_0001998
1160 Ga0501037_0022575
1161 Ga0501037_0092400
1162 Ga0501037_0411650
1163 Ga0501038_0019326
1164 Ga0501038_0021979
1165 Ga0501038_0036559
1166 Ga0501038_0074838
1167 Ga0501038_0146510
1168 Ga0501038_0335420
1169 Ga0501039_0000171
1170 Ga0501039_0006841
1171 Ga0501039_0022482
1172 Ga0501039_0029387
1173 Ga0501039_0055992
1174 Ga0501039_0223141
1175 Ga0501039_0347988
1176 Ga0501040_0000094
1177 Ga0501040_0007610
1178 Ga0501040_0014951
1179 Ga0501040_0028446
1180 Ga0501040_0072078
1181 Ga0501040_0207345
1182 Ga0501041_0003831
1183 Ga0501041_0004209
1184 Ga0501041_0011577
1185 Ga0501041_0014221
1186 Ga0501041_0024321
1187 Ga0501041_0034222
1188 Ga0501041_0286807
1189 Ga0501041_0412648
1190 Ga0501042_0001242
1191 Ga0501042_0004579
1192 Ga0501042_0019571
1193 Ga0501042_0022773
1194 Ga0501042_0083670
1195 Ga0501042_0210385
1196 Ga0501042_0284435
1197 Ga0501043_0000295
1198 Ga0501043_0034370
1199 Ga0501043_0138415
1200 Ga0501043_0298250
1201 Ga0501046_0000999
1202 Ga0501046_0008252
1203 Ga0501046_0034637
1204 Ga0501046_0039040
1205 Ga0501046_0056277
1206 Ga0501046_0078414
1207 Ga0501046_0090895
1208 Ga0501047_0001721
1209 Ga0501047_0310157
1210 Ga0501047_0522343
1211 Ga0501048_0000212
1212 Ga0501048_0001705
1213 Ga0501048_0008060
1214 Ga0501048_0010970
1215 Ga0501048_0013342
1216 Ga0501048_0035911
1217 Ga0501048_0140096
1218 Ga0501048_0430397
1219 Ga0501067_0030485
1220 Ga0501067_0052297
1221 Ga0501068_0000052
1222 Ga0501068_0009191
1223 Ga0501068_0054451
1224 Ga0501068_0056211
1225 Ga0501068_0078343
1226 Ga0501068_0325606
1227 Ga0501069_0000542
1228 Ga0501069_0007975
1229 Ga0501069_0028392
1230 Ga0501069_0288549
1231 Ga0501070_0001060
1232 Ga0501070_0006669
1233 Ga0501070_0028091
1234 Ga0501071_0001124
1235 Ga0501071_0002813
1236 Ga0501071_0004755
1237 Ga0501071_0009237
1238 Ga0501071_0015940
1239 Ga0501071_0056179
1240 Ga0501071_0077477
1241 Ga0501071_0134870
1242 Ga0501072_0000072
1243 Ga0501072_0003239
1244 Ga0501072_0024426
1245 Ga0501072_0029627
1246 Ga0501072_0054718
1247 Ga0501072_0102247
1248 Ga0501072_0148131
1249 Ga0501072_0204309
1250 Ga0501072_0407352
1251 Ga0501073_0002604
1252 Ga0501073_0025215
1253 Ga0501073_0074420
1254 Ga0501073_0139504
1255 Ga0501074_0008516
1256 Ga0501074_0012433
1257 Ga0501074_0013431
1258 Ga0501074_0046305
1259 Ga0501074_0108726
1260 Ga0501075_0000109
1261 Ga0501075_0004222
1262 Ga0501075_0018666
1263 Ga0501075_0038743
1264 Ga0501075_0113366
1265 Ga0501076_0000554
1266 Ga0501076_0010496
1267 Ga0501076_0010994
1268 Ga0501076_0011031
1269 Ga0501076_0014933
1270 Ga0501076_0022334
1271 Ga0501076_0022608
1272 Ga0501076_0782237
1273 Ga0501077_0000809
1274 Ga0501077_0006994
1275 Ga0501077_0033016
1276 Ga0501077_0033947
1277 Ga0501077_0038727
1278 Ga0501077_0049873
1279 Ga0501077_0291313
1280 Ga0501079_0000099
1281 Ga0501079_0008226
1282 Ga0501079_0024980
1283 Ga0501079_0055896
1284 Ga0501079_0211588
1285 Ga0501079_0260480
1286 Ga0501079_0266329
1287 Ga0501080_0051601
1288 Ga0501080_0063926
1289 Ga0501080_0065679
1290 Ga0501080_0107814
1291 Ga0501080_0110863
1292 Ga0501080_0129243
1293 Ga0501080_0478487
1294 Ga0501081_0001992
1295 Ga0501081_0009326
1296 Ga0501081_0010341
1297 Ga0501081_0060521
1298 Ga0501081_0061001
1299 Ga0501081_0071037
1300 Ga0501081_0126758
1301 Ga0501081_0142548
1302 Ga0501081_0148744
1303 Ga0501083_0001781
1304 Ga0501083_0026883
1305 Ga0501083_0077849
1306 Ga0501035_0001297
1307 Ga0501035_0002978
1308 Ga0501035_0013570
1309 Ga0501035_0023004
1310 Ga0501035_0147874
1311 Ga0501035_0722147
1312 Ga0501044_0021292
1313 Ga0501044_0026520
1314 Ga0501044_0087411
1315 Ga0501044_0593536
1316 Ga0501045_0002382
1317 Ga0501045_0003471
1318 Ga0501045_0008005
1319 Ga0501045_0009225
1320 Ga0501045_0036104
1321 Ga0501045_0043354
1322 Ga0501045_0043537
1323 Ga0501045_0085425
1324 nmdc:mga05p37_1267279_c1
1325 nmdc:mga05p37_2685_c1
1326 nmdc:mga05p37_676826_c1
1327 nmdc:mga05p37_833064_c1
1328 nmdc:mga09592_545113_c1
1329 nmdc:mga09592_577611_c1
1330 nmdc:mga09592_8889_c1
1331 nmdc:mga0qj67_107716_c1
1332 nmdc:mga08y16_326172_c1
1333 nmdc:mga08y16_459097_c1
1334 nmdc:mga08y16_7755_c1
1335 nmdc:mga0n895_362118_c1
1336 nmdc:mga0a205_303837_c1
1337 nmdc:mga0a205_30887_c1
1338 nmdc:mga0a205_456151_c1
1339 Ga0495601_0003546
1340 Ga0495612_0001908
1341 Ga0495655_0008712
1342 Ga0495595_0127070
1343 Ga0495595_0207442
1344 Ga0495619_0057932
1345 Ga0501084_0001093
1346 Ga0501084_0014311
1347 Ga0501084_0021204
1348 Ga0501084_0029568
1349 Ga0501084_0037986
1350 Ga0501084_0057619
1351 Ga0501084_0059559
1352 Ga0501084_0071760
1353 Ga0501084_0159426
1354 Ga0501082_0000655
1355 Ga0501082_0031374
1356 Ga0501082_0034568
1357 Ga0501082_0126594
1358 Ga0501082_0157430
1359 Ga0501082_0187895
1360 Ga0530510_0003150
1361 Ga0530510_0005743
1362 Ga0530510_0008670
1363 Ga0530510_0025673
1364 Ga0530510_0030971
1365 Ga0530510_0066171
1366 Ga0530510_0218910
1367 Ga0530510_0591041
1368 2852679567
1369 2857720216
1370 2928091946

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

4

167

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.9329 2 184
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.9173 2 184
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.913 1 180
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.908 1 180
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8451 1 179
ID Description Score Start End Superfamily
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9329 2 184 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9173 2 184 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.84 1 179 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8264 1 179 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8102 4 179 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A538FUY3-F1-model_v4 Dihydrofolate reductase 0.992 2 180 GO:0008703
GO:0009231
AF-A0A538KY34-F1-model_v4 Dihydrofolate reductase 0.9913 17 180 GO:0008703
GO:0009231
AF-A0A6I2FCZ9-F1-model_v4 Dihydrofolate reductase 0.9731 2 185 GO:0008703
GO:0009231
AF-A0A6I2FU62-F1-model_v4 Dihydrofolate reductase 0.9707 1 181 GO:0008703
GO:0009231
AF-A0A1Q3L9T1-F1-model_v4 Deaminase 0.9687 3 185 GO:0008703
GO:0009231

Map