F475134

General Info

Members Datasets Scaffolds Average Seq Length
685 276 1370 128

Family's Representative Sequence

Representative Sequence 3300026088|Ga0207641_10837701|Ga0207641_108377012
Length 157
Sequence MERPKLSKLELRIMEALWNRETASIRDIQESFPENKRPAYTTVQTTVYRLEGKNAVRRVRKVGNFHVFEAAISRDHAQRKLIDDLLALFGGRTQPVMAHLIESGRLTLARPTAVSAVAAHLGPCRPSVSWKSSSRPGPATARFGGARVLTRRPLHGR

Samples

Sample ID Description Type Environment
1 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
193 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
198 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
199 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
200 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
205 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
214 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
215 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
216 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
217 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
222 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
272 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
275 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 2.77
Rhizosphere 96.5
Stem 0
Stem Tuber 0
Unclassified 28.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207641_10837701 3300026088 Bacteria 911
2 MBSR1b_contig_12914911 2162886012 Unclassified 4437
3 MBSR1b_contig_4530508 2162886012 Unclassified 4385
4 JGI24034J26672_10003990 3300002239 Bacteria 2079
5 JGI24751J29686_10001847 3300002459 Bacteria 4339
6 Ga0065712_10022563 3300005290 Bacteria 1590
7 Ga0065712_10260091 3300005290 Unclassified 939
8 Ga0065712_10362287 3300005290 Bacteria 773
9 Ga0065715_10000727 3300005293 Bacteria 8990
10 Ga0070658_10072002 3300005327 Bacteria 2832
11 Ga0070658_10397567 3300005327 Bacteria 1183
12 Ga0070676_10002083 3300005328 Bacteria 10179
13 Ga0070676_10008624 3300005328 Bacteria 5497
14 Ga0070676_10400110 3300005328 Bacteria 955
15 Ga0070683_100045363 3300005329 Unclassified 4056
16 Ga0070683_100195012 3300005329 Unclassified 1923
17 Ga0070683_100212329 3300005329 Unclassified 1839
18 Ga0070683_100738713 3300005329 Bacteria 943
19 Ga0070690_100039611 3300005330 Bacteria 2977
20 Ga0070690_100062874 3300005330 Bacteria 2394
21 Ga0070670_100008374 3300005331 Bacteria 8816
22 Ga0070670_100138782 3300005331 Bacteria 2102
23 Ga0070670_100244522 3300005331 Bacteria 1562
24 Ga0070670_100352316 3300005331 Bacteria 1293
25 Ga0070670_101511043 3300005331 Unclassified 617
26 Ga0070677_10203701 3300005333 Bacteria 956
27 Ga0068869_100004901 3300005334 Bacteria 8375
28 Ga0068869_100025778 3300005334 Bacteria 4086
29 Ga0068869_100637358 3300005334 Bacteria 903
30 Ga0068869_100810002 3300005334 Unclassified 805
31 Ga0068869_101754683 3300005334 Unclassified 554
32 Ga0070666_10021919 3300005335 Bacteria 4143
33 Ga0070666_10191185 3300005335 Bacteria 1438
34 Ga0070666_10555187 3300005335 Bacteria 835
35 Ga0070680_100020492 3300005336 Bacteria 5248
36 Ga0070680_100041407 3300005336 Unclassified 3735
37 Ga0070680_100252194 3300005336 Unclassified 1492
38 Ga0070680_100281682 3300005336 Bacteria 1409
39 Ga0070682_100004629 3300005337 Bacteria 7641
40 Ga0068868_100033011 3300005338 Bacteria 3987
41 Ga0068868_100035938 3300005338 Bacteria 3832
42 Ga0068868_100036507 3300005338 Unclassified 3804
43 Ga0068868_100045896 3300005338 Bacteria 3419
44 Ga0068868_100223880 3300005338 Bacteria 1576
45 Ga0070660_100007995 3300005339 Bacteria 7386
46 Ga0070660_101551713 3300005339 Bacteria 563
47 Ga0070689_100002262 3300005340 Bacteria 12507
48 Ga0070689_100422219 3300005340 Bacteria 1130
49 Ga0070689_100967077 3300005340 Unclassified 756
50 Ga0070689_101938247 3300005340 Unclassified 538
51 Ga0070691_10324780 3300005341 Bacteria 847
52 Ga0070687_100033614 3300005343 Unclassified 2533
53 Ga0070687_100038874 3300005343 Bacteria 2387
54 Ga0070687_100063127 3300005343 Bacteria 1963
55 Ga0070661_100150490 3300005344 Bacteria 1759
56 Ga0070661_100296560 3300005344 Bacteria 1257
57 Ga0070661_101578408 3300005344 Bacteria 554
58 Ga0070692_10151402 3300005345 Bacteria 1321
59 Ga0070668_100003996 3300005347 Bacteria 10915
60 Ga0070669_100010557 3300005353 Bacteria 6557
61 Ga0070669_101317735 3300005353 Unclassified 625
62 Ga0070675_100145219 3300005354 Bacteria 2031
63 Ga0070675_100412586 3300005354 Unclassified 1206
64 Ga0070675_100482218 3300005354 Bacteria 1115
65 Ga0070675_100758938 3300005354 Bacteria 885
66 Ga0070671_100030038 3300005355 Bacteria 4484
67 Ga0070671_100194723 3300005355 Bacteria 1718
68 Ga0070671_100271745 3300005355 Bacteria 1441
69 Ga0070671_101721817 3300005355 Bacteria 556
70 Ga0070674_100257948 3300005356 Unclassified 1372
71 Ga0070674_100697549 3300005356 Bacteria 867
72 Ga0070673_100110084 3300005364 Bacteria 2283
73 Ga0070673_100624843 3300005364 Unclassified 984
74 Ga0070673_100977826 3300005364 Unclassified 787
75 Ga0070673_101084963 3300005364 Unclassified 747
76 Ga0070688_100002500 3300005365 Bacteria 9296
77 Ga0070688_100339301 3300005365 Unclassified 1097
78 Ga0070659_100006165 3300005366 Bacteria 8657
79 Ga0070659_100186827 3300005366 Bacteria 1702
80 Ga0070659_101739770 3300005366 Bacteria 558
81 Ga0070667_100004107 3300005367 Bacteria 12327
82 Ga0070667_100026441 3300005367 Bacteria 4827
83 Ga0070667_100417756 3300005367 Bacteria 1222
84 Ga0070667_100517030 3300005367 Bacteria 1095
85 Ga0070667_101555084 3300005367 Bacteria 621
86 Ga0070709_10047361 3300005434 Bacteria 2678
87 Ga0070709_10483107 3300005434 Unclassified 938
88 Ga0070709_11142928 3300005434 Bacteria 624
89 Ga0070714_100068458 3300005435 Bacteria 3063
90 Ga0070714_100739548 3300005435 Bacteria 950
91 Ga0070714_100952376 3300005435 Unclassified 834
92 Ga0070713_100304257 3300005436 Bacteria 1468
93 Ga0070710_10987221 3300005437 Bacteria 613
94 Ga0070701_10188432 3300005438 Bacteria 1212
95 Ga0070701_10740049 3300005438 Unclassified 665
96 Ga0070711_100099533 3300005439 Bacteria 2112
97 Ga0070711_100119889 3300005439 Bacteria 1944
98 Ga0070711_100231677 3300005439 Bacteria 1440
99 Ga0070711_100687191 3300005439 Unclassified 861
100 Ga0070711_101609484 3300005439 Unclassified 568
101 Ga0070705_100712134 3300005440 Bacteria 790
102 Ga0070708_100012013 3300005445 Bacteria 7058
103 Ga0070663_100008328 3300005455 Bacteria 6372
104 Ga0070678_100016032 3300005456 Unclassified 4779
105 Ga0070678_100035601 3300005456 Unclassified 3478
106 Ga0070678_100359925 3300005456 Bacteria 1253
107 Ga0070662_100928796 3300005457 Bacteria 743
108 Ga0070662_101285657 3300005457 Bacteria 629
109 Ga0070662_101479760 3300005457 Bacteria 585
110 Ga0070662_101758285 3300005457 Unclassified 535
111 Ga0070681_10009170 3300005458 Bacteria 9723
112 Ga0070681_10016819 3300005458 Bacteria 7304
113 Ga0070681_10114402 3300005458 Bacteria 2637
114 Ga0070681_10445946 3300005458 Unclassified 1206
115 Ga0068867_100001758 3300005459 Bacteria 15078
116 Ga0068867_100017798 3300005459 Bacteria 5046
117 Ga0068867_100022116 3300005459 Bacteria 4544
118 Ga0068867_100178467 3300005459 Bacteria 1687
119 Ga0068867_100598181 3300005459 Unclassified 961
120 Ga0068867_100694394 3300005459 Unclassified 897
121 Ga0070685_10000742 3300005466 Bacteria 17767
122 Ga0070685_10259948 3300005466 Bacteria 1154
123 Ga0070685_10443378 3300005466 Bacteria 908
124 Ga0070706_100021896 3300005467 Bacteria 5886
125 Ga0070707_100014247 3300005468 Bacteria 7453
126 Ga0070707_100610576 3300005468 Unclassified 1053
127 Ga0070698_100020840 3300005471 Bacteria 6871
128 Ga0070698_101974157 3300005471 Unclassified 537
129 Ga0070699_100035992 3300005518 Unclassified 4281
130 Ga0070699_100232677 3300005518 Unclassified 1643
131 Ga0070679_100001803 3300005530 Bacteria 19315
132 Ga0070679_100313879 3300005530 Unclassified 1517
133 Ga0070679_100340364 3300005530 Bacteria 1448
134 Ga0070684_100022187 3300005535 Bacteria 5292
135 Ga0070684_100090569 3300005535 Bacteria 2720
136 Ga0070684_100236674 3300005535 Unclassified 1668
137 Ga0070684_100690576 3300005535 Unclassified 951
138 Ga0070697_100001751 3300005536 Bacteria 16559
139 Ga0070697_100327025 3300005536 Bacteria 1321
140 Ga0068853_100153159 3300005539 Bacteria 2076
141 Ga0068853_100274577 3300005539 Bacteria 1553
142 Ga0068853_100305203 3300005539 Unclassified 1472
143 Ga0068853_100307000 3300005539 Bacteria 1468
144 Ga0068853_101078223 3300005539 Unclassified 774
145 Ga0068853_101169774 3300005539 Bacteria 742
146 Ga0070672_100008629 3300005543 Bacteria 6982
147 Ga0070672_100323620 3300005543 Bacteria 1311
148 Ga0070686_100178123 3300005544 Unclassified 1509
149 Ga0070686_100420695 3300005544 Bacteria 1021
150 Ga0070696_100764962 3300005546 Bacteria 792
151 Ga0070696_101066698 3300005546 Bacteria 678
152 Ga0070693_100064284 3300005547 Unclassified 2141
153 Ga0070693_100366168 3300005547 Bacteria 990
154 Ga0070693_100970172 3300005547 Bacteria 641
155 Ga0070665_100055412 3300005548 Bacteria 3977
156 Ga0070665_100398744 3300005548 Bacteria 1383
157 Ga0070665_100401594 3300005548 Unclassified 1378
158 Ga0070665_101818961 3300005548 Bacteria 615
159 Ga0068855_100000212 3300005563 Bacteria 73927
160 Ga0068855_100011477 3300005563 Bacteria 10708
161 Ga0068855_100269490 3300005563 Bacteria 1893
162 Ga0070664_100002350 3300005564 Bacteria 15200
163 Ga0070664_100008820 3300005564 Bacteria 8171
164 Ga0070664_100675806 3300005564 Bacteria 961
165 Ga0068857_100000164 3300005577 Bacteria 41522
166 Ga0068857_100001497 3300005577 Bacteria 18609
167 Ga0068857_100006089 3300005577 Bacteria 10301
168 Ga0068857_100284215 3300005577 Unclassified 1522
169 Ga0068857_100715347 3300005577 Bacteria 952
170 Ga0068854_100038586 3300005578 Unclassified 3360
171 Ga0068854_100043183 3300005578 Bacteria 3194
172 Ga0068856_100000752 3300005614 Bacteria 35202
173 Ga0068856_100011783 3300005614 Bacteria 8479
174 Ga0068856_100034973 3300005614 Bacteria 4923
175 Ga0068856_100045691 3300005614 Bacteria 4313
176 Ga0068856_100060400 3300005614 Bacteria 3745
177 Ga0068856_100121096 3300005614 Unclassified 2618
178 Ga0068856_100133099 3300005614 Bacteria 2491
179 Ga0068856_100755247 3300005614 Bacteria 992
180 Ga0068856_102272417 3300005614 Unclassified 551
181 Ga0070702_100001285 3300005615 Bacteria 10190
182 Ga0070702_100005499 3300005615 Bacteria 5910
183 Ga0070702_100681119 3300005615 Unclassified 781
184 Ga0068852_100009663 3300005616 Bacteria 7166
185 Ga0068852_100014419 3300005616 Bacteria 6085
186 Ga0068852_100324235 3300005616 Bacteria 1497
187 Ga0068852_101051912 3300005616 Unclassified 833
188 Ga0068852_101722880 3300005616 Unclassified 649
189 Ga0068852_102336230 3300005616 Bacteria 556
190 Ga0068859_100078103 3300005617 Bacteria 3351
191 Ga0068859_100115943 3300005617 Bacteria 2743
192 Ga0068859_100145840 3300005617 Bacteria 2442
193 Ga0068859_100560843 3300005617 Bacteria 1236
194 Ga0068864_100001307 3300005618 Bacteria 20734
195 Ga0068864_100034445 3300005618 Bacteria 4307
196 Ga0068864_100135518 3300005618 Bacteria 2217
197 Ga0068864_100565596 3300005618 Bacteria 1100
198 Ga0068864_101585744 3300005618 Bacteria 658
199 Ga0068864_101970008 3300005618 Unclassified 590
200 Ga0068866_10001354 3300005718 Bacteria 10596
201 Ga0068866_10051960 3300005718 Bacteria 2089
202 Ga0068866_10052155 3300005718 Bacteria 2086
203 Ga0068866_10078618 3300005718 Bacteria 1765
204 Ga0068851_10001166 3300005834 Bacteria 11398
205 Ga0068851_10045884 3300005834 Bacteria 2210
206 Ga0068851_10093382 3300005834 Bacteria 1587
207 Ga0068851_10158808 3300005834 Unclassified 1240
208 Ga0068870_10045510 3300005840 Bacteria 2298
209 Ga0068870_10047676 3300005840 Bacteria 2253
210 Ga0068870_10177655 3300005840 Unclassified 1275
211 Ga0068863_100013999 3300005841 Bacteria 7729
212 Ga0068863_100090779 3300005841 Bacteria 2896
213 Ga0068863_100266060 3300005841 Bacteria 1658
214 Ga0068858_100028670 3300005842 Bacteria 5170
215 Ga0068858_100046394 3300005842 Bacteria 4028
216 Ga0068858_100052630 3300005842 Bacteria 3767
217 Ga0068858_100135383 3300005842 Unclassified 2312
218 Ga0068858_100659981 3300005842 Bacteria 1016
219 Ga0068860_100016910 3300005843 Bacteria 7110
220 Ga0068860_100036911 3300005843 Bacteria 4679
221 Ga0068860_100127690 3300005843 Bacteria 2437
222 Ga0068860_100243508 3300005843 Bacteria 1749
223 Ga0068860_100776946 3300005843 Bacteria 970
224 Ga0068860_102072123 3300005843 Unclassified 590
225 Ga0068860_102340400 3300005843 Unclassified 554
226 Ga0068862_100004657 3300005844 Bacteria 11555
227 Ga0068862_100525003 3300005844 Bacteria 1127
228 Ga0070717_10013801 3300006028 Bacteria 6201
229 Ga0070717_10014069 3300006028 Bacteria 6150
230 Ga0070717_11115256 3300006028 Unclassified 718
231 Ga0070715_10288213 3300006163 Unclassified 873
232 Ga0070716_100301987 3300006173 Bacteria 1114
233 Ga0070712_100032171 3300006175 Bacteria 3539
234 Ga0070712_100164401 3300006175 Bacteria 1716
235 Ga0070712_100265002 3300006175 Unclassified 1378
236 Ga0070712_100887472 3300006175 Unclassified 768
237 Ga0070712_101626271 3300006175 Unclassified 565
238 Ga0097621_100000952 3300006237 Bacteria 20303
239 Ga0097621_100006924 3300006237 Bacteria 8072
240 Ga0097621_100020986 3300006237 Bacteria 5042
241 Ga0097621_100058037 3300006237 Bacteria 3167
242 Ga0097621_100331189 3300006237 Bacteria 1350
243 Ga0068871_100000396 3300006358 Bacteria 30364
244 Ga0068871_100081547 3300006358 Unclassified 2680
245 Ga0068871_100142209 3300006358 Unclassified 2041
246 Ga0068871_100271941 3300006358 Bacteria 1480
247 Ga0068871_100396771 3300006358 Unclassified 1228
248 Ga0068871_100774359 3300006358 Bacteria 883
249 Ga0075430_100457242 3300006846 Bacteria 1053
250 Ga0075430_101269172 3300006846 Unclassified 606
251 Ga0075433_10266965 3300006852 Bacteria 1517
252 Ga0075434_100041709 3300006871 Bacteria 4547
253 Ga0075429_101067564 3300006880 Bacteria 705
254 Ga0075429_101402192 3300006880 Unclassified 608
255 Ga0068865_100012700 3300006881 Bacteria 5307
256 Ga0068865_100028124 3300006881 Bacteria 3721
257 Ga0068865_100296757 3300006881 Bacteria 1292
258 Ga0075436_101437139 3300006914 Bacteria 523
259 Ga0097620_100078104 3300006931 Bacteria 3351
260 Ga0097620_100115946 3300006931 Bacteria 2743
261 Ga0097620_100145847 3300006931 Bacteria 2442
262 Ga0097620_100560918 3300006931 Bacteria 1236
263 Ga0075435_100138944 3300007076 Bacteria 2037
264 Ga0075435_100386609 3300007076 Bacteria 1202
265 Ga0099794_10131137 3300007265 Bacteria 1265
266 Ga0105244_10124736 3300009036 Bacteria 1245
267 Ga0105250_10033536 3300009092 Bacteria 2062
268 Ga0105240_10045382 3300009093 Bacteria 5575
269 Ga0105240_10057783 3300009093 Bacteria 4844
270 Ga0105240_10111853 3300009093 Unclassified 3302
271 Ga0105240_10115025 3300009093 Unclassified 3249
272 Ga0105240_10346330 3300009093 Unclassified 1687
273 Ga0105240_12011101 3300009093 Unclassified 600
274 Ga0111539_10128835 3300009094 Bacteria 2964
275 Ga0111539_11248453 3300009094 Bacteria 863
276 Ga0105245_10011385 3300009098 Bacteria 7748
277 Ga0105245_10089894 3300009098 Bacteria 2824
278 Ga0105245_10104947 3300009098 Bacteria 2620
279 Ga0105245_10333418 3300009098 Unclassified 1498
280 Ga0105247_10010589 3300009101 Bacteria 5570
281 Ga0105247_10013116 3300009101 Bacteria 4970
282 Ga0105247_10288806 3300009101 Unclassified 1134
283 Ga0105247_10888461 3300009101 Unclassified 687
284 Ga0114129_10036664 3300009147 Bacteria 6923
285 Ga0105243_10392525 3300009148 Bacteria 1287
286 Ga0105241_10002978 3300009174 Bacteria 12635
287 Ga0105241_10026886 3300009174 Bacteria 4282
288 Ga0105241_10041030 3300009174 Bacteria 3495
289 Ga0105241_10056053 3300009174 Bacteria 3021
290 Ga0105241_10355509 3300009174 Bacteria 1273
291 Ga0105241_11050587 3300009174 Bacteria 764
292 Ga0105241_11310042 3300009174 Unclassified 690
293 Ga0105242_10047151 3300009176 Unclassified 3498
294 Ga0105242_10155631 3300009176 Bacteria 1996
295 Ga0105242_10212578 3300009176 Bacteria 1724
296 Ga0105242_10273840 3300009176 Unclassified 1530
297 Ga0105242_10647898 3300009176 Bacteria 1027
298 Ga0105242_10916145 3300009176 Unclassified 878
299 Ga0105242_11954772 3300009176 Unclassified 628
300 Ga0105248_10015625 3300009177 Bacteria 8367
301 Ga0105248_10076032 3300009177 Unclassified 3774
302 Ga0105248_10292414 3300009177 Bacteria 1834
303 Ga0105248_10301653 3300009177 Bacteria 1804
304 Ga0105248_10327079 3300009177 Unclassified 1727
305 Ga0105248_11044654 3300009177 Bacteria 923
306 Ga0105248_11792731 3300009177 Unclassified 696
307 Ga0105237_10004194 3300009545 Bacteria 16785
308 Ga0105237_10052063 3300009545 Bacteria 4111
309 Ga0105237_10067316 3300009545 Unclassified 3575
310 Ga0105237_10140696 3300009545 Bacteria 2407
311 Ga0105237_10149801 3300009545 Bacteria 2329
312 Ga0105237_10339185 3300009545 Unclassified 1507
313 Ga0105238_10000064 3300009551 Bacteria 122380
314 Ga0105238_10028285 3300009551 Bacteria 5712
315 Ga0105238_10126137 3300009551 Bacteria 2538
316 Ga0105238_10232995 3300009551 Bacteria 1818
317 Ga0105238_11881136 3300009551 Bacteria 631
318 Ga0105249_10005291 3300009553 Bacteria 11142
319 Ga0105249_10209350 3300009553 Unclassified 1913
320 Ga0105249_10306913 3300009553 Unclassified 1594
321 Ga0105249_10839406 3300009553 Bacteria 984
322 Ga0105239_10011333 3300010375 Bacteria 9951
323 Ga0105239_10104295 3300010375 Plasmid 3139
324 Ga0105239_10213060 3300010375 Bacteria 2166
325 Ga0105239_10622968 3300010375 Unclassified 1231
326 Ga0105239_10686561 3300010375 Bacteria 1170
327 Ga0105239_11339094 3300010375 Bacteria 826
328 Ga0105239_11911929 3300010375 Unclassified 688
329 Ga0105246_10025023 3300011119 Bacteria 3888
330 Ga0105246_10334133 3300011119 Bacteria 1236
331 Ga0157315_1001896 3300012508 Bacteria 1239
332 Ga0157373_10005753 3300013100 Bacteria 9281
333 Ga0157373_10018542 3300013100 Bacteria 5064
334 Ga0157373_10176781 3300013100 Bacteria 1503
335 Ga0157373_10459966 3300013100 Bacteria 916
336 Ga0157373_10911652 3300013100 Bacteria 652
337 Ga0157371_10002970 3300013102 Bacteria 15743
338 Ga0157371_10033319 3300013102 Bacteria 3702
339 Ga0157370_10394986 3300013104 Bacteria 1273
340 Ga0157369_10000522 3300013105 Bacteria 50647
341 Ga0157369_10057009 3300013105 Bacteria 4215
342 Ga0157369_10062168 3300013105 Bacteria 4025
343 Ga0157369_10325234 3300013105 Bacteria 1598
344 Ga0157369_10501979 3300013105 Bacteria 1255
345 Ga0157374_10000245 3300013296 Bacteria 50434
346 Ga0157374_10000577 3300013296 Bacteria 32518
347 Ga0157374_10015982 3300013296 Bacteria 6593
348 Ga0157374_10038755 3300013296 Bacteria 4382
349 Ga0157374_10155678 3300013296 Unclassified 2224
350 Ga0157374_10810135 3300013296 Bacteria 952
351 Ga0157378_10000172 3300013297 Bacteria 61182
352 Ga0157378_10000384 3300013297 Bacteria 43827
353 Ga0157378_10004897 3300013297 Bacteria 11740
354 Ga0157378_10029852 3300013297 Bacteria 4815
355 Ga0157378_11463723 3300013297 Bacteria 727
356 Ga0157378_12265812 3300013297 Bacteria 595
357 Ga0163162_10028009 3300013306 Bacteria 5573
358 Ga0163162_10058721 3300013306 Bacteria 3877
359 Ga0163162_10170252 3300013306 Bacteria 2303
360 Ga0163162_10483031 3300013306 Bacteria 1370
361 Ga0157372_10001044 3300013307 Bacteria 30315
362 Ga0157372_10002415 3300013307 Bacteria 20229
363 Ga0157372_10039628 3300013307 Bacteria 5200
364 Ga0157372_10049640 3300013307 Bacteria 4666
365 Ga0157372_10053448 3300013307 Bacteria 4502
366 Ga0157372_10202497 3300013307 Bacteria 2300
367 Ga0157372_10596510 3300013307 Unclassified 1287
368 Ga0157372_11192221 3300013307 Unclassified 880
369 Ga0157375_10017354 3300013308 Bacteria 6494
370 Ga0157375_11147228 3300013308 Unclassified 910
371 Ga0157375_11385535 3300013308 Bacteria 828
372 Ga0163163_10000002 3300014325 Bacteria 609846
373 Ga0163163_10001819 3300014325 Bacteria 18005
374 Ga0163163_10009901 3300014325 Bacteria 8544
375 Ga0163163_10076049 3300014325 Bacteria 3352
376 Ga0163163_10815280 3300014325 Unclassified 997
377 Ga0157380_10005940 3300014326 Bacteria 8541
378 Ga0157380_10029087 3300014326 Bacteria 4222
379 Ga0157380_11541921 3300014326 Bacteria 718
380 Ga0157377_10001344 3300014745 Bacteria 10555
381 Ga0157377_10183154 3300014745 Bacteria 1319
382 Ga0157377_10462124 3300014745 Bacteria 879
383 Ga0157377_10637583 3300014745 Bacteria 765
384 Ga0157379_10032733 3300014968 Bacteria 4636
385 Ga0157379_10337932 3300014968 Unclassified 1377
386 Ga0157376_10007839 3300014969 Bacteria 7656
387 Ga0157376_10099596 3300014969 Bacteria 2536
388 Ga0157376_10929480 3300014969 Unclassified 889
389 Ga0163161_10001993 3300017792 Bacteria 14801
390 Ga0163161_10847627 3300017792 Bacteria 771
391 Ga0213872_10163722 3300021361 Bacteria 967
392 Ga0209758_1038685 3300025297 Bacteria 1826
393 Ga0207697_10013808 3300025315 Unclassified 3363
394 Ga0207656_10068760 3300025321 Bacteria 1570
395 Ga0207682_10008277 3300025893 Unclassified 4119
396 Ga0207682_10177078 3300025893 Bacteria 973
397 Ga0207642_10034105 3300025899 Bacteria 2161
398 Ga0207642_10152503 3300025899 Unclassified 1232
399 Ga0207710_10044402 3300025900 Bacteria 1979
400 Ga0207710_10639610 3300025900 Unclassified 557
401 Ga0207688_10062028 3300025901 Bacteria 2108
402 Ga0207680_10010284 3300025903 Bacteria 4676
403 Ga0207680_10019810 3300025903 Unclassified 3607
404 Ga0207647_10051269 3300025904 Unclassified 2551
405 Ga0207647_10288884 3300025904 Unclassified 935
406 Ga0207699_10388622 3300025906 Unclassified 992
407 Ga0207699_10435586 3300025906 Bacteria 938
408 Ga0207699_10519253 3300025906 Bacteria 861
409 Ga0207699_11182557 3300025906 Bacteria 566
410 Ga0207645_10000310 3300025907 Bacteria 40989
411 Ga0207645_10103438 3300025907 Bacteria 1839
412 Ga0207645_10273734 3300025907 Bacteria 1120
413 Ga0207643_10000514 3300025908 Bacteria 24771
414 Ga0207643_10088809 3300025908 Unclassified 1799
415 Ga0207643_10095337 3300025908 Bacteria 1739
416 Ga0207643_10179677 3300025908 Unclassified 1280
417 Ga0207705_10091962 3300025909 Bacteria 2222
418 Ga0207705_10115474 3300025909 Bacteria 1987
419 Ga0207684_10000892 3300025910 Bacteria 33932
420 Ga0207654_10057608 3300025911 Bacteria 2259
421 Ga0207654_10432325 3300025911 Unclassified 920
422 Ga0207707_10002770 3300025912 Bacteria 15632
423 Ga0207707_10780382 3300025912 Unclassified 797
424 Ga0207707_10832545 3300025912 Bacteria 767
425 Ga0207707_11641122 3300025912 Unclassified 505
426 Ga0207695_10041783 3300025913 Unclassified 4905
427 Ga0207695_10050291 3300025913 Bacteria 4386
428 Ga0207695_10506992 3300025913 Unclassified 1089
429 Ga0207695_10863766 3300025913 Bacteria 785
430 Ga0207695_11409750 3300025913 Unclassified 577
431 Ga0207671_10033930 3300025914 Unclassified 3794
432 Ga0207671_10093486 3300025914 Unclassified 2268
433 Ga0207671_10111690 3300025914 Bacteria 2080
434 Ga0207671_11002776 3300025914 Bacteria 658
435 Ga0207693_10098476 3300025915 Bacteria 2293
436 Ga0207663_10458625 3300025916 Unclassified 984
437 Ga0207663_10794058 3300025916 Bacteria 753
438 Ga0207663_11534856 3300025916 Bacteria 536
439 Ga0207660_10028934 3300025917 Bacteria 3796
440 Ga0207660_10072369 3300025917 Bacteria 2510
441 Ga0207662_10003522 3300025918 Bacteria 8068
442 Ga0207657_10001677 3300025919 Bacteria 23895
443 Ga0207649_10000479 3300025920 Bacteria 28540
444 Ga0207649_10531715 3300025920 Unclassified 897
445 Ga0207652_10001421 3300025921 Bacteria 21254
446 Ga0207652_10027988 3300025921 Unclassified 4700
447 Ga0207652_10131936 3300025921 Bacteria 2229
448 Ga0207652_10278171 3300025921 Unclassified 1510
449 Ga0207646_10013578 3300025922 Bacteria 7779
450 Ga0207646_11143547 3300025922 Bacteria 684
451 Ga0207681_10103306 3300025923 Bacteria 2059
452 Ga0207681_10108052 3300025923 Bacteria 2019
453 Ga0207681_11081222 3300025923 Unclassified 673
454 Ga0207694_10000892 3300025924 Bacteria 26471
455 Ga0207694_11343521 3300025924 Bacteria 604
456 Ga0207650_10001320 3300025925 Bacteria 17937
457 Ga0207650_10075326 3300025925 Bacteria 2546
458 Ga0207650_10229555 3300025925 Unclassified 1497
459 Ga0207659_10109724 3300025926 Unclassified 2095
460 Ga0207659_10171596 3300025926 Bacteria 1711
461 Ga0207659_10592471 3300025926 Bacteria 945
462 Ga0207659_10712504 3300025926 Bacteria 860
463 Ga0207687_10030548 3300025927 Bacteria 3633
464 Ga0207687_10032574 3300025927 Bacteria 3530
465 Ga0207687_10182606 3300025927 Unclassified 1626
466 Ga0207687_10222461 3300025927 Bacteria 1487
467 Ga0207700_10224663 3300025928 Bacteria 1593
468 Ga0207700_10435594 3300025928 Unclassified 1153
469 Ga0207700_10818088 3300025928 Unclassified 833
470 Ga0207700_11575206 3300025928 Bacteria 582
471 Ga0207664_10081542 3300025929 Bacteria 2633
472 Ga0207664_11210694 3300025929 Unclassified 673
473 Ga0207644_11041523 3300025931 Unclassified 687
474 Ga0207690_10028766 3300025932 Unclassified 3525
475 Ga0207690_10554538 3300025932 Unclassified 934
476 Ga0207706_10004675 3300025933 Bacteria 12836
477 Ga0207686_10031015 3300025934 Bacteria 3170
478 Ga0207686_10061196 3300025934 Bacteria 2386
479 Ga0207686_10241818 3300025934 Unclassified 1314
480 Ga0207686_10306185 3300025934 Bacteria 1182
481 Ga0207709_10072726 3300025935 Bacteria 2188
482 Ga0207670_10001577 3300025936 Bacteria 11939
483 Ga0207670_10193924 3300025936 Bacteria 1539
484 Ga0207670_11284652 3300025936 Unclassified 620
485 Ga0207669_10322502 3300025937 Unclassified 1183
486 Ga0207669_10433550 3300025937 Bacteria 1037
487 Ga0207704_10037213 3300025938 Bacteria 2809
488 Ga0207704_10047544 3300025938 Bacteria 2565
489 Ga0207704_10310153 3300025938 Bacteria 1213
490 Ga0207704_11369626 3300025938 Bacteria 606
491 Ga0207665_10007288 3300025939 Bacteria 7318
492 Ga0207691_10120933 3300025940 Unclassified 2321
493 Ga0207711_10004665 3300025941 Bacteria 11636
494 Ga0207711_10024932 3300025941 Bacteria 5017
495 Ga0207711_10029173 3300025941 Bacteria 4650
496 Ga0207711_10176156 3300025941 Bacteria 1943
497 Ga0207711_10751151 3300025941 Unclassified 909
498 Ga0207711_11314475 3300025941 Unclassified 665
499 Ga0207711_11686897 3300025941 Unclassified 577
500 Ga0207689_10001889 3300025942 Bacteria 19815
501 Ga0207689_10004193 3300025942 Bacteria 13110
502 Ga0207689_10007420 3300025942 Bacteria 9616
503 Ga0207661_10003623 3300025944 Bacteria 10753
504 Ga0207661_10290056 3300025944 Unclassified 1464
505 Ga0207661_10467833 3300025944 Bacteria 1150
506 Ga0207661_10680948 3300025944 Unclassified 945
507 Ga0207679_10000281 3300025945 Bacteria 38441
508 Ga0207679_10029365 3300025945 Bacteria 3827
509 Ga0207667_10000370 3300025949 Bacteria 60796
510 Ga0207667_10064600 3300025949 Bacteria 3820
511 Ga0207667_10064947 3300025949 Bacteria 3808
512 Ga0207667_10283846 3300025949 Bacteria 1692
513 Ga0207667_10357909 3300025949 Bacteria 1488
514 Ga0207667_10385205 3300025949 Bacteria 1428
515 Ga0207651_10009529 3300025960 Bacteria 5325
516 Ga0207651_10540410 3300025960 Bacteria 1012
517 Ga0207712_10218186 3300025961 Bacteria 1523
518 Ga0207712_10378615 3300025961 Unclassified 1184
519 Ga0207712_10417016 3300025961 Bacteria 1132
520 Ga0207668_10069536 3300025972 Bacteria 2507
521 Ga0207640_10107539 3300025981 Bacteria 1970
522 Ga0207640_10131977 3300025981 Bacteria 1807
523 Ga0207658_10022734 3300025986 Unclassified 4367
524 Ga0207677_10034656 3300026023 Bacteria 3271
525 Ga0207677_10056269 3300026023 Unclassified 2694
526 Ga0207677_10155231 3300026023 Bacteria 1771
527 Ga0207677_10927192 3300026023 Bacteria 786
528 Ga0207677_11189753 3300026023 Bacteria 697
529 Ga0207703_10033982 3300026035 Bacteria 4045
530 Ga0207703_10038320 3300026035 Bacteria 3824
531 Ga0207703_10222694 3300026035 Bacteria 1688
532 Ga0207703_10486992 3300026035 Bacteria 1156
533 Ga0207703_11439326 3300026035 Bacteria 663
534 Ga0207639_10012077 3300026041 Bacteria 6007
535 Ga0207639_10049798 3300026041 Bacteria 3178
536 Ga0207639_10281356 3300026041 Unclassified 1463
537 Ga0207639_10450200 3300026041 Unclassified 1169
538 Ga0207639_10993019 3300026041 Unclassified 786
539 Ga0207678_10001538 3300026067 Bacteria 21169
540 Ga0207702_10000207 3300026078 Bacteria 69989
541 Ga0207702_10006635 3300026078 Bacteria 9952
542 Ga0207702_10019878 3300026078 Bacteria 5563
543 Ga0207702_10098452 3300026078 Bacteria 2576
544 Ga0207702_10378238 3300026078 Bacteria 1361
545 Ga0207641_10000127 3300026088 Bacteria 111663
546 Ga0207641_10521140 3300026088 Unclassified 1156
547 Ga0207648_10000259 3300026089 Bacteria 57412
548 Ga0207648_10013140 3300026089 Bacteria 7716
549 Ga0207648_10081259 3300026089 Bacteria 2827
550 Ga0207648_11081431 3300026089 Bacteria 752
551 Ga0207676_10000923 3300026095 Bacteria 22723
552 Ga0207676_10004472 3300026095 Bacteria 9885
553 Ga0207674_10000183 3300026116 Bacteria 77186
554 Ga0207674_10002549 3300026116 Bacteria 22950
555 Ga0207674_10138091 3300026116 Unclassified 2398
556 Ga0207674_10259894 3300026116 Unclassified 1684
557 Ga0207674_10457918 3300026116 Bacteria 1233
558 Ga0207674_10655430 3300026116 Unclassified 1014
559 Ga0207675_100007265 3300026118 Bacteria 10472
560 Ga0207675_100255537 3300026118 Bacteria 1697
561 Ga0207683_10000470 3300026121 Bacteria 37505
562 Ga0207683_10079384 3300026121 Bacteria 2909
563 Ga0207683_10137185 3300026121 Unclassified 2202
564 Ga0207698_10062319 3300026142 Unclassified 2912
565 Ga0207698_12375175 3300026142 Unclassified 541
566 Ga0209984_1036855 3300027424 Bacteria 699
567 Ga0268266_10001535 3300028379 Bacteria 27009
568 Ga0268266_10051125 3300028379 Bacteria 3547
569 Ga0268266_11833790 3300028379 Unclassified 581
570 Ga0268265_10002337 3300028380 Bacteria 14401
571 Ga0268264_10011604 3300028381 Bacteria 7270
572 Ga0268264_10050452 3300028381 Bacteria 3465
573 Ga0268264_10074087 3300028381 Bacteria 2891
574 Ga0268264_10256229 3300028381 Unclassified 1628
575 Ga0265338_10104096 3300028800 Unclassified 2304
576 Ga0265760_10094393 3300031090 Unclassified 940
577 Ga0265331_10140703 3300031250 Bacteria 1098
578 Ga0265327_10002223 3300031251 Bacteria 21119
579 Ga0265342_10127101 3300031712 Bacteria 1430
580 Ga0373926_0092377 3300035083 Bacteria 1126
581 Ga0373940_0062269 3300035088 Unclassified 1070
582 Ga0373944_0133241 3300035089 Unclassified 865
583 Ga0373923_0406116 3300035111 Unclassified 656
584 Ga0373923_0660198 3300035111 Unclassified 517
585 Ga0373936_0003664 3300035113 Bacteria 5765
586 Ga0373946_0319527 3300035171 Unclassified 771
587 Ga0373955_0710938 3300035172 Unclassified 617
588 Ga0373962_0244936 3300035242 Unclassified 621
589 Ga0373924_0076228 3300035410 Unclassified 1420
590 Ga0373935_0007330 3300035692 Bacteria 6596
591 Ga0373927_1165379 3300035695 Unclassified 508
592 Ga0373947_0107993 3300035725 Bacteria 1755
593 Ga0373937_0261107 3300036401 Bacteria 1633
594 Ga0373937_1432737 3300036401 Unclassified 638
595 Ga0373925_0005138 3300037068 Bacteria 9806
596 Ga0373925_0018962 3300037068 Bacteria 5000
597 Ga0436364_0423161 3300037853 Bacteria 2394
598 Ga0395901_0428852 3300038443 Bacteria 1355
599 Ga0436360_1212788 3300039438 Unclassified 564
600 Ga0436361_0397684 3300039447 Unclassified 1575
601 Ga0436361_0439180 3300039447 Bacteria 5163
602 Ga0451839_0578054 3300041496 Bacteria 678
603 Ga0495617_213964 3300046452 Unclassified 600
604 Ga0495590_0119175 3300046457 Unclassified 945
605 Ga0495629_0011535 3300046459 Bacteria 6419
606 Ga0495629_1015411 3300046459 Bacteria 539
607 Ga0495580_0000085 3300046472 Bacteria 60075
608 Ga0495580_0820427 3300046472 Unclassified 602
609 Ga0495582_0002592 3300046473 Bacteria 10059
610 Ga0495605_0103003 3300046474 Bacteria 1310
611 Ga0495585_0316454 3300046492 Unclassified 764
612 Ga0495628_0026541 3300046516 Unclassified 4721
613 Ga0495628_0874512 3300046516 Bacteria 625
614 Ga0495630_0410597 3300046517 Bacteria 1037
615 Ga0495630_0749208 3300046517 Unclassified 747
616 Ga0495652_0264499 3300046529 Bacteria 1268
617 Ga0495665_0125311 3300046531 Bacteria 1345
618 Ga0495587_0531857 3300046536 Unclassified 649
619 Ga0495621_0105377 3300046539 Bacteria 1077
620 Ga0495645_0187173 3300046543 Unclassified 1414
621 Ga0495645_0645974 3300046543 Bacteria 647
622 Ga0495645_0647497 3300046543 Bacteria 646
623 Ga0495667_0202012 3300046559 Unclassified 1272
624 Ga0495667_0206174 3300046559 Bacteria 1257
625 Ga0495635_0225644 3300046663 Bacteria 1266
626 Ga0495635_0665337 3300046663 Unclassified 677
627 Ga0495635_1029714 3300046663 Unclassified 523
628 Ga0495599_0578761 3300046678 Unclassified 655
629 Ga0495658_0571323 3300046683 Unclassified 724
630 Ga0495624_0173291 3300046690 Bacteria 1316
631 Ga0495649_0251435 3300046694 Bacteria 908
632 Ga0495581_0233963 3300047315 Bacteria 1075
633 Ga0495636_0551764 3300047318 Bacteria 560
634 Ga0495674_0001980 3300047319 Bacteria 20138
635 Ga0495674_1155419 3300047319 Bacteria 587
636 Ga0495684_0140221 3300047471 Unclassified 1813
637 Ga0495593_0338445 3300047673 Bacteria 752
638 Ga0495602_0041150 3300048088 Bacteria 4225
639 Ga0495602_0697140 3300048088 Unclassified 689
640 Ga0496100_0464833 3300048903 Unclassified 971
641 Ga0496101_0119663 3300048904 Bacteria 1990
642 Ga0496102_0004013 3300048905 Bacteria 12467
643 Ga0496102_1278488 3300048905 Bacteria 653
644 Ga0496105_0237303 3300048908 Bacteria 1480
645 Ga0496105_0906287 3300048908 Unclassified 664
646 Ga0496106_0076233 3300048909 Unclassified 2570
647 Ga0496107_0100803 3300048910 Unclassified 2117
648 Ga0496108_0000122 3300048911 Bacteria 77284
649 Ga0496109_0000141 3300048912 Bacteria 71942
650 Ga0496109_0949100 3300048912 Unclassified 798
651 Ga0496110_0000082 3300048913 Bacteria 49329
652 Ga0496110_1069024 3300048913 Bacteria 715
653 Ga0496111_0000370 3300048914 Bacteria 22385
654 Ga0496112_0000679 3300048915 Bacteria 23767
655 Ga0496112_0132609 3300048915 Bacteria 2462
656 Ga0496112_0342888 3300048915 Bacteria 1437
657 Ga0496112_0657128 3300048915 Bacteria 978
658 Ga0496113_0000063 3300048916 Bacteria 46175
659 Ga0501034_0412867 3300049571 Bacteria 1272
660 Ga0501041_0301384 3300049577 Bacteria 1010
661 Ga0501042_0092343 3300049578 Unclassified 2173
662 Ga0501071_0059206 3300049587 Bacteria 2771
663 Ga0501072_0636823 3300049588 Bacteria 840
664 Ga0501075_0257757 3300049591 Bacteria 1329
665 Ga0501076_1332156 3300049592 Bacteria 590
666 Ga0501077_0492440 3300049593 Bacteria 786
667 Ga0501045_0224336 3300049824 Bacteria 1399
668 nmdc:mga05p37_47625_c1 3300050507 Bacteria 5271
669 nmdc:mga09592_404782_c1 3300050508 Bacteria 1179
670 nmdc:mga0qj67_616566_c1 3300050509 Bacteria 867
671 nmdc:mga08y16_437196_c1 3300050511 Bacteria 1336
672 nmdc:mga0n895_113760_c1 3300050512 Bacteria 2724
673 nmdc:mga0n895_2193633_c1 3300050512 Bacteria 508
674 nmdc:mga0rr50_929201_c1 3300050513 Unclassified 742
675 nmdc:mga08x19_1098339_c1 3300050514 Bacteria 564
676 nmdc:mga08x19_417040_c1 3300050514 Unclassified 943
677 nmdc:mga0a205_7155_c1 3300050515 Bacteria 10086
678 nmdc:mga0a205_85449_c1 3300050515 Bacteria 3047
679 Ga0495601_0051755 3300053077 Bacteria 2592
680 Ga0495601_0063566 3300053077 Bacteria 2346
681 Ga0495612_0329800 3300053078 Unclassified 687
682 Ga0495619_0622170 3300053085 Unclassified 738
683 Ga0500555_018807 3300053103 Unclassified 1992
684 Ga0500637_0010569 3300053178 Unclassified 4738
685 Ga0501084_0050349 3300054114 Bacteria 3487
686 Ga0207641_10837701
687 MBSR1b_contig_12914911
688 MBSR1b_contig_4530508
689 JGI24034J26672_10003990
690 JGI24751J29686_10001847
691 Ga0065712_10022563
692 Ga0065712_10260091
693 Ga0065712_10362287
694 Ga0065715_10000727
695 Ga0070658_10072002
696 Ga0070658_10397567
697 Ga0070676_10002083
698 Ga0070676_10008624
699 Ga0070676_10400110
700 Ga0070683_100045363
701 Ga0070683_100195012
702 Ga0070683_100212329
703 Ga0070683_100738713
704 Ga0070690_100039611
705 Ga0070690_100062874
706 Ga0070670_100008374
707 Ga0070670_100138782
708 Ga0070670_100244522
709 Ga0070670_100352316
710 Ga0070670_101511043
711 Ga0070677_10203701
712 Ga0068869_100004901
713 Ga0068869_100025778
714 Ga0068869_100637358
715 Ga0068869_100810002
716 Ga0068869_101754683
717 Ga0070666_10021919
718 Ga0070666_10191185
719 Ga0070666_10555187
720 Ga0070680_100020492
721 Ga0070680_100041407
722 Ga0070680_100252194
723 Ga0070680_100281682
724 Ga0070682_100004629
725 Ga0068868_100033011
726 Ga0068868_100035938
727 Ga0068868_100036507
728 Ga0068868_100045896
729 Ga0068868_100223880
730 Ga0070660_100007995
731 Ga0070660_101551713
732 Ga0070689_100002262
733 Ga0070689_100422219
734 Ga0070689_100967077
735 Ga0070689_101938247
736 Ga0070691_10324780
737 Ga0070687_100033614
738 Ga0070687_100038874
739 Ga0070687_100063127
740 Ga0070661_100150490
741 Ga0070661_100296560
742 Ga0070661_101578408
743 Ga0070692_10151402
744 Ga0070668_100003996
745 Ga0070669_100010557
746 Ga0070669_101317735
747 Ga0070675_100145219
748 Ga0070675_100412586
749 Ga0070675_100482218
750 Ga0070675_100758938
751 Ga0070671_100030038
752 Ga0070671_100194723
753 Ga0070671_100271745
754 Ga0070671_101721817
755 Ga0070674_100257948
756 Ga0070674_100697549
757 Ga0070673_100110084
758 Ga0070673_100624843
759 Ga0070673_100977826
760 Ga0070673_101084963
761 Ga0070688_100002500
762 Ga0070688_100339301
763 Ga0070659_100006165
764 Ga0070659_100186827
765 Ga0070659_101739770
766 Ga0070667_100004107
767 Ga0070667_100026441
768 Ga0070667_100417756
769 Ga0070667_100517030
770 Ga0070667_101555084
771 Ga0070709_10047361
772 Ga0070709_10483107
773 Ga0070709_11142928
774 Ga0070714_100068458
775 Ga0070714_100739548
776 Ga0070714_100952376
777 Ga0070713_100304257
778 Ga0070710_10987221
779 Ga0070701_10188432
780 Ga0070701_10740049
781 Ga0070711_100099533
782 Ga0070711_100119889
783 Ga0070711_100231677
784 Ga0070711_100687191
785 Ga0070711_101609484
786 Ga0070705_100712134
787 Ga0070708_100012013
788 Ga0070663_100008328
789 Ga0070678_100016032
790 Ga0070678_100035601
791 Ga0070678_100359925
792 Ga0070662_100928796
793 Ga0070662_101285657
794 Ga0070662_101479760
795 Ga0070662_101758285
796 Ga0070681_10009170
797 Ga0070681_10016819
798 Ga0070681_10114402
799 Ga0070681_10445946
800 Ga0068867_100001758
801 Ga0068867_100017798
802 Ga0068867_100022116
803 Ga0068867_100178467
804 Ga0068867_100598181
805 Ga0068867_100694394
806 Ga0070685_10000742
807 Ga0070685_10259948
808 Ga0070685_10443378
809 Ga0070706_100021896
810 Ga0070707_100014247
811 Ga0070707_100610576
812 Ga0070698_100020840
813 Ga0070698_101974157
814 Ga0070699_100035992
815 Ga0070699_100232677
816 Ga0070679_100001803
817 Ga0070679_100313879
818 Ga0070679_100340364
819 Ga0070684_100022187
820 Ga0070684_100090569
821 Ga0070684_100236674
822 Ga0070684_100690576
823 Ga0070697_100001751
824 Ga0070697_100327025
825 Ga0068853_100153159
826 Ga0068853_100274577
827 Ga0068853_100305203
828 Ga0068853_100307000
829 Ga0068853_101078223
830 Ga0068853_101169774
831 Ga0070672_100008629
832 Ga0070672_100323620
833 Ga0070686_100178123
834 Ga0070686_100420695
835 Ga0070696_100764962
836 Ga0070696_101066698
837 Ga0070693_100064284
838 Ga0070693_100366168
839 Ga0070693_100970172
840 Ga0070665_100055412
841 Ga0070665_100398744
842 Ga0070665_100401594
843 Ga0070665_101818961
844 Ga0068855_100000212
845 Ga0068855_100011477
846 Ga0068855_100269490
847 Ga0070664_100002350
848 Ga0070664_100008820
849 Ga0070664_100675806
850 Ga0068857_100000164
851 Ga0068857_100001497
852 Ga0068857_100006089
853 Ga0068857_100284215
854 Ga0068857_100715347
855 Ga0068854_100038586
856 Ga0068854_100043183
857 Ga0068856_100000752
858 Ga0068856_100011783
859 Ga0068856_100034973
860 Ga0068856_100045691
861 Ga0068856_100060400
862 Ga0068856_100121096
863 Ga0068856_100133099
864 Ga0068856_100755247
865 Ga0068856_102272417
866 Ga0070702_100001285
867 Ga0070702_100005499
868 Ga0070702_100681119
869 Ga0068852_100009663
870 Ga0068852_100014419
871 Ga0068852_100324235
872 Ga0068852_101051912
873 Ga0068852_101722880
874 Ga0068852_102336230
875 Ga0068859_100078103
876 Ga0068859_100115943
877 Ga0068859_100145840
878 Ga0068859_100560843
879 Ga0068864_100001307
880 Ga0068864_100034445
881 Ga0068864_100135518
882 Ga0068864_100565596
883 Ga0068864_101585744
884 Ga0068864_101970008
885 Ga0068866_10001354
886 Ga0068866_10051960
887 Ga0068866_10052155
888 Ga0068866_10078618
889 Ga0068851_10001166
890 Ga0068851_10045884
891 Ga0068851_10093382
892 Ga0068851_10158808
893 Ga0068870_10045510
894 Ga0068870_10047676
895 Ga0068870_10177655
896 Ga0068863_100013999
897 Ga0068863_100090779
898 Ga0068863_100266060
899 Ga0068858_100028670
900 Ga0068858_100046394
901 Ga0068858_100052630
902 Ga0068858_100135383
903 Ga0068858_100659981
904 Ga0068860_100016910
905 Ga0068860_100036911
906 Ga0068860_100127690
907 Ga0068860_100243508
908 Ga0068860_100776946
909 Ga0068860_102072123
910 Ga0068860_102340400
911 Ga0068862_100004657
912 Ga0068862_100525003
913 Ga0070717_10013801
914 Ga0070717_10014069
915 Ga0070717_11115256
916 Ga0070715_10288213
917 Ga0070716_100301987
918 Ga0070712_100032171
919 Ga0070712_100164401
920 Ga0070712_100265002
921 Ga0070712_100887472
922 Ga0070712_101626271
923 Ga0097621_100000952
924 Ga0097621_100006924
925 Ga0097621_100020986
926 Ga0097621_100058037
927 Ga0097621_100331189
928 Ga0068871_100000396
929 Ga0068871_100081547
930 Ga0068871_100142209
931 Ga0068871_100271941
932 Ga0068871_100396771
933 Ga0068871_100774359
934 Ga0075430_100457242
935 Ga0075430_101269172
936 Ga0075433_10266965
937 Ga0075434_100041709
938 Ga0075429_101067564
939 Ga0075429_101402192
940 Ga0068865_100012700
941 Ga0068865_100028124
942 Ga0068865_100296757
943 Ga0075436_101437139
944 Ga0097620_100078104
945 Ga0097620_100115946
946 Ga0097620_100145847
947 Ga0097620_100560918
948 Ga0075435_100138944
949 Ga0075435_100386609
950 Ga0099794_10131137
951 Ga0105244_10124736
952 Ga0105250_10033536
953 Ga0105240_10045382
954 Ga0105240_10057783
955 Ga0105240_10111853
956 Ga0105240_10115025
957 Ga0105240_10346330
958 Ga0105240_12011101
959 Ga0111539_10128835
960 Ga0111539_11248453
961 Ga0105245_10011385
962 Ga0105245_10089894
963 Ga0105245_10104947
964 Ga0105245_10333418
965 Ga0105247_10010589
966 Ga0105247_10013116
967 Ga0105247_10288806
968 Ga0105247_10888461
969 Ga0114129_10036664
970 Ga0105243_10392525
971 Ga0105241_10002978
972 Ga0105241_10026886
973 Ga0105241_10041030
974 Ga0105241_10056053
975 Ga0105241_10355509
976 Ga0105241_11050587
977 Ga0105241_11310042
978 Ga0105242_10047151
979 Ga0105242_10155631
980 Ga0105242_10212578
981 Ga0105242_10273840
982 Ga0105242_10647898
983 Ga0105242_10916145
984 Ga0105242_11954772
985 Ga0105248_10015625
986 Ga0105248_10076032
987 Ga0105248_10292414
988 Ga0105248_10301653
989 Ga0105248_10327079
990 Ga0105248_11044654
991 Ga0105248_11792731
992 Ga0105237_10004194
993 Ga0105237_10052063
994 Ga0105237_10067316
995 Ga0105237_10140696
996 Ga0105237_10149801
997 Ga0105237_10339185
998 Ga0105238_10000064
999 Ga0105238_10028285
1000 Ga0105238_10126137
1001 Ga0105238_10232995
1002 Ga0105238_11881136
1003 Ga0105249_10005291
1004 Ga0105249_10209350
1005 Ga0105249_10306913
1006 Ga0105249_10839406
1007 Ga0105239_10011333
1008 Ga0105239_10104295
1009 Ga0105239_10213060
1010 Ga0105239_10622968
1011 Ga0105239_10686561
1012 Ga0105239_11339094
1013 Ga0105239_11911929
1014 Ga0105246_10025023
1015 Ga0105246_10334133
1016 Ga0157315_1001896
1017 Ga0157373_10005753
1018 Ga0157373_10018542
1019 Ga0157373_10176781
1020 Ga0157373_10459966
1021 Ga0157373_10911652
1022 Ga0157371_10002970
1023 Ga0157371_10033319
1024 Ga0157370_10394986
1025 Ga0157369_10000522
1026 Ga0157369_10057009
1027 Ga0157369_10062168
1028 Ga0157369_10325234
1029 Ga0157369_10501979
1030 Ga0157374_10000245
1031 Ga0157374_10000577
1032 Ga0157374_10015982
1033 Ga0157374_10038755
1034 Ga0157374_10155678
1035 Ga0157374_10810135
1036 Ga0157378_10000172
1037 Ga0157378_10000384
1038 Ga0157378_10004897
1039 Ga0157378_10029852
1040 Ga0157378_11463723
1041 Ga0157378_12265812
1042 Ga0163162_10028009
1043 Ga0163162_10058721
1044 Ga0163162_10170252
1045 Ga0163162_10483031
1046 Ga0157372_10001044
1047 Ga0157372_10002415
1048 Ga0157372_10039628
1049 Ga0157372_10049640
1050 Ga0157372_10053448
1051 Ga0157372_10202497
1052 Ga0157372_10596510
1053 Ga0157372_11192221
1054 Ga0157375_10017354
1055 Ga0157375_11147228
1056 Ga0157375_11385535
1057 Ga0163163_10000002
1058 Ga0163163_10001819
1059 Ga0163163_10009901
1060 Ga0163163_10076049
1061 Ga0163163_10815280
1062 Ga0157380_10005940
1063 Ga0157380_10029087
1064 Ga0157380_11541921
1065 Ga0157377_10001344
1066 Ga0157377_10183154
1067 Ga0157377_10462124
1068 Ga0157377_10637583
1069 Ga0157379_10032733
1070 Ga0157379_10337932
1071 Ga0157376_10007839
1072 Ga0157376_10099596
1073 Ga0157376_10929480
1074 Ga0163161_10001993
1075 Ga0163161_10847627
1076 Ga0213872_10163722
1077 Ga0209758_1038685
1078 Ga0207697_10013808
1079 Ga0207656_10068760
1080 Ga0207682_10008277
1081 Ga0207682_10177078
1082 Ga0207642_10034105
1083 Ga0207642_10152503
1084 Ga0207710_10044402
1085 Ga0207710_10639610
1086 Ga0207688_10062028
1087 Ga0207680_10010284
1088 Ga0207680_10019810
1089 Ga0207647_10051269
1090 Ga0207647_10288884
1091 Ga0207699_10388622
1092 Ga0207699_10435586
1093 Ga0207699_10519253
1094 Ga0207699_11182557
1095 Ga0207645_10000310
1096 Ga0207645_10103438
1097 Ga0207645_10273734
1098 Ga0207643_10000514
1099 Ga0207643_10088809
1100 Ga0207643_10095337
1101 Ga0207643_10179677
1102 Ga0207705_10091962
1103 Ga0207705_10115474
1104 Ga0207684_10000892
1105 Ga0207654_10057608
1106 Ga0207654_10432325
1107 Ga0207707_10002770
1108 Ga0207707_10780382
1109 Ga0207707_10832545
1110 Ga0207707_11641122
1111 Ga0207695_10041783
1112 Ga0207695_10050291
1113 Ga0207695_10506992
1114 Ga0207695_10863766
1115 Ga0207695_11409750
1116 Ga0207671_10033930
1117 Ga0207671_10093486
1118 Ga0207671_10111690
1119 Ga0207671_11002776
1120 Ga0207693_10098476
1121 Ga0207663_10458625
1122 Ga0207663_10794058
1123 Ga0207663_11534856
1124 Ga0207660_10028934
1125 Ga0207660_10072369
1126 Ga0207662_10003522
1127 Ga0207657_10001677
1128 Ga0207649_10000479
1129 Ga0207649_10531715
1130 Ga0207652_10001421
1131 Ga0207652_10027988
1132 Ga0207652_10131936
1133 Ga0207652_10278171
1134 Ga0207646_10013578
1135 Ga0207646_11143547
1136 Ga0207681_10103306
1137 Ga0207681_10108052
1138 Ga0207681_11081222
1139 Ga0207694_10000892
1140 Ga0207694_11343521
1141 Ga0207650_10001320
1142 Ga0207650_10075326
1143 Ga0207650_10229555
1144 Ga0207659_10109724
1145 Ga0207659_10171596
1146 Ga0207659_10592471
1147 Ga0207659_10712504
1148 Ga0207687_10030548
1149 Ga0207687_10032574
1150 Ga0207687_10182606
1151 Ga0207687_10222461
1152 Ga0207700_10224663
1153 Ga0207700_10435594
1154 Ga0207700_10818088
1155 Ga0207700_11575206
1156 Ga0207664_10081542
1157 Ga0207664_11210694
1158 Ga0207644_11041523
1159 Ga0207690_10028766
1160 Ga0207690_10554538
1161 Ga0207706_10004675
1162 Ga0207686_10031015
1163 Ga0207686_10061196
1164 Ga0207686_10241818
1165 Ga0207686_10306185
1166 Ga0207709_10072726
1167 Ga0207670_10001577
1168 Ga0207670_10193924
1169 Ga0207670_11284652
1170 Ga0207669_10322502
1171 Ga0207669_10433550
1172 Ga0207704_10037213
1173 Ga0207704_10047544
1174 Ga0207704_10310153
1175 Ga0207704_11369626
1176 Ga0207665_10007288
1177 Ga0207691_10120933
1178 Ga0207711_10004665
1179 Ga0207711_10024932
1180 Ga0207711_10029173
1181 Ga0207711_10176156
1182 Ga0207711_10751151
1183 Ga0207711_11314475
1184 Ga0207711_11686897
1185 Ga0207689_10001889
1186 Ga0207689_10004193
1187 Ga0207689_10007420
1188 Ga0207661_10003623
1189 Ga0207661_10290056
1190 Ga0207661_10467833
1191 Ga0207661_10680948
1192 Ga0207679_10000281
1193 Ga0207679_10029365
1194 Ga0207667_10000370
1195 Ga0207667_10064600
1196 Ga0207667_10064947
1197 Ga0207667_10283846
1198 Ga0207667_10357909
1199 Ga0207667_10385205
1200 Ga0207651_10009529
1201 Ga0207651_10540410
1202 Ga0207712_10218186
1203 Ga0207712_10378615
1204 Ga0207712_10417016
1205 Ga0207668_10069536
1206 Ga0207640_10107539
1207 Ga0207640_10131977
1208 Ga0207658_10022734
1209 Ga0207677_10034656
1210 Ga0207677_10056269
1211 Ga0207677_10155231
1212 Ga0207677_10927192
1213 Ga0207677_11189753
1214 Ga0207703_10033982
1215 Ga0207703_10038320
1216 Ga0207703_10222694
1217 Ga0207703_10486992
1218 Ga0207703_11439326
1219 Ga0207639_10012077
1220 Ga0207639_10049798
1221 Ga0207639_10281356
1222 Ga0207639_10450200
1223 Ga0207639_10993019
1224 Ga0207678_10001538
1225 Ga0207702_10000207
1226 Ga0207702_10006635
1227 Ga0207702_10019878
1228 Ga0207702_10098452
1229 Ga0207702_10378238
1230 Ga0207641_10000127
1231 Ga0207641_10521140
1232 Ga0207648_10000259
1233 Ga0207648_10013140
1234 Ga0207648_10081259
1235 Ga0207648_11081431
1236 Ga0207676_10000923
1237 Ga0207676_10004472
1238 Ga0207674_10000183
1239 Ga0207674_10002549
1240 Ga0207674_10138091
1241 Ga0207674_10259894
1242 Ga0207674_10457918
1243 Ga0207674_10655430
1244 Ga0207675_100007265
1245 Ga0207675_100255537
1246 Ga0207683_10000470
1247 Ga0207683_10079384
1248 Ga0207683_10137185
1249 Ga0207698_10062319
1250 Ga0207698_12375175
1251 Ga0209984_1036855
1252 Ga0268266_10001535
1253 Ga0268266_10051125
1254 Ga0268266_11833790
1255 Ga0268265_10002337
1256 Ga0268264_10011604
1257 Ga0268264_10050452
1258 Ga0268264_10074087
1259 Ga0268264_10256229
1260 Ga0265338_10104096
1261 Ga0265760_10094393
1262 Ga0265331_10140703
1263 Ga0265327_10002223
1264 Ga0265342_10127101
1265 Ga0373926_0092377
1266 Ga0373940_0062269
1267 Ga0373944_0133241
1268 Ga0373923_0406116
1269 Ga0373923_0660198
1270 Ga0373936_0003664
1271 Ga0373946_0319527
1272 Ga0373955_0710938
1273 Ga0373962_0244936
1274 Ga0373924_0076228
1275 Ga0373935_0007330
1276 Ga0373927_1165379
1277 Ga0373947_0107993
1278 Ga0373937_0261107
1279 Ga0373937_1432737
1280 Ga0373925_0005138
1281 Ga0373925_0018962
1282 Ga0436364_0423161
1283 Ga0395901_0428852
1284 Ga0436360_1212788
1285 Ga0436361_0397684
1286 Ga0436361_0439180
1287 Ga0451839_0578054
1288 Ga0495617_213964
1289 Ga0495590_0119175
1290 Ga0495629_0011535
1291 Ga0495629_1015411
1292 Ga0495580_0000085
1293 Ga0495580_0820427
1294 Ga0495582_0002592
1295 Ga0495605_0103003
1296 Ga0495585_0316454
1297 Ga0495628_0026541
1298 Ga0495628_0874512
1299 Ga0495630_0410597
1300 Ga0495630_0749208
1301 Ga0495652_0264499
1302 Ga0495665_0125311
1303 Ga0495587_0531857
1304 Ga0495621_0105377
1305 Ga0495645_0187173
1306 Ga0495645_0645974
1307 Ga0495645_0647497
1308 Ga0495667_0202012
1309 Ga0495667_0206174
1310 Ga0495635_0225644
1311 Ga0495635_0665337
1312 Ga0495635_1029714
1313 Ga0495599_0578761
1314 Ga0495658_0571323
1315 Ga0495624_0173291
1316 Ga0495649_0251435
1317 Ga0495581_0233963
1318 Ga0495636_0551764
1319 Ga0495674_0001980
1320 Ga0495674_1155419
1321 Ga0495684_0140221
1322 Ga0495593_0338445
1323 Ga0495602_0041150
1324 Ga0495602_0697140
1325 Ga0496100_0464833
1326 Ga0496101_0119663
1327 Ga0496102_0004013
1328 Ga0496102_1278488
1329 Ga0496105_0237303
1330 Ga0496105_0906287
1331 Ga0496106_0076233
1332 Ga0496107_0100803
1333 Ga0496108_0000122
1334 Ga0496109_0000141
1335 Ga0496109_0949100
1336 Ga0496110_0000082
1337 Ga0496110_1069024
1338 Ga0496111_0000370
1339 Ga0496112_0000679
1340 Ga0496112_0132609
1341 Ga0496112_0342888
1342 Ga0496112_0657128
1343 Ga0496113_0000063
1344 Ga0501034_0412867
1345 Ga0501041_0301384
1346 Ga0501042_0092343
1347 Ga0501071_0059206
1348 Ga0501072_0636823
1349 Ga0501075_0257757
1350 Ga0501076_1332156
1351 Ga0501077_0492440
1352 Ga0501045_0224336
1353 nmdc:mga05p37_47625_c1
1354 nmdc:mga09592_404782_c1
1355 nmdc:mga0qj67_616566_c1
1356 nmdc:mga08y16_437196_c1
1357 nmdc:mga0n895_113760_c1
1358 nmdc:mga0n895_2193633_c1
1359 nmdc:mga0rr50_929201_c1
1360 nmdc:mga08x19_1098339_c1
1361 nmdc:mga08x19_417040_c1
1362 nmdc:mga0a205_7155_c1
1363 nmdc:mga0a205_85449_c1
1364 Ga0495601_0051755
1365 Ga0495601_0063566
1366 Ga0495612_0329800
1367 Ga0495619_0622170
1368 Ga0500555_018807
1369 Ga0500637_0010569
1370 Ga0501084_0050349

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

6

117

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8881 8 72
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.8751 8 72
7ne9-assembly1.cif.gz_DDD a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8678 6 70
4ija-assembly1.cif.gz_A structure of s. aureus methicillin resistance factor mecr2 0.8659 9 70
5sva-assembly1.cif.gz_h mediator-rna polymerase ii pre-initiation complex 0.8645 6 70
ID Description Score Start End Superfamily
af_Q58651_380_469_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9295 6 71 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.907 8 71 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.898 6 69 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8922 8 71 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8881 8 72 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3D5P045-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9399 3 79 GO:0003677
GO:0045892
AF-A0A2V9US67-F1-model_v4 Transcriptional regulator 0.928 1 126 GO:0003677
GO:0045892
AF-A0A2V9US67-F1-model_v4 Transcriptional regulator 0.9143 1 126 GO:0003677
GO:0045892
AF-A0A3M2BFY9-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9111 2 88 GO:0003677
GO:0045892
AF-A0A2V9QRR4-F1-model_v4 Transcriptional regulator 0.9107 15 127 GO:0003677
GO:0045892

Map