F474997
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 683 | 334 | 650 | 251 |
Family's Representative Sequence
| Representative Sequence | 3300046459|Ga0495629_0006360|Ga0495629_0006360_6229_7065 |
| Length | 278 |
| Sequence | MAVSRVGARDRKPAPGGEKESQDMVEIKTDAALDAMREAGRVVARALAAVQEAAAVGVSLRELDEAARAVLSEAGARSPFLGYRPSFAPTPFPAVICTSVNDAVVHGIPTGYRLRDGDLVSIDCGAELDGWTGDAAVTFTVGRARPADRELIDATRRALDAGIAAAVPGNRIGDISHAIGAVALAARCGMPADFGGHGIGRRMHEDPHLPNRGRPGRGFPLRHGVALAIEPMLMAGGRDAYRTGPDGWTLSTVDGSRAAHIEHTVAVTHDGPRILTLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 2 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 3 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 4 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 5 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 6 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 7 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 8 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 9 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 10 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 11 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 12 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 13 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 14 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 15 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 16 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 17 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 18 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 19 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 20 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 21 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 22 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 23 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 24 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 148 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 149 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 150 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 151 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 152 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 153 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 154 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 155 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 156 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 157 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 158 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 159 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 160 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 161 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 162 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 163 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 164 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 166 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 167 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 169 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 171 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 174 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 176 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 182 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 183 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 185 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 190 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 191 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 192 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 193 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 194 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 272 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 273 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 274 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 275 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 280 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 281 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 282 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 283 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 284 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 311 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 313 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 314 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 315 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 316 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 317 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 318 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 319 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 320 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 321 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 322 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 323 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 324 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 325 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 326 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 327 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 328 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 329 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 330 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 331 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 332 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 333 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 334 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.58 |
| Metatranscriptomes | 0.59 |
| Isolates | 4.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.2 |
| Nodule | 0.15 |
| Rhizoplane | 5.12 |
| Rhizosphere | 87.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10011528 | 3300003320 | Bacteria | 2761 |
| 2 | Ga0070658_10174486 | 3300005327 | Bacteria | 1807 |
| 3 | Ga0070658_10253387 | 3300005327 | Bacteria | 1493 |
| 4 | Ga0070683_100356565 | 3300005329 | Bacteria | 1393 |
| 5 | Ga0070666_10135121 | 3300005335 | Bacteria | 1716 |
| 6 | Ga0070682_100036019 | 3300005337 | Bacteria | 3023 |
| 7 | Ga0070660_100154547 | 3300005339 | Bacteria | 1846 |
| 8 | Ga0070689_100242913 | 3300005340 | Bacteria | 1483 |
| 9 | Ga0070661_100255461 | 3300005344 | Bacteria | 1354 |
| 10 | Ga0070692_10131881 | 3300005345 | Bacteria | 1405 |
| 11 | Ga0070671_100053924 | 3300005355 | Bacteria | 3342 |
| 12 | Ga0070673_100113351 | 3300005364 | Bacteria | 2252 |
| 13 | Ga0070659_100239581 | 3300005366 | Bacteria | 1501 |
| 14 | Ga0070667_100037929 | 3300005367 | Bacteria | 4040 |
| 15 | Ga0070714_100118693 | 3300005435 | Bacteria | 2350 |
| 16 | Ga0070713_100004563 | 3300005436 | Bacteria | 9337 |
| 17 | Ga0070710_10002491 | 3300005437 | Bacteria | 8723 |
| 18 | Ga0070701_10038096 | 3300005438 | Bacteria | 2431 |
| 19 | Ga0070711_100003093 | 3300005439 | Bacteria | 9622 |
| 20 | Ga0070711_100088330 | 3300005439 | Bacteria | 2227 |
| 21 | Ga0070711_100398638 | 3300005439 | Bacteria | 1116 |
| 22 | Ga0070705_100302067 | 3300005440 | Bacteria | 1147 |
| 23 | Ga0070700_100216429 | 3300005441 | Bacteria | 1355 |
| 24 | Ga0070694_100178191 | 3300005444 | Bacteria | 1570 |
| 25 | Ga0070708_100138566 | 3300005445 | Bacteria | 2255 |
| 26 | Ga0070708_100365428 | 3300005445 | Bacteria | 1360 |
| 27 | Ga0070708_100550253 | 3300005445 | Bacteria | 1088 |
| 28 | Ga0070663_100252346 | 3300005455 | Bacteria | 1396 |
| 29 | Ga0070663_100335842 | 3300005455 | Bacteria | 1219 |
| 30 | Ga0070678_100437161 | 3300005456 | Bacteria | 1143 |
| 31 | Ga0070706_100002091 | 3300005467 | Bacteria | 20346 |
| 32 | Ga0070706_100006507 | 3300005467 | Bacteria | 11029 |
| 33 | Ga0070707_100009811 | 3300005468 | Bacteria | 8906 |
| 34 | Ga0070707_100011035 | 3300005468 | Bacteria | 8414 |
| 35 | Ga0070707_100058627 | 3300005468 | Bacteria | 3692 |
| 36 | Ga0070698_100016903 | 3300005471 | Bacteria | 7693 |
| 37 | Ga0070679_100290077 | 3300005530 | Bacteria | 1588 |
| 38 | Ga0070684_100014004 | 3300005535 | Bacteria | 6484 |
| 39 | Ga0070684_100079769 | 3300005535 | Bacteria | 2894 |
| 40 | Ga0070697_100035905 | 3300005536 | Bacteria | 4001 |
| 41 | Ga0070672_100068389 | 3300005543 | Bacteria | 2817 |
| 42 | Ga0070695_100143786 | 3300005545 | Bacteria | 1657 |
| 43 | Ga0070695_100162767 | 3300005545 | Bacteria | 1567 |
| 44 | Ga0070696_100131758 | 3300005546 | Bacteria | 1819 |
| 45 | Ga0070696_100503632 | 3300005546 | Bacteria | 964 |
| 46 | Ga0070693_100190363 | 3300005547 | Bacteria | 1326 |
| 47 | Ga0070665_100044696 | 3300005548 | Bacteria | 4448 |
| 48 | Ga0070665_100048734 | 3300005548 | Bacteria | 4253 |
| 49 | Ga0070704_100113827 | 3300005549 | Bacteria | 2064 |
| 50 | Ga0070704_100372880 | 3300005549 | Bacteria | 1210 |
| 51 | Ga0068855_100082493 | 3300005563 | Bacteria | 3726 |
| 52 | Ga0068855_100446477 | 3300005563 | Bacteria | 1412 |
| 53 | Ga0070664_100196017 | 3300005564 | Bacteria | 1800 |
| 54 | Ga0068857_100124486 | 3300005577 | Bacteria | 2323 |
| 55 | Ga0068856_100077936 | 3300005614 | Bacteria | 3285 |
| 56 | Ga0068856_100136619 | 3300005614 | Bacteria | 2457 |
| 57 | Ga0068864_100061364 | 3300005618 | Bacteria | 3256 |
| 58 | Ga0068851_10109606 | 3300005834 | Bacteria | 1473 |
| 59 | Ga0068870_10340896 | 3300005840 | Bacteria | 959 |
| 60 | Ga0068863_100010463 | 3300005841 | Bacteria | 9017 |
| 61 | Ga0068860_100330196 | 3300005843 | Bacteria | 1498 |
| 62 | Ga0081540_1000372 | 3300005983 | Bacteria | 44934 |
| 63 | Ga0081540_1001031 | 3300005983 | Bacteria | 24972 |
| 64 | Ga0081539_10025102 | 3300005985 | Bacteria | 3848 |
| 65 | Ga0070717_10042123 | 3300006028 | Bacteria | 3724 |
| 66 | Ga0070717_10178583 | 3300006028 | Bacteria | 1849 |
| 67 | Ga0070717_10334974 | 3300006028 | Bacteria | 1350 |
| 68 | Ga0070715_10006847 | 3300006163 | Bacteria | 3893 |
| 69 | Ga0070715_10009752 | 3300006163 | Bacteria | 3396 |
| 70 | Ga0070715_10152909 | 3300006163 | Bacteria | 1132 |
| 71 | Ga0070716_100006138 | 3300006173 | Bacteria | 5864 |
| 72 | Ga0070716_100320057 | 3300006173 | Bacteria | 1086 |
| 73 | Ga0070712_100009339 | 3300006175 | Bacteria | 6180 |
| 74 | Ga0070712_100165932 | 3300006175 | Bacteria | 1709 |
| 75 | Ga0070712_100201288 | 3300006175 | Bacteria | 1564 |
| 76 | Ga0097621_100069030 | 3300006237 | Bacteria | 2917 |
| 77 | Ga0068871_100155023 | 3300006358 | Bacteria | 1955 |
| 78 | Ga0068871_100645678 | 3300006358 | Bacteria | 966 |
| 79 | Ga0075433_10076405 | 3300006852 | Bacteria | 2949 |
| 80 | Ga0075434_100016273 | 3300006871 | Bacteria | 7149 |
| 81 | Ga0075434_100144800 | 3300006871 | Bacteria | 2396 |
| 82 | Ga0075436_100010573 | 3300006914 | Bacteria | 6329 |
| 83 | Ga0075436_100048974 | 3300006914 | Bacteria | 2916 |
| 84 | Ga0075436_100143228 | 3300006914 | Bacteria | 1680 |
| 85 | Ga0075436_100213968 | 3300006914 | Bacteria | 1367 |
| 86 | Ga0075435_100012016 | 3300007076 | Bacteria | 6397 |
| 87 | Ga0075435_100019630 | 3300007076 | Bacteria | 5168 |
| 88 | Ga0099795_10014308 | 3300007788 | Bacteria | 2458 |
| 89 | Ga0105251_10032922 | 3300009011 | Bacteria | 2578 |
| 90 | Ga0105240_10137762 | 3300009093 | Bacteria | 2921 |
| 91 | Ga0105240_10228734 | 3300009093 | Bacteria | 2162 |
| 92 | Ga0111539_10038565 | 3300009094 | Bacteria | 5763 |
| 93 | Ga0114129_10007880 | 3300009147 | Bacteria | 15157 |
| 94 | Ga0105243_10281794 | 3300009148 | Bacteria | 1497 |
| 95 | Ga0105241_10051820 | 3300009174 | Bacteria | 3131 |
| 96 | Ga0105241_10504867 | 3300009174 | Bacteria | 1079 |
| 97 | Ga0105242_10241356 | 3300009176 | Bacteria | 1624 |
| 98 | Ga0105248_10031085 | 3300009177 | Bacteria | 5967 |
| 99 | Ga0105238_10773609 | 3300009551 | Bacteria | 975 |
| 100 | Ga0105249_10480588 | 3300009553 | Bacteria | 1285 |
| 101 | Ga0099796_10067101 | 3300010159 | Bacteria | 1286 |
| 102 | Ga0105239_10286070 | 3300010375 | Bacteria | 1856 |
| 103 | Ga0157338_1007055 | 3300012515 | Bacteria | 1056 |
| 104 | Ga0157373_10017055 | 3300013100 | Bacteria | 5288 |
| 105 | Ga0157370_10165598 | 3300013104 | Bacteria | 2056 |
| 106 | Ga0157369_10032399 | 3300013105 | Bacteria | 5749 |
| 107 | Ga0157369_10412547 | 3300013105 | Bacteria | 1400 |
| 108 | Ga0157374_10181600 | 3300013296 | Bacteria | 2055 |
| 109 | Ga0157378_10202063 | 3300013297 | Bacteria | 1880 |
| 110 | Ga0157378_10890811 | 3300013297 | Bacteria | 920 |
| 111 | Ga0157375_10330166 | 3300013308 | Bacteria | 1690 |
| 112 | Ga0163163_10035818 | 3300014325 | Bacteria | 4818 |
| 113 | Ga0163163_10086379 | 3300014325 | Bacteria | 3146 |
| 114 | Ga0163163_10174172 | 3300014325 | Bacteria | 2198 |
| 115 | Ga0157377_10038305 | 3300014745 | Bacteria | 2646 |
| 116 | Ga0157379_10472064 | 3300014968 | Bacteria | 1160 |
| 117 | Ga0206354_10023125 | 3300020081 | Bacteria | 1299 |
| 118 | Ga0206354_10103253 | 3300020081 | Bacteria | 1227 |
| 119 | Ga0206354_11234941 | 3300020081 | Bacteria | 1235 |
| 120 | Ga0206353_10457440 | 3300020082 | Bacteria | 1711 |
| 121 | Ga0207653_10055896 | 3300025885 | Bacteria | 1322 |
| 122 | Ga0207692_10007117 | 3300025898 | Bacteria | 4572 |
| 123 | Ga0207692_10011039 | 3300025898 | Bacteria | 3825 |
| 124 | Ga0207688_10044054 | 3300025901 | Bacteria | 2487 |
| 125 | Ga0207680_10320655 | 3300025903 | Bacteria | 1083 |
| 126 | Ga0207685_10002720 | 3300025905 | Bacteria | 4119 |
| 127 | Ga0207685_10037868 | 3300025905 | Bacteria | 1779 |
| 128 | Ga0207699_10004058 | 3300025906 | Bacteria | 7003 |
| 129 | Ga0207699_10005379 | 3300025906 | Bacteria | 6136 |
| 130 | Ga0207699_10006833 | 3300025906 | Bacteria | 5549 |
| 131 | Ga0207699_10044442 | 3300025906 | Bacteria | 2586 |
| 132 | Ga0207645_10145403 | 3300025907 | Bacteria | 1545 |
| 133 | Ga0207643_10020448 | 3300025908 | Bacteria | 3632 |
| 134 | Ga0207705_10667824 | 3300025909 | Bacteria | 808 |
| 135 | Ga0207684_10002280 | 3300025910 | Bacteria | 19508 |
| 136 | Ga0207684_10013750 | 3300025910 | Bacteria | 6991 |
| 137 | Ga0207654_10045012 | 3300025911 | Bacteria | 2510 |
| 138 | Ga0207654_10410524 | 3300025911 | Bacteria | 943 |
| 139 | Ga0207671_10420692 | 3300025914 | Bacteria | 1063 |
| 140 | Ga0207693_10033573 | 3300025915 | Bacteria | 4049 |
| 141 | Ga0207693_10288347 | 3300025915 | Bacteria | 1286 |
| 142 | Ga0207663_10054706 | 3300025916 | Bacteria | 2500 |
| 143 | Ga0207663_10062499 | 3300025916 | Bacteria | 2367 |
| 144 | Ga0207663_10151014 | 3300025916 | Bacteria | 1630 |
| 145 | Ga0207663_10160499 | 3300025916 | Bacteria | 1586 |
| 146 | Ga0207663_10219928 | 3300025916 | Bacteria | 1381 |
| 147 | Ga0207662_10029413 | 3300025918 | Bacteria | 3183 |
| 148 | Ga0207657_10026274 | 3300025919 | Bacteria | 5353 |
| 149 | Ga0207646_10004735 | 3300025922 | Bacteria | 14657 |
| 150 | Ga0207646_10004881 | 3300025922 | Bacteria | 14367 |
| 151 | Ga0207646_10048438 | 3300025922 | Bacteria | 3809 |
| 152 | Ga0207694_10203386 | 3300025924 | Bacteria | 1612 |
| 153 | Ga0207694_10226138 | 3300025924 | Bacteria | 1527 |
| 154 | Ga0207687_10624917 | 3300025927 | Bacteria | 910 |
| 155 | Ga0207700_10001080 | 3300025928 | Bacteria | 15690 |
| 156 | Ga0207700_10012073 | 3300025928 | Bacteria | 5549 |
| 157 | Ga0207700_10032271 | 3300025928 | Bacteria | 3733 |
| 158 | Ga0207664_10006874 | 3300025929 | Bacteria | 7866 |
| 159 | Ga0207664_10016258 | 3300025929 | Bacteria | 5423 |
| 160 | Ga0207664_10107176 | 3300025929 | Bacteria | 2318 |
| 161 | Ga0207664_10168529 | 3300025929 | Bacteria | 1873 |
| 162 | Ga0207664_10320687 | 3300025929 | Bacteria | 1367 |
| 163 | Ga0207644_10141107 | 3300025931 | Bacteria | 1855 |
| 164 | Ga0207690_10481025 | 3300025932 | Bacteria | 1002 |
| 165 | Ga0207706_10050882 | 3300025933 | Bacteria | 3660 |
| 166 | Ga0207709_10240915 | 3300025935 | Bacteria | 1316 |
| 167 | Ga0207665_10003938 | 3300025939 | Bacteria | 9938 |
| 168 | Ga0207665_10009530 | 3300025939 | Bacteria | 6377 |
| 169 | Ga0207665_10160643 | 3300025939 | Bacteria | 1616 |
| 170 | Ga0207691_10062115 | 3300025940 | Bacteria | 3391 |
| 171 | Ga0207689_10014748 | 3300025942 | Bacteria | 6636 |
| 172 | Ga0207667_10047676 | 3300025949 | Bacteria | 4534 |
| 173 | Ga0207667_10168379 | 3300025949 | Bacteria | 2252 |
| 174 | Ga0207651_10235081 | 3300025960 | Bacteria | 1490 |
| 175 | Ga0207677_10223321 | 3300026023 | Bacteria | 1512 |
| 176 | Ga0207639_10203090 | 3300026041 | Bacteria | 1701 |
| 177 | Ga0207678_10016213 | 3300026067 | Bacteria | 6538 |
| 178 | Ga0207708_10126387 | 3300026075 | Bacteria | 1996 |
| 179 | Ga0207702_10123841 | 3300026078 | Bacteria | 2317 |
| 180 | Ga0207702_10353729 | 3300026078 | Bacteria | 1406 |
| 181 | Ga0207702_10773657 | 3300026078 | Bacteria | 948 |
| 182 | Ga0207641_10213810 | 3300026088 | Bacteria | 1784 |
| 183 | Ga0207674_10021991 | 3300026116 | Bacteria | 6859 |
| 184 | Ga0207675_100177918 | 3300026118 | Bacteria | 2036 |
| 185 | Ga0207683_10015880 | 3300026121 | Bacteria | 6412 |
| 186 | Ga0268266_10029535 | 3300028379 | Bacteria | 4660 |
| 187 | Ga0268266_10473301 | 3300028379 | Bacteria | 1193 |
| 188 | Ga0268264_10937516 | 3300028381 | Bacteria | 870 |
| 189 | Ga0307517_10003996 | 3300028786 | Bacteria | 22822 |
| 190 | Ga0307517_10082973 | 3300028786 | Bacteria | 2715 |
| 191 | Ga0307515_10100229 | 3300028794 | Bacteria | 3509 |
| 192 | Ga0307515_10176110 | 3300028794 | Bacteria | 2109 |
| 193 | Ga0307511_10103126 | 3300030521 | Bacteria | 1860 |
| 194 | Ga0307513_10017836 | 3300031456 | Bacteria | 8502 |
| 195 | Ga0307509_10526326 | 3300031507 | Bacteria | 863 |
| 196 | Ga0307508_10006889 | 3300031616 | Bacteria | 10622 |
| 197 | Ga0307508_10008020 | 3300031616 | Bacteria | 9790 |
| 198 | Ga0307514_10005869 | 3300031649 | Bacteria | 10834 |
| 199 | Ga0307514_10017946 | 3300031649 | Bacteria | 5813 |
| 200 | Ga0307514_10109544 | 3300031649 | Bacteria | 1961 |
| 201 | Ga0307516_10009624 | 3300031730 | Bacteria | 10753 |
| 202 | Ga0307518_10001359 | 3300031838 | Bacteria | 18188 |
| 203 | Ga0307518_10032435 | 3300031838 | Bacteria | 3787 |
| 204 | Ga0307507_10000001 | 3300033179 | Bacteria | 417520 |
| 205 | Ga0307507_10046326 | 3300033179 | Bacteria | 4264 |
| 206 | Ga0307510_10163415 | 3300033180 | Bacteria | 1819 |
| 207 | Ga0373948_0060325 | 3300034817 | Bacteria | 832 |
| 208 | Ga0373950_0004197 | 3300034818 | Bacteria | 2099 |
| 209 | Ga0373938_0027600 | 3300034957 | Bacteria | 1195 |
| 210 | Ga0373926_0002249 | 3300035083 | Bacteria | 6102 |
| 211 | Ga0373926_0008392 | 3300035083 | Bacteria | 3438 |
| 212 | Ga0373928_0027356 | 3300035084 | Bacteria | 1241 |
| 213 | Ga0373929_0008712 | 3300035085 | Bacteria | 1872 |
| 214 | Ga0373934_0002211 | 3300035086 | Bacteria | 7147 |
| 215 | Ga0373940_0010414 | 3300035088 | Bacteria | 2185 |
| 216 | Ga0373944_0031331 | 3300035089 | Bacteria | 1599 |
| 217 | Ga0373951_0002912 | 3300035091 | Bacteria | 4255 |
| 218 | Ga0373951_0012983 | 3300035091 | Bacteria | 1873 |
| 219 | Ga0373952_0012635 | 3300035092 | Bacteria | 1664 |
| 220 | Ga0373952_0014464 | 3300035092 | Bacteria | 1580 |
| 221 | Ga0373923_0000435 | 3300035111 | Bacteria | 9827 |
| 222 | Ga0373923_0004665 | 3300035111 | Bacteria | 4569 |
| 223 | Ga0373923_0013621 | 3300035111 | Bacteria | 3035 |
| 224 | Ga0373936_0041467 | 3300035113 | Bacteria | 1846 |
| 225 | Ga0373936_0118567 | 3300035113 | Bacteria | 1129 |
| 226 | Ga0373945_0004083 | 3300035116 | Bacteria | 4627 |
| 227 | Ga0373945_0021252 | 3300035116 | Bacteria | 2229 |
| 228 | Ga0373945_0030614 | 3300035116 | Bacteria | 1897 |
| 229 | Ga0373953_0000146 | 3300035117 | Bacteria | 18020 |
| 230 | Ga0373953_0025805 | 3300035117 | Bacteria | 2247 |
| 231 | Ga0373954_0010620 | 3300035118 | Bacteria | 4065 |
| 232 | Ga0373954_0021708 | 3300035118 | Bacteria | 2908 |
| 233 | Ga0373954_0022369 | 3300035118 | Bacteria | 2867 |
| 234 | Ga0373954_0042000 | 3300035118 | Bacteria | 2132 |
| 235 | Ga0373956_0004929 | 3300035119 | Bacteria | 5348 |
| 236 | Ga0373956_0017432 | 3300035119 | Bacteria | 3027 |
| 237 | Ga0373956_0127033 | 3300035119 | Bacteria | 1192 |
| 238 | Ga0373957_0000124 | 3300035120 | Bacteria | 18925 |
| 239 | Ga0373957_0004915 | 3300035120 | Bacteria | 4108 |
| 240 | Ga0373943_0013389 | 3300035170 | Bacteria | 3703 |
| 241 | Ga0373946_0149562 | 3300035171 | Bacteria | 1088 |
| 242 | Ga0373946_0173259 | 3300035171 | Bacteria | 1020 |
| 243 | Ga0373955_0000016 | 3300035172 | Bacteria | 71862 |
| 244 | Ga0373955_0005979 | 3300035172 | Bacteria | 5516 |
| 245 | Ga0373955_0057093 | 3300035172 | Bacteria | 2143 |
| 246 | Ga0373942_0001589 | 3300035207 | Bacteria | 5820 |
| 247 | Ga0373961_0003784 | 3300035241 | Bacteria | 3699 |
| 248 | Ga0373962_0024557 | 3300035242 | Bacteria | 1613 |
| 249 | Ga0373924_0000454 | 3300035410 | Bacteria | 12539 |
| 250 | Ga0373924_0004238 | 3300035410 | Bacteria | 4995 |
| 251 | Ga0373924_0005712 | 3300035410 | Bacteria | 4417 |
| 252 | Ga0373935_0016635 | 3300035692 | Bacteria | 4450 |
| 253 | Ga0373935_0017464 | 3300035692 | Bacteria | 4354 |
| 254 | Ga0373935_0522757 | 3300035692 | Bacteria | 863 |
| 255 | Ga0373927_0004257 | 3300035695 | Bacteria | 10045 |
| 256 | Ga0373927_0127070 | 3300035695 | Bacteria | 1665 |
| 257 | Ga0373927_0198750 | 3300035695 | Bacteria | 1316 |
| 258 | Ga0373933_0000001 | 3300035724 | Bacteria | 228234 |
| 259 | Ga0373933_0005701 | 3300035724 | Bacteria | 6775 |
| 260 | Ga0373933_0081207 | 3300035724 | Bacteria | 1988 |
| 261 | Ga0373933_0153897 | 3300035724 | Bacteria | 1457 |
| 262 | Ga0373947_0252951 | 3300035725 | Bacteria | 1165 |
| 263 | Ga0373937_0000022 | 3300036401 | Bacteria | 127537 |
| 264 | Ga0373937_0121282 | 3300036401 | Bacteria | 2436 |
| 265 | Ga0373925_0011227 | 3300037068 | Bacteria | 6495 |
| 266 | Ga0373925_0012060 | 3300037068 | Bacteria | 6258 |
| 267 | Ga0373925_0042762 | 3300037068 | Bacteria | 3361 |
| 268 | Ga0373925_0070660 | 3300037068 | Bacteria | 2639 |
| 269 | Ga0373925_0073302 | 3300037068 | Bacteria | 2591 |
| 270 | Ga0373925_0461146 | 3300037068 | Bacteria | 1041 |
| 271 | Ga0451841_1462667 | 3300041498 | Bacteria | 2976 |
| 272 | Ga0466969_0072327 | 3300044656 | Bacteria | 1656 |
| 273 | Ga0466961_0049742 | 3300044693 | Bacteria | 2678 |
| 274 | Ga0466961_0182511 | 3300044693 | Bacteria | 1302 |
| 275 | Ga0466971_0000965 | 3300044719 | Bacteria | 11814 |
| 276 | Ga0466960_0006561 | 3300044901 | Bacteria | 4673 |
| 277 | Ga0466959_0080113 | 3300045049 | Bacteria | 2354 |
| 278 | Ga0466959_0152618 | 3300045049 | Bacteria | 1627 |
| 279 | Ga0466967_0002802 | 3300045976 | Bacteria | 11058 |
| 280 | Ga0466967_0084091 | 3300045976 | Bacteria | 2879 |
| 281 | Ga0495617_026579 | 3300046452 | Bacteria | 1949 |
| 282 | Ga0495592_0000025 | 3300046454 | Bacteria | 136324 |
| 283 | Ga0495592_0014690 | 3300046454 | Bacteria | 5944 |
| 284 | Ga0495592_0033900 | 3300046454 | Bacteria | 3850 |
| 285 | Ga0495592_0045453 | 3300046454 | Bacteria | 3276 |
| 286 | Ga0495592_0045497 | 3300046454 | Bacteria | 3275 |
| 287 | Ga0495592_0053639 | 3300046454 | Bacteria | 2989 |
| 288 | Ga0495603_0000135 | 3300046455 | Bacteria | 36544 |
| 289 | Ga0495603_0012804 | 3300046455 | Bacteria | 5072 |
| 290 | Ga0495603_0016005 | 3300046455 | Bacteria | 4535 |
| 291 | Ga0495603_0038840 | 3300046455 | Bacteria | 2853 |
| 292 | Ga0495603_0179274 | 3300046455 | Bacteria | 1226 |
| 293 | Ga0495629_0000803 | 3300046459 | Bacteria | 25439 |
| 294 | Ga0495629_0000836 | 3300046459 | Bacteria | 24977 |
| 295 | Ga0495629_0004490 | 3300046459 | Bacteria | 10449 |
| 296 | Ga0495629_0005491 | 3300046459 | Bacteria | 9466 |
| 297 | Ga0495629_0006360 | 3300046459 | Bacteria | 8766 |
| 298 | Ga0495629_0010061 | 3300046459 | Bacteria | 6900 |
| 299 | Ga0495629_0024501 | 3300046459 | Bacteria | 4297 |
| 300 | Ga0495629_0061358 | 3300046459 | Bacteria | 2627 |
| 301 | Ga0495629_0072046 | 3300046459 | Bacteria | 2412 |
| 302 | Ga0495638_0056436 | 3300046460 | Bacteria | 2437 |
| 303 | Ga0495638_0091605 | 3300046460 | Bacteria | 1831 |
| 304 | Ga0495641_0024973 | 3300046461 | Bacteria | 2938 |
| 305 | Ga0495651_0000014 | 3300046462 | Bacteria | 136312 |
| 306 | Ga0495651_0001022 | 3300046462 | Bacteria | 21654 |
| 307 | Ga0495651_0023969 | 3300046462 | Bacteria | 4747 |
| 308 | Ga0495651_0093672 | 3300046462 | Bacteria | 2248 |
| 309 | Ga0495651_0170996 | 3300046462 | Bacteria | 1547 |
| 310 | Ga0495653_0004386 | 3300046463 | Bacteria | 11405 |
| 311 | Ga0495653_0014589 | 3300046463 | Bacteria | 6413 |
| 312 | Ga0495653_0039282 | 3300046463 | Bacteria | 3708 |
| 313 | Ga0495653_0111899 | 3300046463 | Bacteria | 1960 |
| 314 | Ga0495580_0033565 | 3300046472 | Bacteria | 3697 |
| 315 | Ga0495580_0147458 | 3300046472 | Bacteria | 1631 |
| 316 | Ga0495582_0003713 | 3300046473 | Bacteria | 8596 |
| 317 | Ga0495582_0004944 | 3300046473 | Bacteria | 7471 |
| 318 | Ga0495582_0019382 | 3300046473 | Bacteria | 3718 |
| 319 | Ga0495582_0258441 | 3300046473 | Bacteria | 999 |
| 320 | Ga0495605_0002245 | 3300046474 | Bacteria | 12063 |
| 321 | Ga0495639_0007870 | 3300046475 | Bacteria | 4581 |
| 322 | Ga0495639_0010514 | 3300046475 | Bacteria | 3985 |
| 323 | Ga0495639_0141643 | 3300046475 | Bacteria | 1156 |
| 324 | Ga0495662_0004950 | 3300046476 | Bacteria | 6666 |
| 325 | Ga0495662_0007733 | 3300046476 | Bacteria | 5294 |
| 326 | Ga0495662_0204897 | 3300046476 | Bacteria | 972 |
| 327 | Ga0495664_0001319 | 3300046477 | Bacteria | 13031 |
| 328 | Ga0495664_0007276 | 3300046477 | Bacteria | 6142 |
| 329 | Ga0495664_0017893 | 3300046477 | Bacteria | 4053 |
| 330 | Ga0495664_0152538 | 3300046477 | Bacteria | 1401 |
| 331 | Ga0495594_0001045 | 3300046499 | Bacteria | 14418 |
| 332 | Ga0495594_0009856 | 3300046499 | Bacteria | 4950 |
| 333 | Ga0495594_0035381 | 3300046499 | Bacteria | 2720 |
| 334 | Ga0495594_0047042 | 3300046499 | Bacteria | 2369 |
| 335 | Ga0495594_0131134 | 3300046499 | Bacteria | 1420 |
| 336 | Ga0495594_0190126 | 3300046499 | Bacteria | 1170 |
| 337 | Ga0495594_0191644 | 3300046499 | Bacteria | 1165 |
| 338 | Ga0495607_0042005 | 3300046501 | Bacteria | 2713 |
| 339 | Ga0495607_0151885 | 3300046501 | Bacteria | 1184 |
| 340 | Ga0495583_0022106 | 3300046506 | Bacteria | 3254 |
| 341 | Ga0495606_0025633 | 3300046507 | Bacteria | 4218 |
| 342 | Ga0495608_0000055 | 3300046511 | Bacteria | 93015 |
| 343 | Ga0495608_0010309 | 3300046511 | Bacteria | 6520 |
| 344 | Ga0495608_0027396 | 3300046511 | Bacteria | 3877 |
| 345 | Ga0495618_0009827 | 3300046514 | Bacteria | 5785 |
| 346 | Ga0495618_0023883 | 3300046514 | Bacteria | 3785 |
| 347 | Ga0495618_0256398 | 3300046514 | Bacteria | 1096 |
| 348 | Ga0495620_0000455 | 3300046515 | Bacteria | 27164 |
| 349 | Ga0495628_0000102 | 3300046516 | Bacteria | 68520 |
| 350 | Ga0495628_0015023 | 3300046516 | Bacteria | 6470 |
| 351 | Ga0495628_0034078 | 3300046516 | Bacteria | 4098 |
| 352 | Ga0495628_0049501 | 3300046516 | Bacteria | 3327 |
| 353 | Ga0495628_0069077 | 3300046516 | Bacteria | 2755 |
| 354 | Ga0495628_0245824 | 3300046516 | Bacteria | 1337 |
| 355 | Ga0495628_0348837 | 3300046516 | Bacteria | 1088 |
| 356 | Ga0495630_0012682 | 3300046517 | Bacteria | 6124 |
| 357 | Ga0495630_0058674 | 3300046517 | Bacteria | 2885 |
| 358 | Ga0495630_0131920 | 3300046517 | Bacteria | 1897 |
| 359 | Ga0495631_0013538 | 3300046518 | Bacteria | 3958 |
| 360 | Ga0495632_0018577 | 3300046519 | Bacteria | 3812 |
| 361 | Ga0495637_0134948 | 3300046520 | Bacteria | 940 |
| 362 | Ga0495643_0002871 | 3300046522 | Bacteria | 13092 |
| 363 | Ga0495648_0037496 | 3300046524 | Bacteria | 3114 |
| 364 | Ga0495648_0199047 | 3300046524 | Bacteria | 1004 |
| 365 | Ga0495666_0001661 | 3300046526 | Bacteria | 10975 |
| 366 | Ga0495666_0002088 | 3300046526 | Bacteria | 9896 |
| 367 | Ga0495666_0028955 | 3300046526 | Bacteria | 2725 |
| 368 | Ga0495666_0033644 | 3300046526 | Bacteria | 2503 |
| 369 | Ga0495652_0000236 | 3300046529 | Bacteria | 64607 |
| 370 | Ga0495652_0002425 | 3300046529 | Bacteria | 19225 |
| 371 | Ga0495652_0162716 | 3300046529 | Bacteria | 1730 |
| 372 | Ga0495652_0282997 | 3300046529 | Bacteria | 1213 |
| 373 | Ga0495665_0003302 | 3300046531 | Bacteria | 8739 |
| 374 | Ga0495665_0004492 | 3300046531 | Bacteria | 7531 |
| 375 | Ga0495665_0014555 | 3300046531 | Bacteria | 4242 |
| 376 | Ga0495665_0070032 | 3300046531 | Bacteria | 1848 |
| 377 | Ga0495640_0005341 | 3300046533 | Bacteria | 10214 |
| 378 | Ga0495640_0012603 | 3300046533 | Bacteria | 6455 |
| 379 | Ga0495640_0013060 | 3300046533 | Bacteria | 6324 |
| 380 | Ga0495640_0015518 | 3300046533 | Bacteria | 5728 |
| 381 | Ga0495640_0068979 | 3300046533 | Bacteria | 2378 |
| 382 | Ga0495640_0151474 | 3300046533 | Bacteria | 1490 |
| 383 | Ga0495640_0262400 | 3300046533 | Bacteria | 1079 |
| 384 | Ga0495640_0326025 | 3300046533 | Bacteria | 950 |
| 385 | Ga0495586_0002343 | 3300046535 | Bacteria | 10309 |
| 386 | Ga0495586_0063470 | 3300046535 | Bacteria | 2012 |
| 387 | Ga0495586_0127673 | 3300046535 | Bacteria | 1423 |
| 388 | Ga0495587_0000029 | 3300046536 | Bacteria | 136321 |
| 389 | Ga0495587_0027475 | 3300046536 | Bacteria | 3464 |
| 390 | Ga0495587_0030120 | 3300046536 | Bacteria | 3291 |
| 391 | Ga0495587_0036601 | 3300046536 | Bacteria | 2951 |
| 392 | Ga0495587_0060874 | 3300046536 | Bacteria | 2212 |
| 393 | Ga0495645_0002788 | 3300046543 | Bacteria | 11852 |
| 394 | Ga0495645_0040710 | 3300046543 | Bacteria | 3389 |
| 395 | Ga0495645_0083489 | 3300046543 | Bacteria | 2289 |
| 396 | Ga0495645_0097731 | 3300046543 | Bacteria | 2090 |
| 397 | Ga0495622_0009578 | 3300046557 | Bacteria | 4482 |
| 398 | Ga0495622_0012820 | 3300046557 | Bacteria | 3887 |
| 399 | Ga0495622_0137750 | 3300046557 | Bacteria | 1109 |
| 400 | Ga0495633_0111691 | 3300046558 | Bacteria | 1267 |
| 401 | Ga0495633_0119215 | 3300046558 | Bacteria | 1222 |
| 402 | Ga0495667_0000036 | 3300046559 | Bacteria | 136146 |
| 403 | Ga0495667_0003857 | 3300046559 | Bacteria | 10061 |
| 404 | Ga0495667_0041644 | 3300046559 | Bacteria | 3045 |
| 405 | Ga0495667_0081560 | 3300046559 | Bacteria | 2102 |
| 406 | Ga0495668_0028920 | 3300046616 | Bacteria | 3132 |
| 407 | Ga0495668_0159530 | 3300046616 | Bacteria | 1235 |
| 408 | Ga0495634_0004501 | 3300046642 | Bacteria | 10931 |
| 409 | Ga0495634_0018511 | 3300046642 | Bacteria | 4959 |
| 410 | Ga0495634_0021767 | 3300046642 | Bacteria | 4525 |
| 411 | Ga0495634_0021868 | 3300046642 | Bacteria | 4513 |
| 412 | Ga0495634_0023671 | 3300046642 | Bacteria | 4315 |
| 413 | Ga0495634_0045897 | 3300046642 | Bacteria | 2951 |
| 414 | Ga0495634_0082931 | 3300046642 | Bacteria | 2093 |
| 415 | Ga0495634_0245846 | 3300046642 | Bacteria | 1096 |
| 416 | Ga0495611_0024512 | 3300046648 | Bacteria | 2625 |
| 417 | Ga0495625_0007372 | 3300046660 | Bacteria | 9586 |
| 418 | Ga0495625_0010156 | 3300046660 | Bacteria | 7818 |
| 419 | Ga0495635_0007633 | 3300046663 | Bacteria | 7550 |
| 420 | Ga0495635_0008131 | 3300046663 | Bacteria | 7329 |
| 421 | Ga0495635_0015068 | 3300046663 | Bacteria | 5407 |
| 422 | Ga0495635_0053396 | 3300046663 | Bacteria | 2784 |
| 423 | Ga0495635_0196055 | 3300046663 | Bacteria | 1370 |
| 424 | Ga0495588_0004093 | 3300046674 | Bacteria | 6416 |
| 425 | Ga0495588_0114447 | 3300046674 | Bacteria | 1421 |
| 426 | Ga0495657_0000319 | 3300046675 | Bacteria | 44250 |
| 427 | Ga0495657_0010807 | 3300046675 | Bacteria | 6855 |
| 428 | Ga0495657_0010888 | 3300046675 | Bacteria | 6824 |
| 429 | Ga0495657_0031604 | 3300046675 | Bacteria | 3699 |
| 430 | Ga0495657_0032391 | 3300046675 | Bacteria | 3647 |
| 431 | Ga0495657_0049099 | 3300046675 | Bacteria | 2844 |
| 432 | Ga0495599_0000006 | 3300046678 | Bacteria | 283487 |
| 433 | Ga0495599_0007565 | 3300046678 | Bacteria | 6590 |
| 434 | Ga0495599_0012736 | 3300046678 | Bacteria | 5187 |
| 435 | Ga0495599_0089283 | 3300046678 | Bacteria | 1923 |
| 436 | Ga0495599_0227010 | 3300046678 | Bacteria | 1141 |
| 437 | Ga0495623_0000852 | 3300046679 | Bacteria | 20658 |
| 438 | Ga0495623_0008306 | 3300046679 | Bacteria | 6751 |
| 439 | Ga0495623_0064087 | 3300046679 | Bacteria | 2300 |
| 440 | Ga0495623_0064595 | 3300046679 | Bacteria | 2290 |
| 441 | Ga0495623_0189449 | 3300046679 | Bacteria | 1189 |
| 442 | Ga0495646_0019984 | 3300046680 | Bacteria | 4234 |
| 443 | Ga0495646_0062755 | 3300046680 | Bacteria | 2208 |
| 444 | Ga0495646_0119389 | 3300046680 | Bacteria | 1493 |
| 445 | Ga0495646_0136976 | 3300046680 | Bacteria | 1372 |
| 446 | Ga0495647_0026156 | 3300046681 | Bacteria | 2135 |
| 447 | Ga0495647_0072686 | 3300046681 | Bacteria | 1380 |
| 448 | Ga0495658_0005743 | 3300046683 | Bacteria | 6098 |
| 449 | Ga0495658_0010831 | 3300046683 | Bacteria | 4567 |
| 450 | Ga0495613_0002500 | 3300046689 | Bacteria | 13867 |
| 451 | Ga0495613_0003025 | 3300046689 | Bacteria | 12573 |
| 452 | Ga0495613_0004340 | 3300046689 | Bacteria | 10613 |
| 453 | Ga0495613_0005122 | 3300046689 | Bacteria | 9834 |
| 454 | Ga0495613_0023132 | 3300046689 | Bacteria | 4632 |
| 455 | Ga0495613_0029702 | 3300046689 | Bacteria | 4063 |
| 456 | Ga0495613_0043054 | 3300046689 | Bacteria | 3340 |
| 457 | Ga0495613_0060637 | 3300046689 | Bacteria | 2770 |
| 458 | Ga0495613_0069303 | 3300046689 | Bacteria | 2571 |
| 459 | Ga0495624_0021139 | 3300046690 | Bacteria | 4320 |
| 460 | Ga0495624_0039786 | 3300046690 | Bacteria | 3014 |
| 461 | Ga0495624_0051884 | 3300046690 | Bacteria | 2593 |
| 462 | Ga0495624_0087868 | 3300046690 | Bacteria | 1919 |
| 463 | Ga0495624_0119267 | 3300046690 | Bacteria | 1621 |
| 464 | Ga0495624_0182519 | 3300046690 | Bacteria | 1278 |
| 465 | Ga0495670_0015625 | 3300046691 | Bacteria | 3730 |
| 466 | Ga0495649_0154795 | 3300046694 | Bacteria | 1203 |
| 467 | Ga0495589_0003390 | 3300046794 | Bacteria | 8640 |
| 468 | Ga0495589_0052648 | 3300046794 | Bacteria | 2011 |
| 469 | Ga0495589_0103673 | 3300046794 | Bacteria | 1375 |
| 470 | Ga0495600_0001700 | 3300046809 | Bacteria | 12293 |
| 471 | Ga0495600_0050328 | 3300046809 | Bacteria | 2718 |
| 472 | Ga0495600_0064913 | 3300046809 | Bacteria | 2386 |
| 473 | Ga0495600_0288394 | 3300046809 | Bacteria | 1037 |
| 474 | Ga0495660_0016153 | 3300046810 | Bacteria | 4306 |
| 475 | Ga0495660_0074594 | 3300046810 | Bacteria | 1791 |
| 476 | Ga0495581_0005449 | 3300047315 | Bacteria | 7360 |
| 477 | Ga0495581_0016334 | 3300047315 | Bacteria | 4317 |
| 478 | Ga0495604_0001004 | 3300047317 | Bacteria | 23493 |
| 479 | Ga0495604_0001010 | 3300047317 | Bacteria | 23432 |
| 480 | Ga0495604_0012553 | 3300047317 | Bacteria | 6737 |
| 481 | Ga0495604_0030807 | 3300047317 | Bacteria | 4257 |
| 482 | Ga0495604_0037705 | 3300047317 | Bacteria | 3805 |
| 483 | Ga0495674_0014892 | 3300047319 | Bacteria | 7276 |
| 484 | Ga0495674_0029054 | 3300047319 | Bacteria | 5036 |
| 485 | Ga0495674_0036738 | 3300047319 | Bacteria | 4406 |
| 486 | Ga0495674_0179172 | 3300047319 | Bacteria | 1765 |
| 487 | Ga0495676_0003552 | 3300047321 | Bacteria | 14134 |
| 488 | Ga0495676_0013326 | 3300047321 | Bacteria | 7388 |
| 489 | Ga0495676_0014465 | 3300047321 | Bacteria | 7061 |
| 490 | Ga0495676_0058495 | 3300047321 | Bacteria | 3032 |
| 491 | Ga0495680_0000117 | 3300047322 | Bacteria | 76289 |
| 492 | Ga0495680_0006725 | 3300047322 | Bacteria | 10632 |
| 493 | Ga0495680_0014193 | 3300047322 | Bacteria | 6912 |
| 494 | Ga0495680_0021859 | 3300047322 | Bacteria | 5345 |
| 495 | Ga0495680_0029686 | 3300047322 | Bacteria | 4476 |
| 496 | Ga0495680_0115465 | 3300047322 | Bacteria | 1986 |
| 497 | Ga0495683_0096765 | 3300047323 | Bacteria | 1424 |
| 498 | Ga0495683_0106159 | 3300047323 | Bacteria | 1345 |
| 499 | Ga0495687_005330 | 3300047443 | Bacteria | 8238 |
| 500 | Ga0495687_013487 | 3300047443 | Bacteria | 4261 |
| 501 | Ga0495687_036461 | 3300047443 | Bacteria | 2200 |
| 502 | Ga0495675_0000244 | 3300047444 | Bacteria | 39231 |
| 503 | Ga0495675_0010768 | 3300047444 | Bacteria | 5728 |
| 504 | Ga0495675_0021793 | 3300047444 | Bacteria | 4082 |
| 505 | Ga0495675_0052262 | 3300047444 | Bacteria | 2594 |
| 506 | Ga0495685_000145 | 3300047447 | Bacteria | 24203 |
| 507 | Ga0495685_052628 | 3300047447 | Bacteria | 1379 |
| 508 | Ga0495681_0003982 | 3300047470 | Bacteria | 10165 |
| 509 | Ga0495684_0014703 | 3300047471 | Bacteria | 6024 |
| 510 | Ga0495684_0028253 | 3300047471 | Bacteria | 4306 |
| 511 | Ga0495684_0073969 | 3300047471 | Bacteria | 2588 |
| 512 | Ga0495686_0075165 | 3300047472 | Bacteria | 2072 |
| 513 | Ga0495686_0105025 | 3300047472 | Bacteria | 1700 |
| 514 | Ga0495593_0003238 | 3300047673 | Bacteria | 9759 |
| 515 | Ga0495593_0003876 | 3300047673 | Bacteria | 8938 |
| 516 | Ga0495593_0031562 | 3300047673 | Bacteria | 2893 |
| 517 | Ga0495593_0111406 | 3300047673 | Bacteria | 1397 |
| 518 | Ga0495602_0000104 | 3300048088 | Bacteria | 80789 |
| 519 | Ga0495602_0049852 | 3300048088 | Bacteria | 3746 |
| 520 | Ga0495602_0070060 | 3300048088 | Bacteria | 3003 |
| 521 | Ga0495602_0137503 | 3300048088 | Bacteria | 1938 |
| 522 | Ga0495614_0000178 | 3300048089 | Bacteria | 23618 |
| 523 | Ga0495614_0003028 | 3300048089 | Bacteria | 7486 |
| 524 | Ga0495614_0004258 | 3300048089 | Bacteria | 6448 |
| 525 | Ga0495614_0025498 | 3300048089 | Bacteria | 2550 |
| 526 | Ga0495614_0026372 | 3300048089 | Bacteria | 2504 |
| 527 | Ga0495614_0037431 | 3300048089 | Bacteria | 2081 |
| 528 | Ga0496100_0099229 | 3300048903 | Bacteria | 2003 |
| 529 | Ga0496100_0199183 | 3300048903 | Bacteria | 1458 |
| 530 | Ga0496101_0064146 | 3300048904 | Bacteria | 2675 |
| 531 | Ga0496101_0092880 | 3300048904 | Bacteria | 2247 |
| 532 | Ga0496102_0000221 | 3300048905 | Bacteria | 75427 |
| 533 | Ga0496102_0093559 | 3300048905 | Bacteria | 2784 |
| 534 | Ga0496103_0099455 | 3300048906 | Bacteria | 1840 |
| 535 | Ga0496103_0223958 | 3300048906 | Bacteria | 1209 |
| 536 | Ga0496104_0002504 | 3300048907 | Bacteria | 15805 |
| 537 | Ga0496104_0232228 | 3300048907 | Bacteria | 1756 |
| 538 | Ga0496104_0233646 | 3300048907 | Bacteria | 1750 |
| 539 | Ga0496104_0338918 | 3300048907 | Bacteria | 1416 |
| 540 | Ga0496105_0007358 | 3300048908 | Bacteria | 8516 |
| 541 | Ga0496105_0015001 | 3300048908 | Bacteria | 6165 |
| 542 | Ga0496105_0266428 | 3300048908 | Bacteria | 1384 |
| 543 | Ga0496106_0031752 | 3300048909 | Bacteria | 3935 |
| 544 | Ga0496106_0136937 | 3300048909 | Bacteria | 1924 |
| 545 | Ga0496107_0101353 | 3300048910 | Bacteria | 2111 |
| 546 | Ga0496107_0105321 | 3300048910 | Bacteria | 2070 |
| 547 | Ga0496108_0017640 | 3300048911 | Bacteria | 5841 |
| 548 | Ga0496108_0230016 | 3300048911 | Bacteria | 1612 |
| 549 | Ga0496109_0064891 | 3300048912 | Bacteria | 3342 |
| 550 | Ga0496109_0664653 | 3300048912 | Bacteria | 979 |
| 551 | Ga0496110_0174299 | 3300048913 | Bacteria | 1952 |
| 552 | Ga0496110_0618668 | 3300048913 | Bacteria | 981 |
| 553 | Ga0496111_0015895 | 3300048914 | Bacteria | 5175 |
| 554 | Ga0496112_0003574 | 3300048915 | Bacteria | 12919 |
| 555 | Ga0496112_0018611 | 3300048915 | Bacteria | 6544 |
| 556 | Ga0496112_0038446 | 3300048915 | Bacteria | 4672 |
| 557 | Ga0496113_0107348 | 3300048916 | Bacteria | 2169 |
| 558 | Ga0496113_0145661 | 3300048916 | Bacteria | 1866 |
| 559 | Ga0496113_0600300 | 3300048916 | Bacteria | 881 |
| 560 | Ga0496115_0025010 | 3300048918 | Bacteria | 4645 |
| 561 | Ga0496115_0430117 | 3300048918 | Bacteria | 1068 |
| 562 | Ga0496126_0013418 | 3300048929 | Bacteria | 8336 |
| 563 | Ga0495678_088253 | 3300049459 | Bacteria | 1098 |
| 564 | Ga0501031_0004715 | 3300049568 | Bacteria | 8845 |
| 565 | Ga0501031_0032779 | 3300049568 | Bacteria | 3388 |
| 566 | Ga0501031_0121352 | 3300049568 | Bacteria | 1708 |
| 567 | Ga0501032_0005462 | 3300049569 | Bacteria | 9435 |
| 568 | Ga0501032_0020677 | 3300049569 | Bacteria | 4582 |
| 569 | Ga0501032_0030622 | 3300049569 | Bacteria | 3692 |
| 570 | Ga0501032_0213173 | 3300049569 | Bacteria | 1258 |
| 571 | Ga0501033_0030841 | 3300049570 | Bacteria | 4030 |
| 572 | Ga0501033_0145999 | 3300049570 | Bacteria | 1708 |
| 573 | Ga0501033_0147674 | 3300049570 | Bacteria | 1697 |
| 574 | Ga0501033_0228351 | 3300049570 | Bacteria | 1323 |
| 575 | Ga0501034_0203104 | 3300049571 | Bacteria | 1939 |
| 576 | Ga0501034_0266179 | 3300049571 | Bacteria | 1656 |
| 577 | Ga0501036_0010856 | 3300049572 | Bacteria | 7524 |
| 578 | Ga0501036_0037515 | 3300049572 | Bacteria | 4099 |
| 579 | Ga0501036_0315567 | 3300049572 | Bacteria | 1306 |
| 580 | Ga0501037_0014732 | 3300049573 | Bacteria | 5751 |
| 581 | Ga0501037_0178252 | 3300049573 | Bacteria | 1509 |
| 582 | Ga0501037_0350661 | 3300049573 | Bacteria | 1018 |
| 583 | Ga0501038_0000899 | 3300049574 | Bacteria | 26339 |
| 584 | Ga0501038_0015746 | 3300049574 | Bacteria | 6872 |
| 585 | Ga0501043_0025789 | 3300049579 | Bacteria | 4611 |
| 586 | Ga0501043_0048239 | 3300049579 | Bacteria | 3348 |
| 587 | Ga0501043_0376656 | 3300049579 | Bacteria | 1075 |
| 588 | Ga0501046_0079534 | 3300049580 | Bacteria | 2534 |
| 589 | Ga0501047_0107365 | 3300049581 | Bacteria | 2673 |
| 590 | Ga0501047_0134540 | 3300049581 | Bacteria | 2352 |
| 591 | Ga0501047_0138240 | 3300049581 | Bacteria | 2315 |
| 592 | Ga0501047_0379619 | 3300049581 | Bacteria | 1248 |
| 593 | Ga0501048_0000934 | 3300049582 | Bacteria | 21582 |
| 594 | Ga0501070_0010297 | 3300049586 | Bacteria | 7905 |
| 595 | Ga0501070_0053002 | 3300049586 | Bacteria | 3366 |
| 596 | Ga0501035_0003893 | 3300049822 | Bacteria | 14238 |
| 597 | Ga0501035_0039216 | 3300049822 | Bacteria | 4287 |
| 598 | Ga0501035_0049256 | 3300049822 | Bacteria | 3776 |
| 599 | Ga0501035_0093900 | 3300049822 | Bacteria | 2639 |
| 600 | Ga0501035_0101500 | 3300049822 | Bacteria | 2524 |
| 601 | Ga0501035_0404934 | 3300049822 | Bacteria | 1134 |
| 602 | Ga0501044_0006503 | 3300049823 | Bacteria | 12909 |
| 603 | Ga0501044_0013410 | 3300049823 | Bacteria | 8862 |
| 604 | Ga0501044_0066344 | 3300049823 | Bacteria | 3680 |
| 605 | Ga0501044_0231816 | 3300049823 | Bacteria | 1793 |
| 606 | Ga0501044_0327653 | 3300049823 | Bacteria | 1455 |
| 607 | Ga0501044_0331937 | 3300049823 | Bacteria | 1443 |
| 608 | Ga0501045_0609658 | 3300049824 | Bacteria | 808 |
| 609 | nmdc:mga05p37_45342_c1 | 3300050507 | Bacteria | 5409 |
| 610 | nmdc:mga06r32_319725_c1 | 3300050510 | Bacteria | 1537 |
| 611 | nmdc:mga0rr50_4166_c1 | 3300050513 | Bacteria | 8457 |
| 612 | nmdc:mga08x19_32846_c1 | 3300050514 | Bacteria | 3273 |
| 613 | nmdc:mga08x19_6725_c1 | 3300050514 | Bacteria | 6825 |
| 614 | nmdc:mga0a205_216407_c1 | 3300050515 | Bacteria | 1803 |
| 615 | nmdc:mga0a205_279410_c1 | 3300050515 | Bacteria | 1545 |
| 616 | nmdc:mga0a205_47643_c1 | 3300050515 | Bacteria | 4136 |
| 617 | Ga0495601_0001830 | 3300053077 | Bacteria | 11815 |
| 618 | Ga0495601_0005325 | 3300053077 | Bacteria | 7490 |
| 619 | Ga0495601_0015275 | 3300053077 | Bacteria | 4640 |
| 620 | Ga0495601_0021647 | 3300053077 | Bacteria | 3938 |
| 621 | Ga0495601_0057414 | 3300053077 | Bacteria | 2465 |
| 622 | Ga0495601_0070899 | 3300053077 | Bacteria | 2225 |
| 623 | Ga0495612_0001000 | 3300053078 | Bacteria | 11626 |
| 624 | Ga0495612_0004060 | 3300053078 | Bacteria | 6063 |
| 625 | Ga0495612_0006137 | 3300053078 | Bacteria | 4945 |
| 626 | Ga0495612_0051830 | 3300053078 | Bacteria | 1687 |
| 627 | Ga0495655_0008073 | 3300053083 | Bacteria | 1986 |
| 628 | Ga0495595_0009343 | 3300053084 | Bacteria | 4053 |
| 629 | Ga0495595_0051040 | 3300053084 | Bacteria | 1916 |
| 630 | Ga0495595_0077779 | 3300053084 | Bacteria | 1576 |
| 631 | Ga0495619_0002227 | 3300053085 | Bacteria | 12822 |
| 632 | Ga0495619_0020414 | 3300053085 | Bacteria | 4218 |
| 633 | Ga0495619_0068323 | 3300053085 | Bacteria | 2374 |
| 634 | Ga0495619_0132933 | 3300053085 | Bacteria | 1710 |
| 635 | Ga0500578_0009224 | 3300053086 | Bacteria | 6411 |
| 636 | Ga0500654_064699 | 3300053099 | Bacteria | 1838 |
| 637 | Ga0500660_076483 | 3300053100 | Bacteria | 1550 |
| 638 | Ga0500560_001138 | 3300053107 | Bacteria | 4376 |
| 639 | Ga0500652_007209 | 3300053131 | Bacteria | 3625 |
| 640 | Ga0500658_0000847 | 3300053134 | Bacteria | 12561 |
| 641 | Ga0500561_0000168 | 3300053137 | Bacteria | 12177 |
| 642 | Ga0500573_0002584 | 3300053140 | Bacteria | 9107 |
| 643 | Ga0500579_056230 | 3300053143 | Bacteria | 2370 |
| 644 | Ga0500600_0002727 | 3300053149 | Bacteria | 10013 |
| 645 | Ga0500600_0137658 | 3300053149 | Bacteria | 1234 |
| 646 | Ga0500616_0029487 | 3300053153 | Bacteria | 3017 |
| 647 | Ga0500633_0000369 | 3300053160 | Bacteria | 6886 |
| 648 | Ga0500634_0001537 | 3300053161 | Bacteria | 9073 |
| 649 | Ga0500587_000305 | 3300053739 | Bacteria | 5510 |
| 650 | Ga0466962_0009387 | 3300061719 | Bacteria | 4689 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035083 | Ga0373926_0008392 | Ga0373926_0008392_331_1098 | 208 |
| 2 | 3300005983 | Ga0081540_1001031 | Ga0081540_10010315 | 217 |
| 3 | 3300031838 | Ga0307518_10032435 | Ga0307518_100324353 | 223 |
| 4 | 3300006852 | Ga0075433_10076405 | Ga0075433_100764052 | 225 |
| 5 | 3300006914 | Ga0075436_100010573 | Ga0075436_1000105732 | 225 |
| 6 | 3300007076 | Ga0075435_100019630 | Ga0075435_1000196303 | 225 |
| 7 | 3300009094 | Ga0111539_10038565 | Ga0111539_100385652 | 225 |
| 8 | 3300009147 | Ga0114129_10007880 | Ga0114129_100078808 | 225 |
| 9 | 3300025914 | Ga0207671_10420692 | Ga0207671_104206922 | 225 |
| 10 | 3300050507 | nmdc:mga05p37_45342_c1 | nmdc:mga05p37_45342_c1_4496_5263 | 225 |
| 11 | 3300050510 | nmdc:mga06r32_319725_c1 | nmdc:mga06r32_319725_c1_421_1188 | 225 |
| 12 | 3300050514 | nmdc:mga08x19_32846_c1 | nmdc:mga08x19_32846_c1_249_1016 | 225 |
| 13 | 3300050515 | nmdc:mga0a205_216407_c1 | nmdc:mga0a205_216407_c1_277_1044 | 225 |
| 14 | 3300005468 | Ga0070707_100011035 | Ga0070707_1000110355 | 226 |
| 15 | 3300005985 | Ga0081539_10025102 | Ga0081539_100251021 | 226 |
| 16 | 3300025922 | Ga0207646_10004881 | Ga0207646_100048816 | 226 |
| 17 | 3300046506 | Ga0495583_0022106 | Ga0495583_0022106_1930_2697 | 227 |
| 18 | 3300046524 | Ga0495648_0037496 | Ga0495648_0037496_497_1264 | 227 |
| 19 | 3300046616 | Ga0495668_0159530 | Ga0495668_0159530_117_884 | 227 |
| 20 | 3300046694 | Ga0495649_0154795 | Ga0495649_0154795_360_1127 | 227 |
| 21 | 3300046794 | Ga0495589_0103673 | Ga0495589_0103673_23_790 | 227 |
| 22 | 3300047443 | Ga0495687_005330 | Ga0495687_005330_7318_8085 | 227 |
| 23 | 3300049569 | Ga0501032_0020677 | Ga0501032_0020677_1933_2700 | 228 |
| 24 | 3300049570 | Ga0501033_0030841 | Ga0501033_0030841_2019_2786 | 228 |
| 25 | 3300049571 | Ga0501034_0266179 | Ga0501034_0266179_717_1484 | 228 |
| 26 | 3300049572 | Ga0501036_0037515 | Ga0501036_0037515_1919_2686 | 228 |
| 27 | 3300049579 | Ga0501043_0025789 | Ga0501043_0025789_1216_1983 | 228 |
| 28 | 3300049822 | Ga0501035_0003893 | Ga0501035_0003893_11905_12672 | 228 |
| 29 | 3300049823 | Ga0501044_0013410 | Ga0501044_0013410_1391_2158 | 228 |
| 30 | 3300005445 | Ga0070708_100365428 | Ga0070708_1003654281 | 231 |
| 31 | 3300035086 | Ga0373934_0002211 | Ga0373934_0002211_1176_1943 | 231 |
| 32 | 3300035111 | Ga0373923_0004665 | Ga0373923_0004665_3236_4003 | 231 |
| 33 | 3300035111 | Ga0373923_0013621 | Ga0373923_0013621_1984_2751 | 231 |
| 34 | 3300035116 | Ga0373945_0021252 | Ga0373945_0021252_27_794 | 231 |
| 35 | 3300035117 | Ga0373953_0000146 | Ga0373953_0000146_16662_17429 | 231 |
| 36 | 3300035118 | Ga0373954_0010620 | Ga0373954_0010620_865_1632 | 231 |
| 37 | 3300035119 | Ga0373956_0127033 | Ga0373956_0127033_55_822 | 231 |
| 38 | 3300035120 | Ga0373957_0000124 | Ga0373957_0000124_11970_12737 | 231 |
| 39 | 3300035172 | Ga0373955_0000016 | Ga0373955_0000016_15688_16455 | 231 |
| 40 | 3300035410 | Ga0373924_0005712 | Ga0373924_0005712_3300_4067 | 231 |
| 41 | 3300035692 | Ga0373935_0522757 | Ga0373935_0522757_33_800 | 231 |
| 42 | 3300035695 | Ga0373927_0198750 | Ga0373927_0198750_511_1278 | 231 |
| 43 | 3300035724 | Ga0373933_0000001 | Ga0373933_0000001_227011_227778 | 231 |
| 44 | 3300035725 | Ga0373947_0252951 | Ga0373947_0252951_37_804 | 231 |
| 45 | 3300036401 | Ga0373937_0000022 | Ga0373937_0000022_8779_9546 | 231 |
| 46 | 3300037068 | Ga0373925_0073302 | Ga0373925_0073302_1581_2348 | 231 |
| 47 | 3300046454 | Ga0495592_0000025 | Ga0495592_0000025_17566_18333 | 231 |
| 48 | 3300046462 | Ga0495651_0000014 | Ga0495651_0000014_17554_18321 | 231 |
| 49 | 3300046463 | Ga0495653_0014589 | Ga0495653_0014589_4888_5655 | 231 |
| 50 | 3300046463 | Ga0495653_0039282 | Ga0495653_0039282_2603_3370 | 231 |
| 51 | 3300046472 | Ga0495580_0033565 | Ga0495580_0033565_144_911 | 231 |
| 52 | 3300046473 | Ga0495582_0019382 | Ga0495582_0019382_1902_2669 | 231 |
| 53 | 3300046499 | Ga0495594_0131134 | Ga0495594_0131134_434_1201 | 231 |
| 54 | 3300046511 | Ga0495608_0000055 | Ga0495608_0000055_74710_75477 | 231 |
| 55 | 3300046514 | Ga0495618_0009827 | Ga0495618_0009827_3847_4614 | 231 |
| 56 | 3300046516 | Ga0495628_0000102 | Ga0495628_0000102_50274_51041 | 231 |
| 57 | 3300046517 | Ga0495630_0058674 | Ga0495630_0058674_436_1203 | 231 |
| 58 | 3300046526 | Ga0495666_0028955 | Ga0495666_0028955_1843_2610 | 231 |
| 59 | 3300046529 | Ga0495652_0000236 | Ga0495652_0000236_4337_5104 | 231 |
| 60 | 3300046531 | Ga0495665_0003302 | Ga0495665_0003302_5338_6105 | 231 |
| 61 | 3300046533 | Ga0495640_0068979 | Ga0495640_0068979_77_844 | 231 |
| 62 | 3300046536 | Ga0495587_0000029 | Ga0495587_0000029_17570_18337 | 231 |
| 63 | 3300046559 | Ga0495667_0000036 | Ga0495667_0000036_17388_18155 | 231 |
| 64 | 3300046642 | Ga0495634_0018511 | Ga0495634_0018511_498_1265 | 231 |
| 65 | 3300046663 | Ga0495635_0196055 | Ga0495635_0196055_171_938 | 231 |
| 66 | 3300046675 | Ga0495657_0000319 | Ga0495657_0000319_17539_18306 | 231 |
| 67 | 3300046678 | Ga0495599_0000006 | Ga0495599_0000006_227496_228263 | 231 |
| 68 | 3300046679 | Ga0495623_0000852 | Ga0495623_0000852_15016_15783 | 231 |
| 69 | 3300046680 | Ga0495646_0119389 | Ga0495646_0119389_391_1158 | 231 |
| 70 | 3300046690 | Ga0495624_0021139 | Ga0495624_0021139_3108_3875 | 231 |
| 71 | 3300046809 | Ga0495600_0001700 | Ga0495600_0001700_5667_6434 | 231 |
| 72 | 3300047315 | Ga0495581_0016334 | Ga0495581_0016334_446_1213 | 231 |
| 73 | 3300047317 | Ga0495604_0001010 | Ga0495604_0001010_17553_18320 | 231 |
| 74 | 3300047319 | Ga0495674_0029054 | Ga0495674_0029054_3837_4604 | 231 |
| 75 | 3300047322 | Ga0495680_0000117 | Ga0495680_0000117_15191_15958 | 231 |
| 76 | 3300047322 | Ga0495680_0029686 | Ga0495680_0029686_3630_4397 | 231 |
| 77 | 3300047444 | Ga0495675_0000244 | Ga0495675_0000244_38186_38953 | 231 |
| 78 | 3300047471 | Ga0495684_0028253 | Ga0495684_0028253_1994_2761 | 231 |
| 79 | 3300047673 | Ga0495593_0031562 | Ga0495593_0031562_1553_2320 | 231 |
| 80 | 3300048088 | Ga0495602_0000104 | Ga0495602_0000104_73282_74049 | 231 |
| 81 | 3300048089 | Ga0495614_0026372 | Ga0495614_0026372_790_1557 | 231 |
| 82 | 3300053085 | Ga0495619_0132933 | Ga0495619_0132933_429_1196 | 231 |
| 83 | 3300005435 | Ga0070714_100118693 | Ga0070714_1001186933 | 233 |
| 84 | 3300005439 | Ga0070711_100088330 | Ga0070711_1000883302 | 233 |
| 85 | 3300005614 | Ga0068856_100077936 | Ga0068856_1000779362 | 233 |
| 86 | 3300006028 | Ga0070717_10042123 | Ga0070717_100421233 | 233 |
| 87 | 3300006163 | Ga0070715_10006847 | Ga0070715_100068473 | 233 |
| 88 | 3300006173 | Ga0070716_100006138 | Ga0070716_1000061385 | 233 |
| 89 | 3300010375 | Ga0105239_10286070 | Ga0105239_102860702 | 233 |
| 90 | 3300013297 | Ga0157378_10890811 | Ga0157378_108908111 | 233 |
| 91 | 3300025898 | Ga0207692_10007117 | Ga0207692_100071175 | 233 |
| 92 | 3300025905 | Ga0207685_10037868 | Ga0207685_100378682 | 233 |
| 93 | 3300025906 | Ga0207699_10005379 | Ga0207699_100053796 | 233 |
| 94 | 3300025915 | Ga0207693_10288347 | Ga0207693_102883472 | 233 |
| 95 | 3300025916 | Ga0207663_10151014 | Ga0207663_101510142 | 233 |
| 96 | 3300025928 | Ga0207700_10032271 | Ga0207700_100322715 | 233 |
| 97 | 3300025929 | Ga0207664_10006874 | Ga0207664_100068746 | 233 |
| 98 | 3300025939 | Ga0207665_10003938 | Ga0207665_100039383 | 233 |
| 99 | 3300026078 | Ga0207702_10123841 | Ga0207702_101238412 | 233 |
| 100 | 3300048906 | Ga0496103_0099455 | Ga0496103_0099455_280_1047 | 233 |
| 101 | 3300048907 | Ga0496104_0002504 | Ga0496104_0002504_8474_9241 | 233 |
| 102 | 3300048908 | Ga0496105_0007358 | Ga0496105_0007358_4298_5065 | 233 |
| 103 | 3300048909 | Ga0496106_0136937 | Ga0496106_0136937_991_1758 | 233 |
| 104 | 3300048911 | Ga0496108_0017640 | Ga0496108_0017640_2402_3169 | 233 |
| 105 | 3300048912 | Ga0496109_0064891 | Ga0496109_0064891_2290_3057 | 233 |
| 106 | 3300048915 | Ga0496112_0003574 | Ga0496112_0003574_9751_10518 | 233 |
| 107 | 3300048916 | Ga0496113_0107348 | Ga0496113_0107348_1222_1989 | 233 |
| 108 | 3300049823 | Ga0501044_0231816 | Ga0501044_0231816_19_720 | 233 |
| 109 | 3300009093 | Ga0105240_10228734 | Ga0105240_102287344 | 235 |
| 110 | 3300025924 | Ga0207694_10203386 | Ga0207694_102033862 | 235 |
| 111 | 3300025949 | Ga0207667_10168379 | Ga0207667_101683794 | 235 |
| 112 | 3300046689 | Ga0495613_0002500 | Ga0495613_0002500_3523_4290 | 237 |
| 113 | 3300047447 | Ga0495685_052628 | Ga0495685_052628_89_856 | 237 |
| 114 | 3300005549 | Ga0070704_100113827 | Ga0070704_1001138272 | 238 |
| 115 | 3300006871 | Ga0075434_100144800 | Ga0075434_1001448002 | 238 |
| 116 | 3300013308 | Ga0157375_10330166 | Ga0157375_103301662 | 238 |
| 117 | 3300020081 | Ga0206354_11234941 | Ga0206354_112349412 | 238 |
| 118 | 3300035207 | Ga0373942_0001589 | Ga0373942_0001589_1598_2365 | 238 |
| 119 | 3300050515 | nmdc:mga0a205_47643_c1 | nmdc:mga0a205_47643_c1_556_1323 | 238 |
| 120 | 3300049573 | Ga0501037_0350661 | Ga0501037_0350661_163_930 | 239 |
| 121 | 3300035695 | Ga0373927_0127070 | Ga0373927_0127070_306_1073 | 241 |
| 122 | 3300037068 | Ga0373925_0461146 | Ga0373925_0461146_117_884 | 241 |
| 123 | 3300046476 | Ga0495662_0204897 | Ga0495662_0204897_179_946 | 241 |
| 124 | 3300049569 | Ga0501032_0030622 | Ga0501032_0030622_1842_2609 | 242 |
| 125 | 3300049570 | Ga0501033_0147674 | Ga0501033_0147674_74_841 | 242 |
| 126 | 3300049572 | Ga0501036_0010856 | Ga0501036_0010856_4815_5582 | 242 |
| 127 | 3300049573 | Ga0501037_0014732 | Ga0501037_0014732_77_844 | 242 |
| 128 | 3300049574 | Ga0501038_0015746 | Ga0501038_0015746_4643_5410 | 242 |
| 129 | 3300049579 | Ga0501043_0048239 | Ga0501043_0048239_656_1423 | 242 |
| 130 | 3300049581 | Ga0501047_0138240 | Ga0501047_0138240_876_1643 | 242 |
| 131 | 3300049586 | Ga0501070_0053002 | Ga0501070_0053002_67_834 | 242 |
| 132 | 3300049822 | Ga0501035_0101500 | Ga0501035_0101500_1084_1851 | 242 |
| 133 | 3300037068 | Ga0373925_0011227 | Ga0373925_0011227_3033_3800 | 243 |
| 134 | 3300041498 | Ga0451841_1462667 | Ga0451841_1462667_866_1633 | 243 |
| 135 | 3300046516 | Ga0495628_0245824 | Ga0495628_0245824_585_1316 | 243 |
| 136 | 3300046689 | Ga0495613_0043054 | Ga0495613_0043054_2598_3329 | 243 |
| 137 | 3300049568 | Ga0501031_0032779 | Ga0501031_0032779_1464_2231 | 243 |
| 138 | 3300035171 | Ga0373946_0173259 | Ga0373946_0173259_148_915 | 244 |
| 139 | 3300046455 | Ga0495603_0000135 | Ga0495603_0000135_23825_24592 | 244 |
| 140 | 3300046459 | Ga0495629_0000803 | Ga0495629_0000803_12340_13107 | 244 |
| 141 | 3300046477 | Ga0495664_0017893 | Ga0495664_0017893_365_1132 | 244 |
| 142 | 3300046533 | Ga0495640_0262400 | Ga0495640_0262400_167_934 | 244 |
| 143 | 3300046543 | Ga0495645_0040710 | Ga0495645_0040710_2553_3320 | 244 |
| 144 | 3300046678 | Ga0495599_0227010 | Ga0495599_0227010_278_1045 | 244 |
| 145 | 3300046689 | Ga0495613_0004340 | Ga0495613_0004340_5985_6752 | 244 |
| 146 | 3300048089 | Ga0495614_0000178 | Ga0495614_0000178_649_1416 | 244 |
| 147 | 3300053077 | Ga0495601_0070899 | Ga0495601_0070899_1214_1981 | 244 |
| 148 | 3300053078 | Ga0495612_0051830 | Ga0495612_0051830_279_1046 | 244 |
| 149 | 3300028794 | Ga0307515_10176110 | Ga0307515_101761103 | 247 |
| 150 | 3300031456 | Ga0307513_10017836 | Ga0307513_100178365 | 247 |
| 151 | 3300031649 | Ga0307514_10005869 | Ga0307514_1000586910 | 247 |
| 152 | 3300035113 | Ga0373936_0118567 | Ga0373936_0118567_176_943 | 247 |
| 153 | 3300005548 | Ga0070665_100044696 | Ga0070665_1000446965 | 248 |
| 154 | 3300028379 | Ga0268266_10029535 | Ga0268266_100295353 | 248 |
| 155 | 3300046558 | Ga0495633_0111691 | Ga0495633_0111691_67_813 | 248 |
| 156 | 3300005468 | Ga0070707_100009811 | Ga0070707_1000098116 | 249 |
| 157 | 3300005536 | Ga0070697_100035905 | Ga0070697_1000359052 | 249 |
| 158 | 3300005563 | Ga0068855_100082493 | Ga0068855_1000824935 | 249 |
| 159 | 3300005614 | Ga0068856_100136619 | Ga0068856_1001366193 | 249 |
| 160 | 3300013105 | Ga0157369_10032399 | Ga0157369_100323997 | 249 |
| 161 | 3300025922 | Ga0207646_10048438 | Ga0207646_100484383 | 249 |
| 162 | 3300025949 | Ga0207667_10047676 | Ga0207667_100476767 | 249 |
| 163 | iso_pu_bacteria | 2582581312 | 2585301496 | 251 |
| 164 | iso_pu_bacteria | 2582581314 | 2585317108 | 251 |
| 165 | iso_pu_bacteria | 2616644814 | 2616700910 | 251 |
| 166 | iso_pu_bacteria | 2643221601 | 2644016926 | 251 |
| 167 | iso_pu_bacteria | 2643221631 | 2644177754 | 251 |
| 168 | iso_pu_bacteria | 2643221714 | 2644626889 | 251 |
| 169 | iso_pu_bacteria | 2767802112 | 2768645177 | 251 |
| 170 | iso_pu_bacteria | 2808606359 | 2808844949 | 251 |
| 171 | iso_pu_bacteria | 2818991472 | 2819744420 | 251 |
| 172 | iso_pu_bacteria | 2856741275 | 2856745968 | 251 |
| 173 | iso_pu_bacteria | 2862178590 | 2862183960 | 251 |
| 174 | iso_pu_bacteria | 2873314349 | 2873319629 | 251 |
| 175 | iso_pu_bacteria | 2891562705 | 2891566620 | 251 |
| 176 | iso_pu_bacteria | 2912757875 | 2912761959 | 251 |
| 177 | iso_pu_bacteria | 2997451912 | 2997455747 | 251 |
| 178 | iso_pu_bacteria | 2997600082 | 2997608029 | 251 |
| 179 | iso_pu_bacteria | 3006321560 | 3006326445 | 251 |
| 180 | iso_pu_bacteria | 3006393351 | 3006398249 | 251 |
| 181 | iso_pu_bacteria | 8008485437 | 8008491101 | 251 |
| 182 | iso_pu_bacteria | 8025478263 | 8025482461 | 251 |
| 183 | iso_pu_bacteria | 8025524527 | 8025530430 | 251 |
| 184 | iso_pu_bacteria | 8047893842 | 8047898727 | 251 |
| 185 | iso_pu_bacteria | 8048356638 | 8048360191 | 251 |
| 186 | iso_pu_bacteria | 8048369669 | 8048375689 | 251 |
| 187 | iso_pu_bacteria | 8048379754 | 8048382516 | 251 |
| 188 | iso_pu_bacteria | 8056447290 | 8056453501 | 251 |
| 189 | iso_pu_bacteria | 8056667051 | 8056668763 | 251 |
| 190 | 3300048905 | Ga0496102_0000221 | Ga0496102_0000221_62872_63642 | 253 |
| 191 | iso_pu_bacteria | 2643221578 | 2643903831 | 253 |
| 192 | iso_pu_bacteria | 2643221673 | 2644402185 | 253 |
| 193 | iso_pu_bacteria | 2946045630 | 2946046904 | 253 |
| 194 | 3300005327 | Ga0070658_10174486 | Ga0070658_101744862 | 254 |
| 195 | 3300005455 | Ga0070663_100252346 | Ga0070663_1002523461 | 254 |
| 196 | 3300014325 | Ga0163163_10086379 | Ga0163163_100863795 | 254 |
| 197 | 3300020081 | Ga0206354_10103253 | Ga0206354_101032531 | 254 |
| 198 | 3300045976 | Ga0466967_0002802 | Ga0466967_0002802_9818_10591 | 254 |
| 199 | 3300048912 | Ga0496109_0664653 | Ga0496109_0664653_126_890 | 254 |
| 200 | 3300048915 | Ga0496112_0038446 | Ga0496112_0038446_387_1151 | 254 |
| 201 | 3300049568 | Ga0501031_0121352 | Ga0501031_0121352_787_1551 | 254 |
| 202 | 3300049581 | Ga0501047_0107365 | Ga0501047_0107365_948_1712 | 254 |
| 203 | 3300049581 | Ga0501047_0379619 | Ga0501047_0379619_36_800 | 254 |
| 204 | 3300049823 | Ga0501044_0006503 | Ga0501044_0006503_8582_9346 | 254 |
| 205 | iso_pu_bacteria | 3006425503 | 3006429719 | 254 |
| 206 | 3300003320 | rootH2_10011528 | rootH2_100115282 | 255 |
| 207 | 3300005327 | Ga0070658_10253387 | Ga0070658_102533873 | 255 |
| 208 | 3300005329 | Ga0070683_100356565 | Ga0070683_1003565653 | 255 |
| 209 | 3300005335 | Ga0070666_10135121 | Ga0070666_101351211 | 255 |
| 210 | 3300005337 | Ga0070682_100036019 | Ga0070682_1000360193 | 255 |
| 211 | 3300005339 | Ga0070660_100154547 | Ga0070660_1001545473 | 255 |
| 212 | 3300005340 | Ga0070689_100242913 | Ga0070689_1002429133 | 255 |
| 213 | 3300005344 | Ga0070661_100255461 | Ga0070661_1002554612 | 255 |
| 214 | 3300005345 | Ga0070692_10131881 | Ga0070692_101318813 | 255 |
| 215 | 3300005355 | Ga0070671_100053924 | Ga0070671_1000539242 | 255 |
| 216 | 3300005364 | Ga0070673_100113351 | Ga0070673_1001133512 | 255 |
| 217 | 3300005366 | Ga0070659_100239581 | Ga0070659_1002395811 | 255 |
| 218 | 3300005367 | Ga0070667_100037929 | Ga0070667_1000379294 | 255 |
| 219 | 3300005436 | Ga0070713_100004563 | Ga0070713_1000045637 | 255 |
| 220 | 3300005437 | Ga0070710_10002491 | Ga0070710_100024916 | 255 |
| 221 | 3300005438 | Ga0070701_10038096 | Ga0070701_100380963 | 255 |
| 222 | 3300005439 | Ga0070711_100003093 | Ga0070711_1000030932 | 255 |
| 223 | 3300005439 | Ga0070711_100398638 | Ga0070711_1003986381 | 255 |
| 224 | 3300005440 | Ga0070705_100302067 | Ga0070705_1003020671 | 255 |
| 225 | 3300005441 | Ga0070700_100216429 | Ga0070700_1002164293 | 255 |
| 226 | 3300005444 | Ga0070694_100178191 | Ga0070694_1001781912 | 255 |
| 227 | 3300005445 | Ga0070708_100138566 | Ga0070708_1001385663 | 255 |
| 228 | 3300005445 | Ga0070708_100550253 | Ga0070708_1005502531 | 255 |
| 229 | 3300005455 | Ga0070663_100335842 | Ga0070663_1003358421 | 255 |
| 230 | 3300005456 | Ga0070678_100437161 | Ga0070678_1004371611 | 255 |
| 231 | 3300005467 | Ga0070706_100002091 | Ga0070706_10000209115 | 255 |
| 232 | 3300005467 | Ga0070706_100006507 | Ga0070706_1000065078 | 255 |
| 233 | 3300005468 | Ga0070707_100058627 | Ga0070707_1000586274 | 255 |
| 234 | 3300005471 | Ga0070698_100016903 | Ga0070698_1000169036 | 255 |
| 235 | 3300005530 | Ga0070679_100290077 | Ga0070679_1002900773 | 255 |
| 236 | 3300005535 | Ga0070684_100014004 | Ga0070684_1000140043 | 255 |
| 237 | 3300005535 | Ga0070684_100079769 | Ga0070684_1000797692 | 255 |
| 238 | 3300005543 | Ga0070672_100068389 | Ga0070672_1000683891 | 255 |
| 239 | 3300005545 | Ga0070695_100143786 | Ga0070695_1001437862 | 255 |
| 240 | 3300005545 | Ga0070695_100162767 | Ga0070695_1001627673 | 255 |
| 241 | 3300005546 | Ga0070696_100131758 | Ga0070696_1001317581 | 255 |
| 242 | 3300005546 | Ga0070696_100503632 | Ga0070696_1005036321 | 255 |
| 243 | 3300005547 | Ga0070693_100190363 | Ga0070693_1001903631 | 255 |
| 244 | 3300005548 | Ga0070665_100048734 | Ga0070665_1000487341 | 255 |
| 245 | 3300005549 | Ga0070704_100372880 | Ga0070704_1003728802 | 255 |
| 246 | 3300005563 | Ga0068855_100446477 | Ga0068855_1004464772 | 255 |
| 247 | 3300005564 | Ga0070664_100196017 | Ga0070664_1001960171 | 255 |
| 248 | 3300005577 | Ga0068857_100124486 | Ga0068857_1001244863 | 255 |
| 249 | 3300005618 | Ga0068864_100061364 | Ga0068864_1000613643 | 255 |
| 250 | 3300005834 | Ga0068851_10109606 | Ga0068851_101096061 | 255 |
| 251 | 3300005840 | Ga0068870_10340896 | Ga0068870_103408962 | 255 |
| 252 | 3300005841 | Ga0068863_100010463 | Ga0068863_1000104637 | 255 |
| 253 | 3300005843 | Ga0068860_100330196 | Ga0068860_1003301961 | 255 |
| 254 | 3300005983 | Ga0081540_1000372 | Ga0081540_100037232 | 255 |
| 255 | 3300006028 | Ga0070717_10178583 | Ga0070717_101785832 | 255 |
| 256 | 3300006028 | Ga0070717_10334974 | Ga0070717_103349742 | 255 |
| 257 | 3300006163 | Ga0070715_10009752 | Ga0070715_100097522 | 255 |
| 258 | 3300006163 | Ga0070715_10152909 | Ga0070715_101529092 | 255 |
| 259 | 3300006173 | Ga0070716_100320057 | Ga0070716_1003200571 | 255 |
| 260 | 3300006175 | Ga0070712_100009339 | Ga0070712_1000093392 | 255 |
| 261 | 3300006175 | Ga0070712_100165932 | Ga0070712_1001659322 | 255 |
| 262 | 3300006175 | Ga0070712_100201288 | Ga0070712_1002012882 | 255 |
| 263 | 3300006237 | Ga0097621_100069030 | Ga0097621_1000690305 | 255 |
| 264 | 3300006358 | Ga0068871_100155023 | Ga0068871_1001550232 | 255 |
| 265 | 3300006358 | Ga0068871_100645678 | Ga0068871_1006456781 | 255 |
| 266 | 3300006871 | Ga0075434_100016273 | Ga0075434_1000162733 | 255 |
| 267 | 3300006914 | Ga0075436_100048974 | Ga0075436_1000489742 | 255 |
| 268 | 3300006914 | Ga0075436_100143228 | Ga0075436_1001432283 | 255 |
| 269 | 3300006914 | Ga0075436_100213968 | Ga0075436_1002139681 | 255 |
| 270 | 3300007076 | Ga0075435_100012016 | Ga0075435_1000120164 | 255 |
| 271 | 3300007788 | Ga0099795_10014308 | Ga0099795_100143082 | 255 |
| 272 | 3300009011 | Ga0105251_10032922 | Ga0105251_100329223 | 255 |
| 273 | 3300009093 | Ga0105240_10137762 | Ga0105240_101377623 | 255 |
| 274 | 3300009148 | Ga0105243_10281794 | Ga0105243_102817943 | 255 |
| 275 | 3300009174 | Ga0105241_10051820 | Ga0105241_100518202 | 255 |
| 276 | 3300009174 | Ga0105241_10504867 | Ga0105241_105048671 | 255 |
| 277 | 3300009176 | Ga0105242_10241356 | Ga0105242_102413563 | 255 |
| 278 | 3300009177 | Ga0105248_10031085 | Ga0105248_100310857 | 255 |
| 279 | 3300009551 | Ga0105238_10773609 | Ga0105238_107736091 | 255 |
| 280 | 3300009553 | Ga0105249_10480588 | Ga0105249_104805881 | 255 |
| 281 | 3300010159 | Ga0099796_10067101 | Ga0099796_100671013 | 255 |
| 282 | 3300012515 | Ga0157338_1007055 | Ga0157338_10070551 | 255 |
| 283 | 3300013100 | Ga0157373_10017055 | Ga0157373_100170553 | 255 |
| 284 | 3300013104 | Ga0157370_10165598 | Ga0157370_101655982 | 255 |
| 285 | 3300013105 | Ga0157369_10412547 | Ga0157369_104125472 | 255 |
| 286 | 3300013296 | Ga0157374_10181600 | Ga0157374_101816003 | 255 |
| 287 | 3300013297 | Ga0157378_10202063 | Ga0157378_102020632 | 255 |
| 288 | 3300014325 | Ga0163163_10035818 | Ga0163163_100358185 | 255 |
| 289 | 3300014325 | Ga0163163_10174172 | Ga0163163_101741722 | 255 |
| 290 | 3300014745 | Ga0157377_10038305 | Ga0157377_100383054 | 255 |
| 291 | 3300014968 | Ga0157379_10472064 | Ga0157379_104720641 | 255 |
| 292 | 3300020081 | Ga0206354_10023125 | Ga0206354_100231253 | 255 |
| 293 | 3300020082 | Ga0206353_10457440 | Ga0206353_104574402 | 255 |
| 294 | 3300025885 | Ga0207653_10055896 | Ga0207653_100558962 | 255 |
| 295 | 3300025898 | Ga0207692_10011039 | Ga0207692_100110392 | 255 |
| 296 | 3300025901 | Ga0207688_10044054 | Ga0207688_100440542 | 255 |
| 297 | 3300025903 | Ga0207680_10320655 | Ga0207680_103206551 | 255 |
| 298 | 3300025905 | Ga0207685_10002720 | Ga0207685_100027203 | 255 |
| 299 | 3300025906 | Ga0207699_10004058 | Ga0207699_100040588 | 255 |
| 300 | 3300025906 | Ga0207699_10006833 | Ga0207699_100068332 | 255 |
| 301 | 3300025906 | Ga0207699_10044442 | Ga0207699_100444423 | 255 |
| 302 | 3300025907 | Ga0207645_10145403 | Ga0207645_101454032 | 255 |
| 303 | 3300025908 | Ga0207643_10020448 | Ga0207643_100204484 | 255 |
| 304 | 3300025909 | Ga0207705_10667824 | Ga0207705_106678241 | 255 |
| 305 | 3300025910 | Ga0207684_10002280 | Ga0207684_1000228014 | 255 |
| 306 | 3300025910 | Ga0207684_10013750 | Ga0207684_100137505 | 255 |
| 307 | 3300025911 | Ga0207654_10045012 | Ga0207654_100450122 | 255 |
| 308 | 3300025911 | Ga0207654_10410524 | Ga0207654_104105241 | 255 |
| 309 | 3300025915 | Ga0207693_10033573 | Ga0207693_100335733 | 255 |
| 310 | 3300025916 | Ga0207663_10054706 | Ga0207663_100547062 | 255 |
| 311 | 3300025916 | Ga0207663_10062499 | Ga0207663_100624991 | 255 |
| 312 | 3300025916 | Ga0207663_10160499 | Ga0207663_101604991 | 255 |
| 313 | 3300025916 | Ga0207663_10219928 | Ga0207663_102199282 | 255 |
| 314 | 3300025918 | Ga0207662_10029413 | Ga0207662_100294131 | 255 |
| 315 | 3300025919 | Ga0207657_10026274 | Ga0207657_100262746 | 255 |
| 316 | 3300025922 | Ga0207646_10004735 | Ga0207646_100047352 | 255 |
| 317 | 3300025924 | Ga0207694_10226138 | Ga0207694_102261382 | 255 |
| 318 | 3300025927 | Ga0207687_10624917 | Ga0207687_106249171 | 255 |
| 319 | 3300025928 | Ga0207700_10001080 | Ga0207700_1000108011 | 255 |
| 320 | 3300025928 | Ga0207700_10012073 | Ga0207700_100120736 | 255 |
| 321 | 3300025929 | Ga0207664_10016258 | Ga0207664_100162583 | 255 |
| 322 | 3300025929 | Ga0207664_10107176 | Ga0207664_101071763 | 255 |
| 323 | 3300025929 | Ga0207664_10168529 | Ga0207664_101685292 | 255 |
| 324 | 3300025929 | Ga0207664_10320687 | Ga0207664_103206872 | 255 |
| 325 | 3300025931 | Ga0207644_10141107 | Ga0207644_101411071 | 255 |
| 326 | 3300025932 | Ga0207690_10481025 | Ga0207690_104810251 | 255 |
| 327 | 3300025933 | Ga0207706_10050882 | Ga0207706_100508823 | 255 |
| 328 | 3300025935 | Ga0207709_10240915 | Ga0207709_102409151 | 255 |
| 329 | 3300025939 | Ga0207665_10009530 | Ga0207665_100095301 | 255 |
| 330 | 3300025939 | Ga0207665_10160643 | Ga0207665_101606432 | 255 |
| 331 | 3300025940 | Ga0207691_10062115 | Ga0207691_100621154 | 255 |
| 332 | 3300025942 | Ga0207689_10014748 | Ga0207689_100147483 | 255 |
| 333 | 3300025960 | Ga0207651_10235081 | Ga0207651_102350813 | 255 |
| 334 | 3300026023 | Ga0207677_10223321 | Ga0207677_102233211 | 255 |
| 335 | 3300026041 | Ga0207639_10203090 | Ga0207639_102030903 | 255 |
| 336 | 3300026067 | Ga0207678_10016213 | Ga0207678_100162136 | 255 |
| 337 | 3300026075 | Ga0207708_10126387 | Ga0207708_101263873 | 255 |
| 338 | 3300026078 | Ga0207702_10353729 | Ga0207702_103537291 | 255 |
| 339 | 3300026078 | Ga0207702_10773657 | Ga0207702_107736571 | 255 |
| 340 | 3300026088 | Ga0207641_10213810 | Ga0207641_102138103 | 255 |
| 341 | 3300026116 | Ga0207674_10021991 | Ga0207674_100219917 | 255 |
| 342 | 3300026118 | Ga0207675_100177918 | Ga0207675_1001779183 | 255 |
| 343 | 3300026121 | Ga0207683_10015880 | Ga0207683_100158804 | 255 |
| 344 | 3300028379 | Ga0268266_10473301 | Ga0268266_104733012 | 255 |
| 345 | 3300028381 | Ga0268264_10937516 | Ga0268264_109375161 | 255 |
| 346 | 3300028786 | Ga0307517_10003996 | Ga0307517_1000399618 | 255 |
| 347 | 3300028786 | Ga0307517_10082973 | Ga0307517_100829732 | 255 |
| 348 | 3300028794 | Ga0307515_10100229 | Ga0307515_101002292 | 255 |
| 349 | 3300030521 | Ga0307511_10103126 | Ga0307511_101031263 | 255 |
| 350 | 3300031507 | Ga0307509_10526326 | Ga0307509_105263261 | 255 |
| 351 | 3300031616 | Ga0307508_10006889 | Ga0307508_100068894 | 255 |
| 352 | 3300031616 | Ga0307508_10008020 | Ga0307508_100080203 | 255 |
| 353 | 3300031649 | Ga0307514_10017946 | Ga0307514_100179463 | 255 |
| 354 | 3300031649 | Ga0307514_10109544 | Ga0307514_101095442 | 255 |
| 355 | 3300031730 | Ga0307516_10009624 | Ga0307516_100096244 | 255 |
| 356 | 3300031838 | Ga0307518_10001359 | Ga0307518_1000135910 | 255 |
| 357 | 3300033179 | Ga0307507_10000001 | Ga0307507_10000001178 | 255 |
| 358 | 3300033179 | Ga0307507_10046326 | Ga0307507_100463264 | 255 |
| 359 | 3300033180 | Ga0307510_10163415 | Ga0307510_101634153 | 255 |
| 360 | 3300034817 | Ga0373948_0060325 | Ga0373948_0060325_25_792 | 255 |
| 361 | 3300034818 | Ga0373950_0004197 | Ga0373950_0004197_1014_1781 | 255 |
| 362 | 3300034957 | Ga0373938_0027600 | Ga0373938_0027600_79_846 | 255 |
| 363 | 3300035083 | Ga0373926_0002249 | Ga0373926_0002249_3020_3814 | 255 |
| 364 | 3300035084 | Ga0373928_0027356 | Ga0373928_0027356_309_1076 | 255 |
| 365 | 3300035085 | Ga0373929_0008712 | Ga0373929_0008712_27_794 | 255 |
| 366 | 3300035088 | Ga0373940_0010414 | Ga0373940_0010414_854_1621 | 255 |
| 367 | 3300035089 | Ga0373944_0031331 | Ga0373944_0031331_23_790 | 255 |
| 368 | 3300035091 | Ga0373951_0002912 | Ga0373951_0002912_1155_1922 | 255 |
| 369 | 3300035091 | Ga0373951_0012983 | Ga0373951_0012983_391_1158 | 255 |
| 370 | 3300035092 | Ga0373952_0012635 | Ga0373952_0012635_253_1020 | 255 |
| 371 | 3300035092 | Ga0373952_0014464 | Ga0373952_0014464_793_1560 | 255 |
| 372 | 3300035111 | Ga0373923_0000435 | Ga0373923_0000435_8807_9601 | 255 |
| 373 | 3300035113 | Ga0373936_0041467 | Ga0373936_0041467_826_1620 | 255 |
| 374 | 3300035116 | Ga0373945_0004083 | Ga0373945_0004083_2940_3707 | 255 |
| 375 | 3300035116 | Ga0373945_0030614 | Ga0373945_0030614_305_1099 | 255 |
| 376 | 3300035117 | Ga0373953_0025805 | Ga0373953_0025805_960_1727 | 255 |
| 377 | 3300035118 | Ga0373954_0021708 | Ga0373954_0021708_2058_2825 | 255 |
| 378 | 3300035118 | Ga0373954_0022369 | Ga0373954_0022369_776_1543 | 255 |
| 379 | 3300035118 | Ga0373954_0042000 | Ga0373954_0042000_526_1320 | 255 |
| 380 | 3300035119 | Ga0373956_0004929 | Ga0373956_0004929_2142_2909 | 255 |
| 381 | 3300035119 | Ga0373956_0017432 | Ga0373956_0017432_2195_2989 | 255 |
| 382 | 3300035120 | Ga0373957_0004915 | Ga0373957_0004915_1936_2703 | 255 |
| 383 | 3300035170 | Ga0373943_0013389 | Ga0373943_0013389_102_896 | 255 |
| 384 | 3300035171 | Ga0373946_0149562 | Ga0373946_0149562_23_790 | 255 |
| 385 | 3300035172 | Ga0373955_0005979 | Ga0373955_0005979_2513_3280 | 255 |
| 386 | 3300035172 | Ga0373955_0057093 | Ga0373955_0057093_433_1227 | 255 |
| 387 | 3300035241 | Ga0373961_0003784 | Ga0373961_0003784_1254_2021 | 255 |
| 388 | 3300035242 | Ga0373962_0024557 | Ga0373962_0024557_385_1152 | 255 |
| 389 | 3300035410 | Ga0373924_0000454 | Ga0373924_0000454_143_937 | 255 |
| 390 | 3300035410 | Ga0373924_0004238 | Ga0373924_0004238_662_1429 | 255 |
| 391 | 3300035692 | Ga0373935_0016635 | Ga0373935_0016635_826_1620 | 255 |
| 392 | 3300035692 | Ga0373935_0017464 | Ga0373935_0017464_3563_4330 | 255 |
| 393 | 3300035695 | Ga0373927_0004257 | Ga0373927_0004257_9234_10028 | 255 |
| 394 | 3300035724 | Ga0373933_0005701 | Ga0373933_0005701_749_1516 | 255 |
| 395 | 3300035724 | Ga0373933_0081207 | Ga0373933_0081207_396_1190 | 255 |
| 396 | 3300035724 | Ga0373933_0153897 | Ga0373933_0153897_559_1326 | 255 |
| 397 | 3300036401 | Ga0373937_0121282 | Ga0373937_0121282_1345_2112 | 255 |
| 398 | 3300037068 | Ga0373925_0012060 | Ga0373925_0012060_4252_5019 | 255 |
| 399 | 3300037068 | Ga0373925_0042762 | Ga0373925_0042762_1865_2659 | 255 |
| 400 | 3300037068 | Ga0373925_0070660 | Ga0373925_0070660_1245_2012 | 255 |
| 401 | 3300044656 | Ga0466969_0072327 | Ga0466969_0072327_658_1425 | 255 |
| 402 | 3300044693 | Ga0466961_0049742 | Ga0466961_0049742_1514_2281 | 255 |
| 403 | 3300044693 | Ga0466961_0182511 | Ga0466961_0182511_428_1231 | 255 |
| 404 | 3300044719 | Ga0466971_0000965 | Ga0466971_0000965_363_1130 | 255 |
| 405 | 3300044901 | Ga0466960_0006561 | Ga0466960_0006561_879_1646 | 255 |
| 406 | 3300045049 | Ga0466959_0080113 | Ga0466959_0080113_439_1209 | 255 |
| 407 | 3300045049 | Ga0466959_0152618 | Ga0466959_0152618_643_1410 | 255 |
| 408 | 3300045976 | Ga0466967_0084091 | Ga0466967_0084091_1344_2111 | 255 |
| 409 | 3300046452 | Ga0495617_026579 | Ga0495617_026579_731_1498 | 255 |
| 410 | 3300046454 | Ga0495592_0014690 | Ga0495592_0014690_2757_3524 | 255 |
| 411 | 3300046454 | Ga0495592_0033900 | Ga0495592_0033900_2385_3152 | 255 |
| 412 | 3300046454 | Ga0495592_0045453 | Ga0495592_0045453_266_1033 | 255 |
| 413 | 3300046454 | Ga0495592_0045497 | Ga0495592_0045497_2411_3178 | 255 |
| 414 | 3300046454 | Ga0495592_0053639 | Ga0495592_0053639_1159_1953 | 255 |
| 415 | 3300046455 | Ga0495603_0012804 | Ga0495603_0012804_2576_3343 | 255 |
| 416 | 3300046455 | Ga0495603_0016005 | Ga0495603_0016005_685_1479 | 255 |
| 417 | 3300046455 | Ga0495603_0038840 | Ga0495603_0038840_416_1183 | 255 |
| 418 | 3300046455 | Ga0495603_0179274 | Ga0495603_0179274_159_926 | 255 |
| 419 | 3300046459 | Ga0495629_0000836 | Ga0495629_0000836_20780_21547 | 255 |
| 420 | 3300046459 | Ga0495629_0004490 | Ga0495629_0004490_9290_10057 | 255 |
| 421 | 3300046459 | Ga0495629_0005491 | Ga0495629_0005491_3997_4764 | 255 |
| 422 | 3300046459 | Ga0495629_0006360 | Ga0495629_0006360_6229_7065 | 255 |
| 423 | 3300046459 | Ga0495629_0010061 | Ga0495629_0010061_945_1712 | 255 |
| 424 | 3300046459 | Ga0495629_0024501 | Ga0495629_0024501_2808_3602 | 255 |
| 425 | 3300046459 | Ga0495629_0061358 | Ga0495629_0061358_1763_2530 | 255 |
| 426 | 3300046459 | Ga0495629_0072046 | Ga0495629_0072046_625_1392 | 255 |
| 427 | 3300046460 | Ga0495638_0056436 | Ga0495638_0056436_863_1630 | 255 |
| 428 | 3300046460 | Ga0495638_0091605 | Ga0495638_0091605_1000_1767 | 255 |
| 429 | 3300046461 | Ga0495641_0024973 | Ga0495641_0024973_162_956 | 255 |
| 430 | 3300046462 | Ga0495651_0001022 | Ga0495651_0001022_14736_15503 | 255 |
| 431 | 3300046462 | Ga0495651_0023969 | Ga0495651_0023969_727_1494 | 255 |
| 432 | 3300046462 | Ga0495651_0093672 | Ga0495651_0093672_559_1326 | 255 |
| 433 | 3300046462 | Ga0495651_0170996 | Ga0495651_0170996_527_1321 | 255 |
| 434 | 3300046463 | Ga0495653_0004386 | Ga0495653_0004386_2385_3152 | 255 |
| 435 | 3300046463 | Ga0495653_0111899 | Ga0495653_0111899_464_1258 | 255 |
| 436 | 3300046472 | Ga0495580_0147458 | Ga0495580_0147458_549_1316 | 255 |
| 437 | 3300046473 | Ga0495582_0003713 | Ga0495582_0003713_6330_7097 | 255 |
| 438 | 3300046473 | Ga0495582_0004944 | Ga0495582_0004944_5981_6775 | 255 |
| 439 | 3300046473 | Ga0495582_0258441 | Ga0495582_0258441_74_841 | 255 |
| 440 | 3300046474 | Ga0495605_0002245 | Ga0495605_0002245_5317_6084 | 255 |
| 441 | 3300046475 | Ga0495639_0007870 | Ga0495639_0007870_3561_4355 | 255 |
| 442 | 3300046475 | Ga0495639_0010514 | Ga0495639_0010514_2770_3537 | 255 |
| 443 | 3300046475 | Ga0495639_0141643 | Ga0495639_0141643_25_792 | 255 |
| 444 | 3300046476 | Ga0495662_0004950 | Ga0495662_0004950_442_1209 | 255 |
| 445 | 3300046476 | Ga0495662_0007733 | Ga0495662_0007733_1865_2659 | 255 |
| 446 | 3300046477 | Ga0495664_0001319 | Ga0495664_0001319_9881_10648 | 255 |
| 447 | 3300046477 | Ga0495664_0007276 | Ga0495664_0007276_2638_3405 | 255 |
| 448 | 3300046477 | Ga0495664_0152538 | Ga0495664_0152538_250_1017 | 255 |
| 449 | 3300046499 | Ga0495594_0001045 | Ga0495594_0001045_4078_4845 | 255 |
| 450 | 3300046499 | Ga0495594_0009856 | Ga0495594_0009856_766_1533 | 255 |
| 451 | 3300046499 | Ga0495594_0035381 | Ga0495594_0035381_1799_2566 | 255 |
| 452 | 3300046499 | Ga0495594_0047042 | Ga0495594_0047042_650_1444 | 255 |
| 453 | 3300046499 | Ga0495594_0190126 | Ga0495594_0190126_74_841 | 255 |
| 454 | 3300046499 | Ga0495594_0191644 | Ga0495594_0191644_87_854 | 255 |
| 455 | 3300046501 | Ga0495607_0042005 | Ga0495607_0042005_1599_2366 | 255 |
| 456 | 3300046501 | Ga0495607_0151885 | Ga0495607_0151885_24_791 | 255 |
| 457 | 3300046507 | Ga0495606_0025633 | Ga0495606_0025633_558_1325 | 255 |
| 458 | 3300046511 | Ga0495608_0010309 | Ga0495608_0010309_18_785 | 255 |
| 459 | 3300046511 | Ga0495608_0027396 | Ga0495608_0027396_726_1493 | 255 |
| 460 | 3300046514 | Ga0495618_0023883 | Ga0495618_0023883_2687_3481 | 255 |
| 461 | 3300046514 | Ga0495618_0256398 | Ga0495618_0256398_96_863 | 255 |
| 462 | 3300046515 | Ga0495620_0000455 | Ga0495620_0000455_12081_12848 | 255 |
| 463 | 3300046516 | Ga0495628_0015023 | Ga0495628_0015023_4881_5648 | 255 |
| 464 | 3300046516 | Ga0495628_0034078 | Ga0495628_0034078_1825_2619 | 255 |
| 465 | 3300046516 | Ga0495628_0049501 | Ga0495628_0049501_1281_2048 | 255 |
| 466 | 3300046516 | Ga0495628_0069077 | Ga0495628_0069077_1327_2094 | 255 |
| 467 | 3300046516 | Ga0495628_0348837 | Ga0495628_0348837_93_860 | 255 |
| 468 | 3300046517 | Ga0495630_0012682 | Ga0495630_0012682_1433_2200 | 255 |
| 469 | 3300046517 | Ga0495630_0131920 | Ga0495630_0131920_799_1593 | 255 |
| 470 | 3300046518 | Ga0495631_0013538 | Ga0495631_0013538_2237_3004 | 255 |
| 471 | 3300046519 | Ga0495632_0018577 | Ga0495632_0018577_959_1726 | 255 |
| 472 | 3300046520 | Ga0495637_0134948 | Ga0495637_0134948_134_901 | 255 |
| 473 | 3300046522 | Ga0495643_0002871 | Ga0495643_0002871_6078_6845 | 255 |
| 474 | 3300046524 | Ga0495648_0199047 | Ga0495648_0199047_95_862 | 255 |
| 475 | 3300046526 | Ga0495666_0001661 | Ga0495666_0001661_9748_10542 | 255 |
| 476 | 3300046526 | Ga0495666_0002088 | Ga0495666_0002088_4775_5542 | 255 |
| 477 | 3300046526 | Ga0495666_0033644 | Ga0495666_0033644_908_1675 | 255 |
| 478 | 3300046529 | Ga0495652_0002425 | Ga0495652_0002425_8091_8858 | 255 |
| 479 | 3300046529 | Ga0495652_0162716 | Ga0495652_0162716_747_1514 | 255 |
| 480 | 3300046529 | Ga0495652_0282997 | Ga0495652_0282997_190_957 | 255 |
| 481 | 3300046531 | Ga0495665_0004492 | Ga0495665_0004492_1434_2201 | 255 |
| 482 | 3300046531 | Ga0495665_0014555 | Ga0495665_0014555_1916_2683 | 255 |
| 483 | 3300046531 | Ga0495665_0070032 | Ga0495665_0070032_439_1206 | 255 |
| 484 | 3300046533 | Ga0495640_0005341 | Ga0495640_0005341_8899_9666 | 255 |
| 485 | 3300046533 | Ga0495640_0012603 | Ga0495640_0012603_1469_2305 | 255 |
| 486 | 3300046533 | Ga0495640_0013060 | Ga0495640_0013060_5292_6059 | 255 |
| 487 | 3300046533 | Ga0495640_0015518 | Ga0495640_0015518_433_1227 | 255 |
| 488 | 3300046533 | Ga0495640_0151474 | Ga0495640_0151474_577_1344 | 255 |
| 489 | 3300046533 | Ga0495640_0326025 | Ga0495640_0326025_52_819 | 255 |
| 490 | 3300046535 | Ga0495586_0002343 | Ga0495586_0002343_1233_2000 | 255 |
| 491 | 3300046535 | Ga0495586_0063470 | Ga0495586_0063470_889_1683 | 255 |
| 492 | 3300046535 | Ga0495586_0127673 | Ga0495586_0127673_625_1392 | 255 |
| 493 | 3300046536 | Ga0495587_0027475 | Ga0495587_0027475_2637_3404 | 255 |
| 494 | 3300046536 | Ga0495587_0030120 | Ga0495587_0030120_2259_3026 | 255 |
| 495 | 3300046536 | Ga0495587_0036601 | Ga0495587_0036601_294_1088 | 255 |
| 496 | 3300046536 | Ga0495587_0060874 | Ga0495587_0060874_13_780 | 255 |
| 497 | 3300046543 | Ga0495645_0002788 | Ga0495645_0002788_9465_10232 | 255 |
| 498 | 3300046543 | Ga0495645_0083489 | Ga0495645_0083489_960_1727 | 255 |
| 499 | 3300046543 | Ga0495645_0097731 | Ga0495645_0097731_1070_1864 | 255 |
| 500 | 3300046557 | Ga0495622_0009578 | Ga0495622_0009578_2952_3719 | 255 |
| 501 | 3300046557 | Ga0495622_0012820 | Ga0495622_0012820_745_1512 | 255 |
| 502 | 3300046557 | Ga0495622_0137750 | Ga0495622_0137750_303_1097 | 255 |
| 503 | 3300046558 | Ga0495633_0119215 | Ga0495633_0119215_130_897 | 255 |
| 504 | 3300046559 | Ga0495667_0003857 | Ga0495667_0003857_6072_6839 | 255 |
| 505 | 3300046559 | Ga0495667_0041644 | Ga0495667_0041644_2025_2819 | 255 |
| 506 | 3300046559 | Ga0495667_0081560 | Ga0495667_0081560_164_931 | 255 |
| 507 | 3300046616 | Ga0495668_0028920 | Ga0495668_0028920_895_1662 | 255 |
| 508 | 3300046642 | Ga0495634_0004501 | Ga0495634_0004501_5001_5768 | 255 |
| 509 | 3300046642 | Ga0495634_0021767 | Ga0495634_0021767_2906_3700 | 255 |
| 510 | 3300046642 | Ga0495634_0021868 | Ga0495634_0021868_35_802 | 255 |
| 511 | 3300046642 | Ga0495634_0023671 | Ga0495634_0023671_1263_2099 | 255 |
| 512 | 3300046642 | Ga0495634_0045897 | Ga0495634_0045897_1478_2245 | 255 |
| 513 | 3300046642 | Ga0495634_0082931 | Ga0495634_0082931_491_1258 | 255 |
| 514 | 3300046642 | Ga0495634_0245846 | Ga0495634_0245846_311_1078 | 255 |
| 515 | 3300046648 | Ga0495611_0024512 | Ga0495611_0024512_28_795 | 255 |
| 516 | 3300046660 | Ga0495625_0007372 | Ga0495625_0007372_6598_7365 | 255 |
| 517 | 3300046660 | Ga0495625_0010156 | Ga0495625_0010156_3435_4262 | 255 |
| 518 | 3300046663 | Ga0495635_0007633 | Ga0495635_0007633_6646_7413 | 255 |
| 519 | 3300046663 | Ga0495635_0008131 | Ga0495635_0008131_5399_6166 | 255 |
| 520 | 3300046663 | Ga0495635_0015068 | Ga0495635_0015068_4468_5262 | 255 |
| 521 | 3300046663 | Ga0495635_0053396 | Ga0495635_0053396_1458_2225 | 255 |
| 522 | 3300046674 | Ga0495588_0004093 | Ga0495588_0004093_4461_5228 | 255 |
| 523 | 3300046674 | Ga0495588_0114447 | Ga0495588_0114447_204_998 | 255 |
| 524 | 3300046675 | Ga0495657_0010807 | Ga0495657_0010807_3704_4471 | 255 |
| 525 | 3300046675 | Ga0495657_0010888 | Ga0495657_0010888_217_984 | 255 |
| 526 | 3300046675 | Ga0495657_0031604 | Ga0495657_0031604_1885_2721 | 255 |
| 527 | 3300046675 | Ga0495657_0032391 | Ga0495657_0032391_2636_3430 | 255 |
| 528 | 3300046675 | Ga0495657_0049099 | Ga0495657_0049099_1379_2146 | 255 |
| 529 | 3300046678 | Ga0495599_0007565 | Ga0495599_0007565_621_1388 | 255 |
| 530 | 3300046678 | Ga0495599_0012736 | Ga0495599_0012736_133_900 | 255 |
| 531 | 3300046678 | Ga0495599_0089283 | Ga0495599_0089283_13_780 | 255 |
| 532 | 3300046679 | Ga0495623_0008306 | Ga0495623_0008306_2785_3552 | 255 |
| 533 | 3300046679 | Ga0495623_0064087 | Ga0495623_0064087_146_940 | 255 |
| 534 | 3300046679 | Ga0495623_0064595 | Ga0495623_0064595_750_1517 | 255 |
| 535 | 3300046679 | Ga0495623_0189449 | Ga0495623_0189449_141_908 | 255 |
| 536 | 3300046680 | Ga0495646_0019984 | Ga0495646_0019984_1332_2099 | 255 |
| 537 | 3300046680 | Ga0495646_0062755 | Ga0495646_0062755_695_1462 | 255 |
| 538 | 3300046680 | Ga0495646_0136976 | Ga0495646_0136976_433_1227 | 255 |
| 539 | 3300046681 | Ga0495647_0026156 | Ga0495647_0026156_1021_1815 | 255 |
| 540 | 3300046681 | Ga0495647_0072686 | Ga0495647_0072686_150_917 | 255 |
| 541 | 3300046683 | Ga0495658_0005743 | Ga0495658_0005743_5032_5799 | 255 |
| 542 | 3300046683 | Ga0495658_0010831 | Ga0495658_0010831_2848_3642 | 255 |
| 543 | 3300046689 | Ga0495613_0003025 | Ga0495613_0003025_4126_4893 | 255 |
| 544 | 3300046689 | Ga0495613_0005122 | Ga0495613_0005122_4510_5277 | 255 |
| 545 | 3300046689 | Ga0495613_0023132 | Ga0495613_0023132_3547_4314 | 255 |
| 546 | 3300046689 | Ga0495613_0029702 | Ga0495613_0029702_1932_2699 | 255 |
| 547 | 3300046689 | Ga0495613_0060637 | Ga0495613_0060637_211_978 | 255 |
| 548 | 3300046689 | Ga0495613_0069303 | Ga0495613_0069303_471_1265 | 255 |
| 549 | 3300046690 | Ga0495624_0039786 | Ga0495624_0039786_1542_2309 | 255 |
| 550 | 3300046690 | Ga0495624_0051884 | Ga0495624_0051884_1434_2201 | 255 |
| 551 | 3300046690 | Ga0495624_0087868 | Ga0495624_0087868_899_1693 | 255 |
| 552 | 3300046690 | Ga0495624_0119267 | Ga0495624_0119267_426_1193 | 255 |
| 553 | 3300046690 | Ga0495624_0182519 | Ga0495624_0182519_101_868 | 255 |
| 554 | 3300046691 | Ga0495670_0015625 | Ga0495670_0015625_1841_2608 | 255 |
| 555 | 3300046794 | Ga0495589_0003390 | Ga0495589_0003390_2851_3618 | 255 |
| 556 | 3300046794 | Ga0495589_0052648 | Ga0495589_0052648_1137_1904 | 255 |
| 557 | 3300046809 | Ga0495600_0050328 | Ga0495600_0050328_284_1051 | 255 |
| 558 | 3300046809 | Ga0495600_0064913 | Ga0495600_0064913_146_913 | 255 |
| 559 | 3300046809 | Ga0495600_0288394 | Ga0495600_0288394_13_780 | 255 |
| 560 | 3300046810 | Ga0495660_0016153 | Ga0495660_0016153_3297_4064 | 255 |
| 561 | 3300046810 | Ga0495660_0074594 | Ga0495660_0074594_525_1292 | 255 |
| 562 | 3300047315 | Ga0495581_0005449 | Ga0495581_0005449_4872_5639 | 255 |
| 563 | 3300047317 | Ga0495604_0001004 | Ga0495604_0001004_8655_9422 | 255 |
| 564 | 3300047317 | Ga0495604_0012553 | Ga0495604_0012553_4518_5285 | 255 |
| 565 | 3300047317 | Ga0495604_0030807 | Ga0495604_0030807_27_794 | 255 |
| 566 | 3300047317 | Ga0495604_0037705 | Ga0495604_0037705_987_1781 | 255 |
| 567 | 3300047319 | Ga0495674_0014892 | Ga0495674_0014892_455_1222 | 255 |
| 568 | 3300047319 | Ga0495674_0036738 | Ga0495674_0036738_2941_3708 | 255 |
| 569 | 3300047319 | Ga0495674_0179172 | Ga0495674_0179172_826_1620 | 255 |
| 570 | 3300047321 | Ga0495676_0003552 | Ga0495676_0003552_13184_13951 | 255 |
| 571 | 3300047321 | Ga0495676_0013326 | Ga0495676_0013326_6320_7156 | 255 |
| 572 | 3300047321 | Ga0495676_0014465 | Ga0495676_0014465_3075_3842 | 255 |
| 573 | 3300047321 | Ga0495676_0058495 | Ga0495676_0058495_1164_1958 | 255 |
| 574 | 3300047322 | Ga0495680_0006725 | Ga0495680_0006725_218_1012 | 255 |
| 575 | 3300047322 | Ga0495680_0014193 | Ga0495680_0014193_5362_6129 | 255 |
| 576 | 3300047322 | Ga0495680_0021859 | Ga0495680_0021859_116_883 | 255 |
| 577 | 3300047322 | Ga0495680_0115465 | Ga0495680_0115465_782_1549 | 255 |
| 578 | 3300047323 | Ga0495683_0096765 | Ga0495683_0096765_548_1315 | 255 |
| 579 | 3300047323 | Ga0495683_0106159 | Ga0495683_0106159_156_923 | 255 |
| 580 | 3300047443 | Ga0495687_013487 | Ga0495687_013487_15_782 | 255 |
| 581 | 3300047443 | Ga0495687_036461 | Ga0495687_036461_280_1047 | 255 |
| 582 | 3300047444 | Ga0495675_0010768 | Ga0495675_0010768_1266_2033 | 255 |
| 583 | 3300047444 | Ga0495675_0021793 | Ga0495675_0021793_1907_2674 | 255 |
| 584 | 3300047444 | Ga0495675_0052262 | Ga0495675_0052262_1658_2452 | 255 |
| 585 | 3300047447 | Ga0495685_000145 | Ga0495685_000145_9593_10360 | 255 |
| 586 | 3300047470 | Ga0495681_0003982 | Ga0495681_0003982_8883_9650 | 255 |
| 587 | 3300047471 | Ga0495684_0014703 | Ga0495684_0014703_621_1388 | 255 |
| 588 | 3300047471 | Ga0495684_0073969 | Ga0495684_0073969_1095_1862 | 255 |
| 589 | 3300047472 | Ga0495686_0075165 | Ga0495686_0075165_305_1072 | 255 |
| 590 | 3300047472 | Ga0495686_0105025 | Ga0495686_0105025_516_1283 | 255 |
| 591 | 3300047673 | Ga0495593_0003238 | Ga0495593_0003238_926_1720 | 255 |
| 592 | 3300047673 | Ga0495593_0003876 | Ga0495593_0003876_337_1104 | 255 |
| 593 | 3300047673 | Ga0495593_0111406 | Ga0495593_0111406_499_1266 | 255 |
| 594 | 3300048088 | Ga0495602_0049852 | Ga0495602_0049852_2530_3297 | 255 |
| 595 | 3300048088 | Ga0495602_0070060 | Ga0495602_0070060_133_900 | 255 |
| 596 | 3300048088 | Ga0495602_0137503 | Ga0495602_0137503_18_785 | 255 |
| 597 | 3300048089 | Ga0495614_0003028 | Ga0495614_0003028_292_1059 | 255 |
| 598 | 3300048089 | Ga0495614_0004258 | Ga0495614_0004258_3480_4247 | 255 |
| 599 | 3300048089 | Ga0495614_0025498 | Ga0495614_0025498_560_1354 | 255 |
| 600 | 3300048089 | Ga0495614_0037431 | Ga0495614_0037431_295_1062 | 255 |
| 601 | 3300048903 | Ga0496100_0099229 | Ga0496100_0099229_471_1238 | 255 |
| 602 | 3300048903 | Ga0496100_0199183 | Ga0496100_0199183_382_1149 | 255 |
| 603 | 3300048904 | Ga0496101_0064146 | Ga0496101_0064146_1558_2325 | 255 |
| 604 | 3300048904 | Ga0496101_0092880 | Ga0496101_0092880_688_1455 | 255 |
| 605 | 3300048905 | Ga0496102_0093559 | Ga0496102_0093559_388_1155 | 255 |
| 606 | 3300048906 | Ga0496103_0223958 | Ga0496103_0223958_82_849 | 255 |
| 607 | 3300048907 | Ga0496104_0232228 | Ga0496104_0232228_80_847 | 255 |
| 608 | 3300048907 | Ga0496104_0233646 | Ga0496104_0233646_27_794 | 255 |
| 609 | 3300048907 | Ga0496104_0338918 | Ga0496104_0338918_365_1132 | 255 |
| 610 | 3300048908 | Ga0496105_0015001 | Ga0496105_0015001_4544_5311 | 255 |
| 611 | 3300048908 | Ga0496105_0266428 | Ga0496105_0266428_548_1315 | 255 |
| 612 | 3300048909 | Ga0496106_0031752 | Ga0496106_0031752_196_963 | 255 |
| 613 | 3300048910 | Ga0496107_0101353 | Ga0496107_0101353_1168_1935 | 255 |
| 614 | 3300048910 | Ga0496107_0105321 | Ga0496107_0105321_1047_1814 | 255 |
| 615 | 3300048911 | Ga0496108_0230016 | Ga0496108_0230016_458_1225 | 255 |
| 616 | 3300048913 | Ga0496110_0174299 | Ga0496110_0174299_24_791 | 255 |
| 617 | 3300048913 | Ga0496110_0618668 | Ga0496110_0618668_43_810 | 255 |
| 618 | 3300048914 | Ga0496111_0015895 | Ga0496111_0015895_330_1097 | 255 |
| 619 | 3300048915 | Ga0496112_0018611 | Ga0496112_0018611_2878_3645 | 255 |
| 620 | 3300048916 | Ga0496113_0145661 | Ga0496113_0145661_1042_1809 | 255 |
| 621 | 3300048916 | Ga0496113_0600300 | Ga0496113_0600300_33_800 | 255 |
| 622 | 3300048918 | Ga0496115_0025010 | Ga0496115_0025010_2862_3629 | 255 |
| 623 | 3300048918 | Ga0496115_0430117 | Ga0496115_0430117_16_783 | 255 |
| 624 | 3300048929 | Ga0496126_0013418 | Ga0496126_0013418_4181_4987 | 255 |
| 625 | 3300049459 | Ga0495678_088253 | Ga0495678_088253_285_1052 | 255 |
| 626 | 3300049568 | Ga0501031_0004715 | Ga0501031_0004715_2760_3527 | 255 |
| 627 | 3300049569 | Ga0501032_0005462 | Ga0501032_0005462_2720_3487 | 255 |
| 628 | 3300049569 | Ga0501032_0213173 | Ga0501032_0213173_32_799 | 255 |
| 629 | 3300049570 | Ga0501033_0145999 | Ga0501033_0145999_656_1423 | 255 |
| 630 | 3300049570 | Ga0501033_0228351 | Ga0501033_0228351_210_977 | 255 |
| 631 | 3300049571 | Ga0501034_0203104 | Ga0501034_0203104_1032_1799 | 255 |
| 632 | 3300049572 | Ga0501036_0315567 | Ga0501036_0315567_265_1032 | 255 |
| 633 | 3300049573 | Ga0501037_0178252 | Ga0501037_0178252_578_1345 | 255 |
| 634 | 3300049574 | Ga0501038_0000899 | Ga0501038_0000899_23404_24171 | 255 |
| 635 | 3300049579 | Ga0501043_0376656 | Ga0501043_0376656_149_916 | 255 |
| 636 | 3300049580 | Ga0501046_0079534 | Ga0501046_0079534_1513_2280 | 255 |
| 637 | 3300049581 | Ga0501047_0134540 | Ga0501047_0134540_1433_2200 | 255 |
| 638 | 3300049582 | Ga0501048_0000934 | Ga0501048_0000934_2264_3031 | 255 |
| 639 | 3300049586 | Ga0501070_0010297 | Ga0501070_0010297_4888_5655 | 255 |
| 640 | 3300049822 | Ga0501035_0039216 | Ga0501035_0039216_2880_3647 | 255 |
| 641 | 3300049822 | Ga0501035_0049256 | Ga0501035_0049256_287_1054 | 255 |
| 642 | 3300049822 | Ga0501035_0093900 | Ga0501035_0093900_1733_2542 | 255 |
| 643 | 3300049822 | Ga0501035_0404934 | Ga0501035_0404934_150_917 | 255 |
| 644 | 3300049823 | Ga0501044_0066344 | Ga0501044_0066344_285_1052 | 255 |
| 645 | 3300049823 | Ga0501044_0327653 | Ga0501044_0327653_342_1151 | 255 |
| 646 | 3300049823 | Ga0501044_0331937 | Ga0501044_0331937_194_961 | 255 |
| 647 | 3300049824 | Ga0501045_0609658 | Ga0501045_0609658_10_777 | 255 |
| 648 | 3300050513 | nmdc:mga0rr50_4166_c1 | nmdc:mga0rr50_4166_c1_5094_5861 | 255 |
| 649 | 3300050514 | nmdc:mga08x19_6725_c1 | nmdc:mga08x19_6725_c1_2221_2988 | 255 |
| 650 | 3300050515 | nmdc:mga0a205_279410_c1 | nmdc:mga0a205_279410_c1_558_1325 | 255 |
| 651 | 3300053077 | Ga0495601_0001830 | Ga0495601_0001830_10795_11589 | 255 |
| 652 | 3300053077 | Ga0495601_0005325 | Ga0495601_0005325_4472_5239 | 255 |
| 653 | 3300053077 | Ga0495601_0015275 | Ga0495601_0015275_1117_1884 | 255 |
| 654 | 3300053077 | Ga0495601_0021647 | Ga0495601_0021647_477_1244 | 255 |
| 655 | 3300053077 | Ga0495601_0057414 | Ga0495601_0057414_30_797 | 255 |
| 656 | 3300053078 | Ga0495612_0001000 | Ga0495612_0001000_7197_7964 | 255 |
| 657 | 3300053078 | Ga0495612_0004060 | Ga0495612_0004060_4790_5557 | 255 |
| 658 | 3300053078 | Ga0495612_0006137 | Ga0495612_0006137_73_840 | 255 |
| 659 | 3300053083 | Ga0495655_0008073 | Ga0495655_0008073_676_1443 | 255 |
| 660 | 3300053084 | Ga0495595_0009343 | Ga0495595_0009343_2785_3552 | 255 |
| 661 | 3300053084 | Ga0495595_0051040 | Ga0495595_0051040_81_875 | 255 |
| 662 | 3300053084 | Ga0495595_0077779 | Ga0495595_0077779_463_1230 | 255 |
| 663 | 3300053085 | Ga0495619_0002227 | Ga0495619_0002227_5570_6337 | 255 |
| 664 | 3300053085 | Ga0495619_0020414 | Ga0495619_0020414_1769_2563 | 255 |
| 665 | 3300053085 | Ga0495619_0068323 | Ga0495619_0068323_249_1016 | 255 |
| 666 | 3300053086 | Ga0500578_0009224 | Ga0500578_0009224_4685_5452 | 255 |
| 667 | 3300053099 | Ga0500654_064699 | Ga0500654_064699_940_1707 | 255 |
| 668 | 3300053100 | Ga0500660_076483 | Ga0500660_076483_567_1334 | 255 |
| 669 | 3300053107 | Ga0500560_001138 | Ga0500560_001138_3502_4269 | 255 |
| 670 | 3300053131 | Ga0500652_007209 | Ga0500652_007209_1882_2649 | 255 |
| 671 | 3300053134 | Ga0500658_0000847 | Ga0500658_0000847_10033_10800 | 255 |
| 672 | 3300053137 | Ga0500561_0000168 | Ga0500561_0000168_8494_9261 | 255 |
| 673 | 3300053140 | Ga0500573_0002584 | Ga0500573_0002584_5455_6222 | 255 |
| 674 | 3300053143 | Ga0500579_056230 | Ga0500579_056230_611_1378 | 255 |
| 675 | 3300053149 | Ga0500600_0002727 | Ga0500600_0002727_8603_9370 | 255 |
| 676 | 3300053149 | Ga0500600_0137658 | Ga0500600_0137658_420_1187 | 255 |
| 677 | 3300053153 | Ga0500616_0029487 | Ga0500616_0029487_1607_2374 | 255 |
| 678 | 3300053160 | Ga0500633_0000369 | Ga0500633_0000369_296_1063 | 255 |
| 679 | 3300053161 | Ga0500634_0001537 | Ga0500634_0001537_296_1063 | 255 |
| 680 | 3300053739 | Ga0500587_000305 | Ga0500587_000305_3297_4064 | 255 |
| 681 | 3300061719 | Ga0466962_0009387 | Ga0466962_0009387_3331_4098 | 255 |
| 682 | iso_pu_bacteria | 2867369537 | 2867374860 | 255 |
| 683 | iso_pu_bacteria | 8055157932 | 8055158856 | 255 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tb5-assembly2.cif.gz_B | crystal structure of the enterococcus faecalis methionine aminopeptidase apo form | 0.9755 | 1 | 254 |
| 3mr1-assembly2.cif.gz_B | crystal structure of methionine aminopeptidase from rickettsia prowazekii | 0.9738 | 1 | 253 |
| 4juq-assembly1.cif.gz_A | pseudomonas aeruginosa metap t2n mutant, in mn form | 0.972 | 1 | 253 |
| 5yoi-assembly1.cif.gz_A | mycobacterium tuberculosis methionine aminopeptidase type 1c (c105t mutant) in complex with methionine | 0.9698 | 4 | 255 |
| 5yoh-assembly1.cif.gz_A | mycobacterium tuberculosis methionine aminopeptidase type 1c (c105m mutant) in complex with methionine | 0.9698 | 4 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4juqD00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9751 | 1 | 253 | 3.90.230.10 |
| af_P9WK19_6_284_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9702 | 4 | 253 | 3.90.230.10 |
| af_Q9VKV9_33_317_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.969 | 1 | 253 | 3.90.230.10 |
| af_Q4VBS4_53_336_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.969 | 1 | 255 | 3.90.230.10 |
| 1o0xA00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9685 | 1 | 255 | 3.90.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B1P9B0-F1-model_v4 | deleted | 0.9967 | 1 | 214 |
|
| AF-A0A7K1B200-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.996 | 13 | 255 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A0K2RSB2-F1-model_v4 | Methionine aminopeptidase 1 | 0.9936 | 105 | 255 |
GO:0005829
GO:0070006 |
| AF-A0A7W3T825-F1-model_v4 | Methionine aminopeptidase (EC 3.4.11.18) | 0.9927 | 67 | 255 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A6B1P9B0-F1-model_v4 | deleted | 0.992 | 1 | 214 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar