F474997

General Info

Members Datasets Scaffolds Average Seq Length
683 334 650 251

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0006360|Ga0495629_0006360_6229_7065
Length 278
Sequence MAVSRVGARDRKPAPGGEKESQDMVEIKTDAALDAMREAGRVVARALAAVQEAAAVGVSLRELDEAARAVLSEAGARSPFLGYRPSFAPTPFPAVICTSVNDAVVHGIPTGYRLRDGDLVSIDCGAELDGWTGDAAVTFTVGRARPADRELIDATRRALDAGIAAAVPGNRIGDISHAIGAVALAARCGMPADFGGHGIGRRMHEDPHLPNRGRPGRGFPLRHGVALAIEPMLMAGGRDAYRTGPDGWTLSTVDGSRAAHIEHTVAVTHDGPRILTLP

Samples

Sample ID Description Type Environment
1 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
2 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
3 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
4 2643221578 Streptomyces sp. Root63 Isolate Unclassified
5 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
6 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
7 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
8 2643221714 Streptomyces sp. Root264 Isolate Unclassified
9 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
10 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
11 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
12 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
13 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
14 2867369537 Streptomyces sp. Z26 Isolate Unclassified
15 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
16 2891562705 Microbispora tritici MT50 Isolate Unclassified
17 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
18 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
19 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
20 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
21 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
22 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
23 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
24 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
156 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
159 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
160 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
161 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
162 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
163 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
166 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
167 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
168 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
169 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
180 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
181 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
193 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
212 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
216 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
220 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
221 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
222 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
223 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
228 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
231 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
232 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
248 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
249 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
250 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
259 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
260 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
261 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
262 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
263 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
266 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
267 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
284 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
285 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
302 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
303 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
304 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
305 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
306 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
307 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
311 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
312 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
313 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
314 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
315 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
316 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
317 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
318 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
319 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
320 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
321 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
322 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
323 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
324 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
325 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
326 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
327 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
328 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
329 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
330 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
331 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
332 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
333 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
334 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.58
Metatranscriptomes 0.59
Isolates 4.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.2
Nodule 0.15
Rhizoplane 5.12
Rhizosphere 87.26
Stem 0
Stem Tuber 0
Unclassified 5.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10011528 3300003320 Bacteria 2761
2 Ga0070658_10174486 3300005327 Bacteria 1807
3 Ga0070658_10253387 3300005327 Bacteria 1493
4 Ga0070683_100356565 3300005329 Bacteria 1393
5 Ga0070666_10135121 3300005335 Bacteria 1716
6 Ga0070682_100036019 3300005337 Bacteria 3023
7 Ga0070660_100154547 3300005339 Bacteria 1846
8 Ga0070689_100242913 3300005340 Bacteria 1483
9 Ga0070661_100255461 3300005344 Bacteria 1354
10 Ga0070692_10131881 3300005345 Bacteria 1405
11 Ga0070671_100053924 3300005355 Bacteria 3342
12 Ga0070673_100113351 3300005364 Bacteria 2252
13 Ga0070659_100239581 3300005366 Bacteria 1501
14 Ga0070667_100037929 3300005367 Bacteria 4040
15 Ga0070714_100118693 3300005435 Bacteria 2350
16 Ga0070713_100004563 3300005436 Bacteria 9337
17 Ga0070710_10002491 3300005437 Bacteria 8723
18 Ga0070701_10038096 3300005438 Bacteria 2431
19 Ga0070711_100003093 3300005439 Bacteria 9622
20 Ga0070711_100088330 3300005439 Bacteria 2227
21 Ga0070711_100398638 3300005439 Bacteria 1116
22 Ga0070705_100302067 3300005440 Bacteria 1147
23 Ga0070700_100216429 3300005441 Bacteria 1355
24 Ga0070694_100178191 3300005444 Bacteria 1570
25 Ga0070708_100138566 3300005445 Bacteria 2255
26 Ga0070708_100365428 3300005445 Bacteria 1360
27 Ga0070708_100550253 3300005445 Bacteria 1088
28 Ga0070663_100252346 3300005455 Bacteria 1396
29 Ga0070663_100335842 3300005455 Bacteria 1219
30 Ga0070678_100437161 3300005456 Bacteria 1143
31 Ga0070706_100002091 3300005467 Bacteria 20346
32 Ga0070706_100006507 3300005467 Bacteria 11029
33 Ga0070707_100009811 3300005468 Bacteria 8906
34 Ga0070707_100011035 3300005468 Bacteria 8414
35 Ga0070707_100058627 3300005468 Bacteria 3692
36 Ga0070698_100016903 3300005471 Bacteria 7693
37 Ga0070679_100290077 3300005530 Bacteria 1588
38 Ga0070684_100014004 3300005535 Bacteria 6484
39 Ga0070684_100079769 3300005535 Bacteria 2894
40 Ga0070697_100035905 3300005536 Bacteria 4001
41 Ga0070672_100068389 3300005543 Bacteria 2817
42 Ga0070695_100143786 3300005545 Bacteria 1657
43 Ga0070695_100162767 3300005545 Bacteria 1567
44 Ga0070696_100131758 3300005546 Bacteria 1819
45 Ga0070696_100503632 3300005546 Bacteria 964
46 Ga0070693_100190363 3300005547 Bacteria 1326
47 Ga0070665_100044696 3300005548 Bacteria 4448
48 Ga0070665_100048734 3300005548 Bacteria 4253
49 Ga0070704_100113827 3300005549 Bacteria 2064
50 Ga0070704_100372880 3300005549 Bacteria 1210
51 Ga0068855_100082493 3300005563 Bacteria 3726
52 Ga0068855_100446477 3300005563 Bacteria 1412
53 Ga0070664_100196017 3300005564 Bacteria 1800
54 Ga0068857_100124486 3300005577 Bacteria 2323
55 Ga0068856_100077936 3300005614 Bacteria 3285
56 Ga0068856_100136619 3300005614 Bacteria 2457
57 Ga0068864_100061364 3300005618 Bacteria 3256
58 Ga0068851_10109606 3300005834 Bacteria 1473
59 Ga0068870_10340896 3300005840 Bacteria 959
60 Ga0068863_100010463 3300005841 Bacteria 9017
61 Ga0068860_100330196 3300005843 Bacteria 1498
62 Ga0081540_1000372 3300005983 Bacteria 44934
63 Ga0081540_1001031 3300005983 Bacteria 24972
64 Ga0081539_10025102 3300005985 Bacteria 3848
65 Ga0070717_10042123 3300006028 Bacteria 3724
66 Ga0070717_10178583 3300006028 Bacteria 1849
67 Ga0070717_10334974 3300006028 Bacteria 1350
68 Ga0070715_10006847 3300006163 Bacteria 3893
69 Ga0070715_10009752 3300006163 Bacteria 3396
70 Ga0070715_10152909 3300006163 Bacteria 1132
71 Ga0070716_100006138 3300006173 Bacteria 5864
72 Ga0070716_100320057 3300006173 Bacteria 1086
73 Ga0070712_100009339 3300006175 Bacteria 6180
74 Ga0070712_100165932 3300006175 Bacteria 1709
75 Ga0070712_100201288 3300006175 Bacteria 1564
76 Ga0097621_100069030 3300006237 Bacteria 2917
77 Ga0068871_100155023 3300006358 Bacteria 1955
78 Ga0068871_100645678 3300006358 Bacteria 966
79 Ga0075433_10076405 3300006852 Bacteria 2949
80 Ga0075434_100016273 3300006871 Bacteria 7149
81 Ga0075434_100144800 3300006871 Bacteria 2396
82 Ga0075436_100010573 3300006914 Bacteria 6329
83 Ga0075436_100048974 3300006914 Bacteria 2916
84 Ga0075436_100143228 3300006914 Bacteria 1680
85 Ga0075436_100213968 3300006914 Bacteria 1367
86 Ga0075435_100012016 3300007076 Bacteria 6397
87 Ga0075435_100019630 3300007076 Bacteria 5168
88 Ga0099795_10014308 3300007788 Bacteria 2458
89 Ga0105251_10032922 3300009011 Bacteria 2578
90 Ga0105240_10137762 3300009093 Bacteria 2921
91 Ga0105240_10228734 3300009093 Bacteria 2162
92 Ga0111539_10038565 3300009094 Bacteria 5763
93 Ga0114129_10007880 3300009147 Bacteria 15157
94 Ga0105243_10281794 3300009148 Bacteria 1497
95 Ga0105241_10051820 3300009174 Bacteria 3131
96 Ga0105241_10504867 3300009174 Bacteria 1079
97 Ga0105242_10241356 3300009176 Bacteria 1624
98 Ga0105248_10031085 3300009177 Bacteria 5967
99 Ga0105238_10773609 3300009551 Bacteria 975
100 Ga0105249_10480588 3300009553 Bacteria 1285
101 Ga0099796_10067101 3300010159 Bacteria 1286
102 Ga0105239_10286070 3300010375 Bacteria 1856
103 Ga0157338_1007055 3300012515 Bacteria 1056
104 Ga0157373_10017055 3300013100 Bacteria 5288
105 Ga0157370_10165598 3300013104 Bacteria 2056
106 Ga0157369_10032399 3300013105 Bacteria 5749
107 Ga0157369_10412547 3300013105 Bacteria 1400
108 Ga0157374_10181600 3300013296 Bacteria 2055
109 Ga0157378_10202063 3300013297 Bacteria 1880
110 Ga0157378_10890811 3300013297 Bacteria 920
111 Ga0157375_10330166 3300013308 Bacteria 1690
112 Ga0163163_10035818 3300014325 Bacteria 4818
113 Ga0163163_10086379 3300014325 Bacteria 3146
114 Ga0163163_10174172 3300014325 Bacteria 2198
115 Ga0157377_10038305 3300014745 Bacteria 2646
116 Ga0157379_10472064 3300014968 Bacteria 1160
117 Ga0206354_10023125 3300020081 Bacteria 1299
118 Ga0206354_10103253 3300020081 Bacteria 1227
119 Ga0206354_11234941 3300020081 Bacteria 1235
120 Ga0206353_10457440 3300020082 Bacteria 1711
121 Ga0207653_10055896 3300025885 Bacteria 1322
122 Ga0207692_10007117 3300025898 Bacteria 4572
123 Ga0207692_10011039 3300025898 Bacteria 3825
124 Ga0207688_10044054 3300025901 Bacteria 2487
125 Ga0207680_10320655 3300025903 Bacteria 1083
126 Ga0207685_10002720 3300025905 Bacteria 4119
127 Ga0207685_10037868 3300025905 Bacteria 1779
128 Ga0207699_10004058 3300025906 Bacteria 7003
129 Ga0207699_10005379 3300025906 Bacteria 6136
130 Ga0207699_10006833 3300025906 Bacteria 5549
131 Ga0207699_10044442 3300025906 Bacteria 2586
132 Ga0207645_10145403 3300025907 Bacteria 1545
133 Ga0207643_10020448 3300025908 Bacteria 3632
134 Ga0207705_10667824 3300025909 Bacteria 808
135 Ga0207684_10002280 3300025910 Bacteria 19508
136 Ga0207684_10013750 3300025910 Bacteria 6991
137 Ga0207654_10045012 3300025911 Bacteria 2510
138 Ga0207654_10410524 3300025911 Bacteria 943
139 Ga0207671_10420692 3300025914 Bacteria 1063
140 Ga0207693_10033573 3300025915 Bacteria 4049
141 Ga0207693_10288347 3300025915 Bacteria 1286
142 Ga0207663_10054706 3300025916 Bacteria 2500
143 Ga0207663_10062499 3300025916 Bacteria 2367
144 Ga0207663_10151014 3300025916 Bacteria 1630
145 Ga0207663_10160499 3300025916 Bacteria 1586
146 Ga0207663_10219928 3300025916 Bacteria 1381
147 Ga0207662_10029413 3300025918 Bacteria 3183
148 Ga0207657_10026274 3300025919 Bacteria 5353
149 Ga0207646_10004735 3300025922 Bacteria 14657
150 Ga0207646_10004881 3300025922 Bacteria 14367
151 Ga0207646_10048438 3300025922 Bacteria 3809
152 Ga0207694_10203386 3300025924 Bacteria 1612
153 Ga0207694_10226138 3300025924 Bacteria 1527
154 Ga0207687_10624917 3300025927 Bacteria 910
155 Ga0207700_10001080 3300025928 Bacteria 15690
156 Ga0207700_10012073 3300025928 Bacteria 5549
157 Ga0207700_10032271 3300025928 Bacteria 3733
158 Ga0207664_10006874 3300025929 Bacteria 7866
159 Ga0207664_10016258 3300025929 Bacteria 5423
160 Ga0207664_10107176 3300025929 Bacteria 2318
161 Ga0207664_10168529 3300025929 Bacteria 1873
162 Ga0207664_10320687 3300025929 Bacteria 1367
163 Ga0207644_10141107 3300025931 Bacteria 1855
164 Ga0207690_10481025 3300025932 Bacteria 1002
165 Ga0207706_10050882 3300025933 Bacteria 3660
166 Ga0207709_10240915 3300025935 Bacteria 1316
167 Ga0207665_10003938 3300025939 Bacteria 9938
168 Ga0207665_10009530 3300025939 Bacteria 6377
169 Ga0207665_10160643 3300025939 Bacteria 1616
170 Ga0207691_10062115 3300025940 Bacteria 3391
171 Ga0207689_10014748 3300025942 Bacteria 6636
172 Ga0207667_10047676 3300025949 Bacteria 4534
173 Ga0207667_10168379 3300025949 Bacteria 2252
174 Ga0207651_10235081 3300025960 Bacteria 1490
175 Ga0207677_10223321 3300026023 Bacteria 1512
176 Ga0207639_10203090 3300026041 Bacteria 1701
177 Ga0207678_10016213 3300026067 Bacteria 6538
178 Ga0207708_10126387 3300026075 Bacteria 1996
179 Ga0207702_10123841 3300026078 Bacteria 2317
180 Ga0207702_10353729 3300026078 Bacteria 1406
181 Ga0207702_10773657 3300026078 Bacteria 948
182 Ga0207641_10213810 3300026088 Bacteria 1784
183 Ga0207674_10021991 3300026116 Bacteria 6859
184 Ga0207675_100177918 3300026118 Bacteria 2036
185 Ga0207683_10015880 3300026121 Bacteria 6412
186 Ga0268266_10029535 3300028379 Bacteria 4660
187 Ga0268266_10473301 3300028379 Bacteria 1193
188 Ga0268264_10937516 3300028381 Bacteria 870
189 Ga0307517_10003996 3300028786 Bacteria 22822
190 Ga0307517_10082973 3300028786 Bacteria 2715
191 Ga0307515_10100229 3300028794 Bacteria 3509
192 Ga0307515_10176110 3300028794 Bacteria 2109
193 Ga0307511_10103126 3300030521 Bacteria 1860
194 Ga0307513_10017836 3300031456 Bacteria 8502
195 Ga0307509_10526326 3300031507 Bacteria 863
196 Ga0307508_10006889 3300031616 Bacteria 10622
197 Ga0307508_10008020 3300031616 Bacteria 9790
198 Ga0307514_10005869 3300031649 Bacteria 10834
199 Ga0307514_10017946 3300031649 Bacteria 5813
200 Ga0307514_10109544 3300031649 Bacteria 1961
201 Ga0307516_10009624 3300031730 Bacteria 10753
202 Ga0307518_10001359 3300031838 Bacteria 18188
203 Ga0307518_10032435 3300031838 Bacteria 3787
204 Ga0307507_10000001 3300033179 Bacteria 417520
205 Ga0307507_10046326 3300033179 Bacteria 4264
206 Ga0307510_10163415 3300033180 Bacteria 1819
207 Ga0373948_0060325 3300034817 Bacteria 832
208 Ga0373950_0004197 3300034818 Bacteria 2099
209 Ga0373938_0027600 3300034957 Bacteria 1195
210 Ga0373926_0002249 3300035083 Bacteria 6102
211 Ga0373926_0008392 3300035083 Bacteria 3438
212 Ga0373928_0027356 3300035084 Bacteria 1241
213 Ga0373929_0008712 3300035085 Bacteria 1872
214 Ga0373934_0002211 3300035086 Bacteria 7147
215 Ga0373940_0010414 3300035088 Bacteria 2185
216 Ga0373944_0031331 3300035089 Bacteria 1599
217 Ga0373951_0002912 3300035091 Bacteria 4255
218 Ga0373951_0012983 3300035091 Bacteria 1873
219 Ga0373952_0012635 3300035092 Bacteria 1664
220 Ga0373952_0014464 3300035092 Bacteria 1580
221 Ga0373923_0000435 3300035111 Bacteria 9827
222 Ga0373923_0004665 3300035111 Bacteria 4569
223 Ga0373923_0013621 3300035111 Bacteria 3035
224 Ga0373936_0041467 3300035113 Bacteria 1846
225 Ga0373936_0118567 3300035113 Bacteria 1129
226 Ga0373945_0004083 3300035116 Bacteria 4627
227 Ga0373945_0021252 3300035116 Bacteria 2229
228 Ga0373945_0030614 3300035116 Bacteria 1897
229 Ga0373953_0000146 3300035117 Bacteria 18020
230 Ga0373953_0025805 3300035117 Bacteria 2247
231 Ga0373954_0010620 3300035118 Bacteria 4065
232 Ga0373954_0021708 3300035118 Bacteria 2908
233 Ga0373954_0022369 3300035118 Bacteria 2867
234 Ga0373954_0042000 3300035118 Bacteria 2132
235 Ga0373956_0004929 3300035119 Bacteria 5348
236 Ga0373956_0017432 3300035119 Bacteria 3027
237 Ga0373956_0127033 3300035119 Bacteria 1192
238 Ga0373957_0000124 3300035120 Bacteria 18925
239 Ga0373957_0004915 3300035120 Bacteria 4108
240 Ga0373943_0013389 3300035170 Bacteria 3703
241 Ga0373946_0149562 3300035171 Bacteria 1088
242 Ga0373946_0173259 3300035171 Bacteria 1020
243 Ga0373955_0000016 3300035172 Bacteria 71862
244 Ga0373955_0005979 3300035172 Bacteria 5516
245 Ga0373955_0057093 3300035172 Bacteria 2143
246 Ga0373942_0001589 3300035207 Bacteria 5820
247 Ga0373961_0003784 3300035241 Bacteria 3699
248 Ga0373962_0024557 3300035242 Bacteria 1613
249 Ga0373924_0000454 3300035410 Bacteria 12539
250 Ga0373924_0004238 3300035410 Bacteria 4995
251 Ga0373924_0005712 3300035410 Bacteria 4417
252 Ga0373935_0016635 3300035692 Bacteria 4450
253 Ga0373935_0017464 3300035692 Bacteria 4354
254 Ga0373935_0522757 3300035692 Bacteria 863
255 Ga0373927_0004257 3300035695 Bacteria 10045
256 Ga0373927_0127070 3300035695 Bacteria 1665
257 Ga0373927_0198750 3300035695 Bacteria 1316
258 Ga0373933_0000001 3300035724 Bacteria 228234
259 Ga0373933_0005701 3300035724 Bacteria 6775
260 Ga0373933_0081207 3300035724 Bacteria 1988
261 Ga0373933_0153897 3300035724 Bacteria 1457
262 Ga0373947_0252951 3300035725 Bacteria 1165
263 Ga0373937_0000022 3300036401 Bacteria 127537
264 Ga0373937_0121282 3300036401 Bacteria 2436
265 Ga0373925_0011227 3300037068 Bacteria 6495
266 Ga0373925_0012060 3300037068 Bacteria 6258
267 Ga0373925_0042762 3300037068 Bacteria 3361
268 Ga0373925_0070660 3300037068 Bacteria 2639
269 Ga0373925_0073302 3300037068 Bacteria 2591
270 Ga0373925_0461146 3300037068 Bacteria 1041
271 Ga0451841_1462667 3300041498 Bacteria 2976
272 Ga0466969_0072327 3300044656 Bacteria 1656
273 Ga0466961_0049742 3300044693 Bacteria 2678
274 Ga0466961_0182511 3300044693 Bacteria 1302
275 Ga0466971_0000965 3300044719 Bacteria 11814
276 Ga0466960_0006561 3300044901 Bacteria 4673
277 Ga0466959_0080113 3300045049 Bacteria 2354
278 Ga0466959_0152618 3300045049 Bacteria 1627
279 Ga0466967_0002802 3300045976 Bacteria 11058
280 Ga0466967_0084091 3300045976 Bacteria 2879
281 Ga0495617_026579 3300046452 Bacteria 1949
282 Ga0495592_0000025 3300046454 Bacteria 136324
283 Ga0495592_0014690 3300046454 Bacteria 5944
284 Ga0495592_0033900 3300046454 Bacteria 3850
285 Ga0495592_0045453 3300046454 Bacteria 3276
286 Ga0495592_0045497 3300046454 Bacteria 3275
287 Ga0495592_0053639 3300046454 Bacteria 2989
288 Ga0495603_0000135 3300046455 Bacteria 36544
289 Ga0495603_0012804 3300046455 Bacteria 5072
290 Ga0495603_0016005 3300046455 Bacteria 4535
291 Ga0495603_0038840 3300046455 Bacteria 2853
292 Ga0495603_0179274 3300046455 Bacteria 1226
293 Ga0495629_0000803 3300046459 Bacteria 25439
294 Ga0495629_0000836 3300046459 Bacteria 24977
295 Ga0495629_0004490 3300046459 Bacteria 10449
296 Ga0495629_0005491 3300046459 Bacteria 9466
297 Ga0495629_0006360 3300046459 Bacteria 8766
298 Ga0495629_0010061 3300046459 Bacteria 6900
299 Ga0495629_0024501 3300046459 Bacteria 4297
300 Ga0495629_0061358 3300046459 Bacteria 2627
301 Ga0495629_0072046 3300046459 Bacteria 2412
302 Ga0495638_0056436 3300046460 Bacteria 2437
303 Ga0495638_0091605 3300046460 Bacteria 1831
304 Ga0495641_0024973 3300046461 Bacteria 2938
305 Ga0495651_0000014 3300046462 Bacteria 136312
306 Ga0495651_0001022 3300046462 Bacteria 21654
307 Ga0495651_0023969 3300046462 Bacteria 4747
308 Ga0495651_0093672 3300046462 Bacteria 2248
309 Ga0495651_0170996 3300046462 Bacteria 1547
310 Ga0495653_0004386 3300046463 Bacteria 11405
311 Ga0495653_0014589 3300046463 Bacteria 6413
312 Ga0495653_0039282 3300046463 Bacteria 3708
313 Ga0495653_0111899 3300046463 Bacteria 1960
314 Ga0495580_0033565 3300046472 Bacteria 3697
315 Ga0495580_0147458 3300046472 Bacteria 1631
316 Ga0495582_0003713 3300046473 Bacteria 8596
317 Ga0495582_0004944 3300046473 Bacteria 7471
318 Ga0495582_0019382 3300046473 Bacteria 3718
319 Ga0495582_0258441 3300046473 Bacteria 999
320 Ga0495605_0002245 3300046474 Bacteria 12063
321 Ga0495639_0007870 3300046475 Bacteria 4581
322 Ga0495639_0010514 3300046475 Bacteria 3985
323 Ga0495639_0141643 3300046475 Bacteria 1156
324 Ga0495662_0004950 3300046476 Bacteria 6666
325 Ga0495662_0007733 3300046476 Bacteria 5294
326 Ga0495662_0204897 3300046476 Bacteria 972
327 Ga0495664_0001319 3300046477 Bacteria 13031
328 Ga0495664_0007276 3300046477 Bacteria 6142
329 Ga0495664_0017893 3300046477 Bacteria 4053
330 Ga0495664_0152538 3300046477 Bacteria 1401
331 Ga0495594_0001045 3300046499 Bacteria 14418
332 Ga0495594_0009856 3300046499 Bacteria 4950
333 Ga0495594_0035381 3300046499 Bacteria 2720
334 Ga0495594_0047042 3300046499 Bacteria 2369
335 Ga0495594_0131134 3300046499 Bacteria 1420
336 Ga0495594_0190126 3300046499 Bacteria 1170
337 Ga0495594_0191644 3300046499 Bacteria 1165
338 Ga0495607_0042005 3300046501 Bacteria 2713
339 Ga0495607_0151885 3300046501 Bacteria 1184
340 Ga0495583_0022106 3300046506 Bacteria 3254
341 Ga0495606_0025633 3300046507 Bacteria 4218
342 Ga0495608_0000055 3300046511 Bacteria 93015
343 Ga0495608_0010309 3300046511 Bacteria 6520
344 Ga0495608_0027396 3300046511 Bacteria 3877
345 Ga0495618_0009827 3300046514 Bacteria 5785
346 Ga0495618_0023883 3300046514 Bacteria 3785
347 Ga0495618_0256398 3300046514 Bacteria 1096
348 Ga0495620_0000455 3300046515 Bacteria 27164
349 Ga0495628_0000102 3300046516 Bacteria 68520
350 Ga0495628_0015023 3300046516 Bacteria 6470
351 Ga0495628_0034078 3300046516 Bacteria 4098
352 Ga0495628_0049501 3300046516 Bacteria 3327
353 Ga0495628_0069077 3300046516 Bacteria 2755
354 Ga0495628_0245824 3300046516 Bacteria 1337
355 Ga0495628_0348837 3300046516 Bacteria 1088
356 Ga0495630_0012682 3300046517 Bacteria 6124
357 Ga0495630_0058674 3300046517 Bacteria 2885
358 Ga0495630_0131920 3300046517 Bacteria 1897
359 Ga0495631_0013538 3300046518 Bacteria 3958
360 Ga0495632_0018577 3300046519 Bacteria 3812
361 Ga0495637_0134948 3300046520 Bacteria 940
362 Ga0495643_0002871 3300046522 Bacteria 13092
363 Ga0495648_0037496 3300046524 Bacteria 3114
364 Ga0495648_0199047 3300046524 Bacteria 1004
365 Ga0495666_0001661 3300046526 Bacteria 10975
366 Ga0495666_0002088 3300046526 Bacteria 9896
367 Ga0495666_0028955 3300046526 Bacteria 2725
368 Ga0495666_0033644 3300046526 Bacteria 2503
369 Ga0495652_0000236 3300046529 Bacteria 64607
370 Ga0495652_0002425 3300046529 Bacteria 19225
371 Ga0495652_0162716 3300046529 Bacteria 1730
372 Ga0495652_0282997 3300046529 Bacteria 1213
373 Ga0495665_0003302 3300046531 Bacteria 8739
374 Ga0495665_0004492 3300046531 Bacteria 7531
375 Ga0495665_0014555 3300046531 Bacteria 4242
376 Ga0495665_0070032 3300046531 Bacteria 1848
377 Ga0495640_0005341 3300046533 Bacteria 10214
378 Ga0495640_0012603 3300046533 Bacteria 6455
379 Ga0495640_0013060 3300046533 Bacteria 6324
380 Ga0495640_0015518 3300046533 Bacteria 5728
381 Ga0495640_0068979 3300046533 Bacteria 2378
382 Ga0495640_0151474 3300046533 Bacteria 1490
383 Ga0495640_0262400 3300046533 Bacteria 1079
384 Ga0495640_0326025 3300046533 Bacteria 950
385 Ga0495586_0002343 3300046535 Bacteria 10309
386 Ga0495586_0063470 3300046535 Bacteria 2012
387 Ga0495586_0127673 3300046535 Bacteria 1423
388 Ga0495587_0000029 3300046536 Bacteria 136321
389 Ga0495587_0027475 3300046536 Bacteria 3464
390 Ga0495587_0030120 3300046536 Bacteria 3291
391 Ga0495587_0036601 3300046536 Bacteria 2951
392 Ga0495587_0060874 3300046536 Bacteria 2212
393 Ga0495645_0002788 3300046543 Bacteria 11852
394 Ga0495645_0040710 3300046543 Bacteria 3389
395 Ga0495645_0083489 3300046543 Bacteria 2289
396 Ga0495645_0097731 3300046543 Bacteria 2090
397 Ga0495622_0009578 3300046557 Bacteria 4482
398 Ga0495622_0012820 3300046557 Bacteria 3887
399 Ga0495622_0137750 3300046557 Bacteria 1109
400 Ga0495633_0111691 3300046558 Bacteria 1267
401 Ga0495633_0119215 3300046558 Bacteria 1222
402 Ga0495667_0000036 3300046559 Bacteria 136146
403 Ga0495667_0003857 3300046559 Bacteria 10061
404 Ga0495667_0041644 3300046559 Bacteria 3045
405 Ga0495667_0081560 3300046559 Bacteria 2102
406 Ga0495668_0028920 3300046616 Bacteria 3132
407 Ga0495668_0159530 3300046616 Bacteria 1235
408 Ga0495634_0004501 3300046642 Bacteria 10931
409 Ga0495634_0018511 3300046642 Bacteria 4959
410 Ga0495634_0021767 3300046642 Bacteria 4525
411 Ga0495634_0021868 3300046642 Bacteria 4513
412 Ga0495634_0023671 3300046642 Bacteria 4315
413 Ga0495634_0045897 3300046642 Bacteria 2951
414 Ga0495634_0082931 3300046642 Bacteria 2093
415 Ga0495634_0245846 3300046642 Bacteria 1096
416 Ga0495611_0024512 3300046648 Bacteria 2625
417 Ga0495625_0007372 3300046660 Bacteria 9586
418 Ga0495625_0010156 3300046660 Bacteria 7818
419 Ga0495635_0007633 3300046663 Bacteria 7550
420 Ga0495635_0008131 3300046663 Bacteria 7329
421 Ga0495635_0015068 3300046663 Bacteria 5407
422 Ga0495635_0053396 3300046663 Bacteria 2784
423 Ga0495635_0196055 3300046663 Bacteria 1370
424 Ga0495588_0004093 3300046674 Bacteria 6416
425 Ga0495588_0114447 3300046674 Bacteria 1421
426 Ga0495657_0000319 3300046675 Bacteria 44250
427 Ga0495657_0010807 3300046675 Bacteria 6855
428 Ga0495657_0010888 3300046675 Bacteria 6824
429 Ga0495657_0031604 3300046675 Bacteria 3699
430 Ga0495657_0032391 3300046675 Bacteria 3647
431 Ga0495657_0049099 3300046675 Bacteria 2844
432 Ga0495599_0000006 3300046678 Bacteria 283487
433 Ga0495599_0007565 3300046678 Bacteria 6590
434 Ga0495599_0012736 3300046678 Bacteria 5187
435 Ga0495599_0089283 3300046678 Bacteria 1923
436 Ga0495599_0227010 3300046678 Bacteria 1141
437 Ga0495623_0000852 3300046679 Bacteria 20658
438 Ga0495623_0008306 3300046679 Bacteria 6751
439 Ga0495623_0064087 3300046679 Bacteria 2300
440 Ga0495623_0064595 3300046679 Bacteria 2290
441 Ga0495623_0189449 3300046679 Bacteria 1189
442 Ga0495646_0019984 3300046680 Bacteria 4234
443 Ga0495646_0062755 3300046680 Bacteria 2208
444 Ga0495646_0119389 3300046680 Bacteria 1493
445 Ga0495646_0136976 3300046680 Bacteria 1372
446 Ga0495647_0026156 3300046681 Bacteria 2135
447 Ga0495647_0072686 3300046681 Bacteria 1380
448 Ga0495658_0005743 3300046683 Bacteria 6098
449 Ga0495658_0010831 3300046683 Bacteria 4567
450 Ga0495613_0002500 3300046689 Bacteria 13867
451 Ga0495613_0003025 3300046689 Bacteria 12573
452 Ga0495613_0004340 3300046689 Bacteria 10613
453 Ga0495613_0005122 3300046689 Bacteria 9834
454 Ga0495613_0023132 3300046689 Bacteria 4632
455 Ga0495613_0029702 3300046689 Bacteria 4063
456 Ga0495613_0043054 3300046689 Bacteria 3340
457 Ga0495613_0060637 3300046689 Bacteria 2770
458 Ga0495613_0069303 3300046689 Bacteria 2571
459 Ga0495624_0021139 3300046690 Bacteria 4320
460 Ga0495624_0039786 3300046690 Bacteria 3014
461 Ga0495624_0051884 3300046690 Bacteria 2593
462 Ga0495624_0087868 3300046690 Bacteria 1919
463 Ga0495624_0119267 3300046690 Bacteria 1621
464 Ga0495624_0182519 3300046690 Bacteria 1278
465 Ga0495670_0015625 3300046691 Bacteria 3730
466 Ga0495649_0154795 3300046694 Bacteria 1203
467 Ga0495589_0003390 3300046794 Bacteria 8640
468 Ga0495589_0052648 3300046794 Bacteria 2011
469 Ga0495589_0103673 3300046794 Bacteria 1375
470 Ga0495600_0001700 3300046809 Bacteria 12293
471 Ga0495600_0050328 3300046809 Bacteria 2718
472 Ga0495600_0064913 3300046809 Bacteria 2386
473 Ga0495600_0288394 3300046809 Bacteria 1037
474 Ga0495660_0016153 3300046810 Bacteria 4306
475 Ga0495660_0074594 3300046810 Bacteria 1791
476 Ga0495581_0005449 3300047315 Bacteria 7360
477 Ga0495581_0016334 3300047315 Bacteria 4317
478 Ga0495604_0001004 3300047317 Bacteria 23493
479 Ga0495604_0001010 3300047317 Bacteria 23432
480 Ga0495604_0012553 3300047317 Bacteria 6737
481 Ga0495604_0030807 3300047317 Bacteria 4257
482 Ga0495604_0037705 3300047317 Bacteria 3805
483 Ga0495674_0014892 3300047319 Bacteria 7276
484 Ga0495674_0029054 3300047319 Bacteria 5036
485 Ga0495674_0036738 3300047319 Bacteria 4406
486 Ga0495674_0179172 3300047319 Bacteria 1765
487 Ga0495676_0003552 3300047321 Bacteria 14134
488 Ga0495676_0013326 3300047321 Bacteria 7388
489 Ga0495676_0014465 3300047321 Bacteria 7061
490 Ga0495676_0058495 3300047321 Bacteria 3032
491 Ga0495680_0000117 3300047322 Bacteria 76289
492 Ga0495680_0006725 3300047322 Bacteria 10632
493 Ga0495680_0014193 3300047322 Bacteria 6912
494 Ga0495680_0021859 3300047322 Bacteria 5345
495 Ga0495680_0029686 3300047322 Bacteria 4476
496 Ga0495680_0115465 3300047322 Bacteria 1986
497 Ga0495683_0096765 3300047323 Bacteria 1424
498 Ga0495683_0106159 3300047323 Bacteria 1345
499 Ga0495687_005330 3300047443 Bacteria 8238
500 Ga0495687_013487 3300047443 Bacteria 4261
501 Ga0495687_036461 3300047443 Bacteria 2200
502 Ga0495675_0000244 3300047444 Bacteria 39231
503 Ga0495675_0010768 3300047444 Bacteria 5728
504 Ga0495675_0021793 3300047444 Bacteria 4082
505 Ga0495675_0052262 3300047444 Bacteria 2594
506 Ga0495685_000145 3300047447 Bacteria 24203
507 Ga0495685_052628 3300047447 Bacteria 1379
508 Ga0495681_0003982 3300047470 Bacteria 10165
509 Ga0495684_0014703 3300047471 Bacteria 6024
510 Ga0495684_0028253 3300047471 Bacteria 4306
511 Ga0495684_0073969 3300047471 Bacteria 2588
512 Ga0495686_0075165 3300047472 Bacteria 2072
513 Ga0495686_0105025 3300047472 Bacteria 1700
514 Ga0495593_0003238 3300047673 Bacteria 9759
515 Ga0495593_0003876 3300047673 Bacteria 8938
516 Ga0495593_0031562 3300047673 Bacteria 2893
517 Ga0495593_0111406 3300047673 Bacteria 1397
518 Ga0495602_0000104 3300048088 Bacteria 80789
519 Ga0495602_0049852 3300048088 Bacteria 3746
520 Ga0495602_0070060 3300048088 Bacteria 3003
521 Ga0495602_0137503 3300048088 Bacteria 1938
522 Ga0495614_0000178 3300048089 Bacteria 23618
523 Ga0495614_0003028 3300048089 Bacteria 7486
524 Ga0495614_0004258 3300048089 Bacteria 6448
525 Ga0495614_0025498 3300048089 Bacteria 2550
526 Ga0495614_0026372 3300048089 Bacteria 2504
527 Ga0495614_0037431 3300048089 Bacteria 2081
528 Ga0496100_0099229 3300048903 Bacteria 2003
529 Ga0496100_0199183 3300048903 Bacteria 1458
530 Ga0496101_0064146 3300048904 Bacteria 2675
531 Ga0496101_0092880 3300048904 Bacteria 2247
532 Ga0496102_0000221 3300048905 Bacteria 75427
533 Ga0496102_0093559 3300048905 Bacteria 2784
534 Ga0496103_0099455 3300048906 Bacteria 1840
535 Ga0496103_0223958 3300048906 Bacteria 1209
536 Ga0496104_0002504 3300048907 Bacteria 15805
537 Ga0496104_0232228 3300048907 Bacteria 1756
538 Ga0496104_0233646 3300048907 Bacteria 1750
539 Ga0496104_0338918 3300048907 Bacteria 1416
540 Ga0496105_0007358 3300048908 Bacteria 8516
541 Ga0496105_0015001 3300048908 Bacteria 6165
542 Ga0496105_0266428 3300048908 Bacteria 1384
543 Ga0496106_0031752 3300048909 Bacteria 3935
544 Ga0496106_0136937 3300048909 Bacteria 1924
545 Ga0496107_0101353 3300048910 Bacteria 2111
546 Ga0496107_0105321 3300048910 Bacteria 2070
547 Ga0496108_0017640 3300048911 Bacteria 5841
548 Ga0496108_0230016 3300048911 Bacteria 1612
549 Ga0496109_0064891 3300048912 Bacteria 3342
550 Ga0496109_0664653 3300048912 Bacteria 979
551 Ga0496110_0174299 3300048913 Bacteria 1952
552 Ga0496110_0618668 3300048913 Bacteria 981
553 Ga0496111_0015895 3300048914 Bacteria 5175
554 Ga0496112_0003574 3300048915 Bacteria 12919
555 Ga0496112_0018611 3300048915 Bacteria 6544
556 Ga0496112_0038446 3300048915 Bacteria 4672
557 Ga0496113_0107348 3300048916 Bacteria 2169
558 Ga0496113_0145661 3300048916 Bacteria 1866
559 Ga0496113_0600300 3300048916 Bacteria 881
560 Ga0496115_0025010 3300048918 Bacteria 4645
561 Ga0496115_0430117 3300048918 Bacteria 1068
562 Ga0496126_0013418 3300048929 Bacteria 8336
563 Ga0495678_088253 3300049459 Bacteria 1098
564 Ga0501031_0004715 3300049568 Bacteria 8845
565 Ga0501031_0032779 3300049568 Bacteria 3388
566 Ga0501031_0121352 3300049568 Bacteria 1708
567 Ga0501032_0005462 3300049569 Bacteria 9435
568 Ga0501032_0020677 3300049569 Bacteria 4582
569 Ga0501032_0030622 3300049569 Bacteria 3692
570 Ga0501032_0213173 3300049569 Bacteria 1258
571 Ga0501033_0030841 3300049570 Bacteria 4030
572 Ga0501033_0145999 3300049570 Bacteria 1708
573 Ga0501033_0147674 3300049570 Bacteria 1697
574 Ga0501033_0228351 3300049570 Bacteria 1323
575 Ga0501034_0203104 3300049571 Bacteria 1939
576 Ga0501034_0266179 3300049571 Bacteria 1656
577 Ga0501036_0010856 3300049572 Bacteria 7524
578 Ga0501036_0037515 3300049572 Bacteria 4099
579 Ga0501036_0315567 3300049572 Bacteria 1306
580 Ga0501037_0014732 3300049573 Bacteria 5751
581 Ga0501037_0178252 3300049573 Bacteria 1509
582 Ga0501037_0350661 3300049573 Bacteria 1018
583 Ga0501038_0000899 3300049574 Bacteria 26339
584 Ga0501038_0015746 3300049574 Bacteria 6872
585 Ga0501043_0025789 3300049579 Bacteria 4611
586 Ga0501043_0048239 3300049579 Bacteria 3348
587 Ga0501043_0376656 3300049579 Bacteria 1075
588 Ga0501046_0079534 3300049580 Bacteria 2534
589 Ga0501047_0107365 3300049581 Bacteria 2673
590 Ga0501047_0134540 3300049581 Bacteria 2352
591 Ga0501047_0138240 3300049581 Bacteria 2315
592 Ga0501047_0379619 3300049581 Bacteria 1248
593 Ga0501048_0000934 3300049582 Bacteria 21582
594 Ga0501070_0010297 3300049586 Bacteria 7905
595 Ga0501070_0053002 3300049586 Bacteria 3366
596 Ga0501035_0003893 3300049822 Bacteria 14238
597 Ga0501035_0039216 3300049822 Bacteria 4287
598 Ga0501035_0049256 3300049822 Bacteria 3776
599 Ga0501035_0093900 3300049822 Bacteria 2639
600 Ga0501035_0101500 3300049822 Bacteria 2524
601 Ga0501035_0404934 3300049822 Bacteria 1134
602 Ga0501044_0006503 3300049823 Bacteria 12909
603 Ga0501044_0013410 3300049823 Bacteria 8862
604 Ga0501044_0066344 3300049823 Bacteria 3680
605 Ga0501044_0231816 3300049823 Bacteria 1793
606 Ga0501044_0327653 3300049823 Bacteria 1455
607 Ga0501044_0331937 3300049823 Bacteria 1443
608 Ga0501045_0609658 3300049824 Bacteria 808
609 nmdc:mga05p37_45342_c1 3300050507 Bacteria 5409
610 nmdc:mga06r32_319725_c1 3300050510 Bacteria 1537
611 nmdc:mga0rr50_4166_c1 3300050513 Bacteria 8457
612 nmdc:mga08x19_32846_c1 3300050514 Bacteria 3273
613 nmdc:mga08x19_6725_c1 3300050514 Bacteria 6825
614 nmdc:mga0a205_216407_c1 3300050515 Bacteria 1803
615 nmdc:mga0a205_279410_c1 3300050515 Bacteria 1545
616 nmdc:mga0a205_47643_c1 3300050515 Bacteria 4136
617 Ga0495601_0001830 3300053077 Bacteria 11815
618 Ga0495601_0005325 3300053077 Bacteria 7490
619 Ga0495601_0015275 3300053077 Bacteria 4640
620 Ga0495601_0021647 3300053077 Bacteria 3938
621 Ga0495601_0057414 3300053077 Bacteria 2465
622 Ga0495601_0070899 3300053077 Bacteria 2225
623 Ga0495612_0001000 3300053078 Bacteria 11626
624 Ga0495612_0004060 3300053078 Bacteria 6063
625 Ga0495612_0006137 3300053078 Bacteria 4945
626 Ga0495612_0051830 3300053078 Bacteria 1687
627 Ga0495655_0008073 3300053083 Bacteria 1986
628 Ga0495595_0009343 3300053084 Bacteria 4053
629 Ga0495595_0051040 3300053084 Bacteria 1916
630 Ga0495595_0077779 3300053084 Bacteria 1576
631 Ga0495619_0002227 3300053085 Bacteria 12822
632 Ga0495619_0020414 3300053085 Bacteria 4218
633 Ga0495619_0068323 3300053085 Bacteria 2374
634 Ga0495619_0132933 3300053085 Bacteria 1710
635 Ga0500578_0009224 3300053086 Bacteria 6411
636 Ga0500654_064699 3300053099 Bacteria 1838
637 Ga0500660_076483 3300053100 Bacteria 1550
638 Ga0500560_001138 3300053107 Bacteria 4376
639 Ga0500652_007209 3300053131 Bacteria 3625
640 Ga0500658_0000847 3300053134 Bacteria 12561
641 Ga0500561_0000168 3300053137 Bacteria 12177
642 Ga0500573_0002584 3300053140 Bacteria 9107
643 Ga0500579_056230 3300053143 Bacteria 2370
644 Ga0500600_0002727 3300053149 Bacteria 10013
645 Ga0500600_0137658 3300053149 Bacteria 1234
646 Ga0500616_0029487 3300053153 Bacteria 3017
647 Ga0500633_0000369 3300053160 Bacteria 6886
648 Ga0500634_0001537 3300053161 Bacteria 9073
649 Ga0500587_000305 3300053739 Bacteria 5510
650 Ga0466962_0009387 3300061719 Bacteria 4689

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035083 Ga0373926_0008392 Ga0373926_0008392_331_1098 208
2 3300005983 Ga0081540_1001031 Ga0081540_10010315 217
3 3300031838 Ga0307518_10032435 Ga0307518_100324353 223
4 3300006852 Ga0075433_10076405 Ga0075433_100764052 225
5 3300006914 Ga0075436_100010573 Ga0075436_1000105732 225
6 3300007076 Ga0075435_100019630 Ga0075435_1000196303 225
7 3300009094 Ga0111539_10038565 Ga0111539_100385652 225
8 3300009147 Ga0114129_10007880 Ga0114129_100078808 225
9 3300025914 Ga0207671_10420692 Ga0207671_104206922 225
10 3300050507 nmdc:mga05p37_45342_c1 nmdc:mga05p37_45342_c1_4496_5263 225
11 3300050510 nmdc:mga06r32_319725_c1 nmdc:mga06r32_319725_c1_421_1188 225
12 3300050514 nmdc:mga08x19_32846_c1 nmdc:mga08x19_32846_c1_249_1016 225
13 3300050515 nmdc:mga0a205_216407_c1 nmdc:mga0a205_216407_c1_277_1044 225
14 3300005468 Ga0070707_100011035 Ga0070707_1000110355 226
15 3300005985 Ga0081539_10025102 Ga0081539_100251021 226
16 3300025922 Ga0207646_10004881 Ga0207646_100048816 226
17 3300046506 Ga0495583_0022106 Ga0495583_0022106_1930_2697 227
18 3300046524 Ga0495648_0037496 Ga0495648_0037496_497_1264 227
19 3300046616 Ga0495668_0159530 Ga0495668_0159530_117_884 227
20 3300046694 Ga0495649_0154795 Ga0495649_0154795_360_1127 227
21 3300046794 Ga0495589_0103673 Ga0495589_0103673_23_790 227
22 3300047443 Ga0495687_005330 Ga0495687_005330_7318_8085 227
23 3300049569 Ga0501032_0020677 Ga0501032_0020677_1933_2700 228
24 3300049570 Ga0501033_0030841 Ga0501033_0030841_2019_2786 228
25 3300049571 Ga0501034_0266179 Ga0501034_0266179_717_1484 228
26 3300049572 Ga0501036_0037515 Ga0501036_0037515_1919_2686 228
27 3300049579 Ga0501043_0025789 Ga0501043_0025789_1216_1983 228
28 3300049822 Ga0501035_0003893 Ga0501035_0003893_11905_12672 228
29 3300049823 Ga0501044_0013410 Ga0501044_0013410_1391_2158 228
30 3300005445 Ga0070708_100365428 Ga0070708_1003654281 231
31 3300035086 Ga0373934_0002211 Ga0373934_0002211_1176_1943 231
32 3300035111 Ga0373923_0004665 Ga0373923_0004665_3236_4003 231
33 3300035111 Ga0373923_0013621 Ga0373923_0013621_1984_2751 231
34 3300035116 Ga0373945_0021252 Ga0373945_0021252_27_794 231
35 3300035117 Ga0373953_0000146 Ga0373953_0000146_16662_17429 231
36 3300035118 Ga0373954_0010620 Ga0373954_0010620_865_1632 231
37 3300035119 Ga0373956_0127033 Ga0373956_0127033_55_822 231
38 3300035120 Ga0373957_0000124 Ga0373957_0000124_11970_12737 231
39 3300035172 Ga0373955_0000016 Ga0373955_0000016_15688_16455 231
40 3300035410 Ga0373924_0005712 Ga0373924_0005712_3300_4067 231
41 3300035692 Ga0373935_0522757 Ga0373935_0522757_33_800 231
42 3300035695 Ga0373927_0198750 Ga0373927_0198750_511_1278 231
43 3300035724 Ga0373933_0000001 Ga0373933_0000001_227011_227778 231
44 3300035725 Ga0373947_0252951 Ga0373947_0252951_37_804 231
45 3300036401 Ga0373937_0000022 Ga0373937_0000022_8779_9546 231
46 3300037068 Ga0373925_0073302 Ga0373925_0073302_1581_2348 231
47 3300046454 Ga0495592_0000025 Ga0495592_0000025_17566_18333 231
48 3300046462 Ga0495651_0000014 Ga0495651_0000014_17554_18321 231
49 3300046463 Ga0495653_0014589 Ga0495653_0014589_4888_5655 231
50 3300046463 Ga0495653_0039282 Ga0495653_0039282_2603_3370 231
51 3300046472 Ga0495580_0033565 Ga0495580_0033565_144_911 231
52 3300046473 Ga0495582_0019382 Ga0495582_0019382_1902_2669 231
53 3300046499 Ga0495594_0131134 Ga0495594_0131134_434_1201 231
54 3300046511 Ga0495608_0000055 Ga0495608_0000055_74710_75477 231
55 3300046514 Ga0495618_0009827 Ga0495618_0009827_3847_4614 231
56 3300046516 Ga0495628_0000102 Ga0495628_0000102_50274_51041 231
57 3300046517 Ga0495630_0058674 Ga0495630_0058674_436_1203 231
58 3300046526 Ga0495666_0028955 Ga0495666_0028955_1843_2610 231
59 3300046529 Ga0495652_0000236 Ga0495652_0000236_4337_5104 231
60 3300046531 Ga0495665_0003302 Ga0495665_0003302_5338_6105 231
61 3300046533 Ga0495640_0068979 Ga0495640_0068979_77_844 231
62 3300046536 Ga0495587_0000029 Ga0495587_0000029_17570_18337 231
63 3300046559 Ga0495667_0000036 Ga0495667_0000036_17388_18155 231
64 3300046642 Ga0495634_0018511 Ga0495634_0018511_498_1265 231
65 3300046663 Ga0495635_0196055 Ga0495635_0196055_171_938 231
66 3300046675 Ga0495657_0000319 Ga0495657_0000319_17539_18306 231
67 3300046678 Ga0495599_0000006 Ga0495599_0000006_227496_228263 231
68 3300046679 Ga0495623_0000852 Ga0495623_0000852_15016_15783 231
69 3300046680 Ga0495646_0119389 Ga0495646_0119389_391_1158 231
70 3300046690 Ga0495624_0021139 Ga0495624_0021139_3108_3875 231
71 3300046809 Ga0495600_0001700 Ga0495600_0001700_5667_6434 231
72 3300047315 Ga0495581_0016334 Ga0495581_0016334_446_1213 231
73 3300047317 Ga0495604_0001010 Ga0495604_0001010_17553_18320 231
74 3300047319 Ga0495674_0029054 Ga0495674_0029054_3837_4604 231
75 3300047322 Ga0495680_0000117 Ga0495680_0000117_15191_15958 231
76 3300047322 Ga0495680_0029686 Ga0495680_0029686_3630_4397 231
77 3300047444 Ga0495675_0000244 Ga0495675_0000244_38186_38953 231
78 3300047471 Ga0495684_0028253 Ga0495684_0028253_1994_2761 231
79 3300047673 Ga0495593_0031562 Ga0495593_0031562_1553_2320 231
80 3300048088 Ga0495602_0000104 Ga0495602_0000104_73282_74049 231
81 3300048089 Ga0495614_0026372 Ga0495614_0026372_790_1557 231
82 3300053085 Ga0495619_0132933 Ga0495619_0132933_429_1196 231
83 3300005435 Ga0070714_100118693 Ga0070714_1001186933 233
84 3300005439 Ga0070711_100088330 Ga0070711_1000883302 233
85 3300005614 Ga0068856_100077936 Ga0068856_1000779362 233
86 3300006028 Ga0070717_10042123 Ga0070717_100421233 233
87 3300006163 Ga0070715_10006847 Ga0070715_100068473 233
88 3300006173 Ga0070716_100006138 Ga0070716_1000061385 233
89 3300010375 Ga0105239_10286070 Ga0105239_102860702 233
90 3300013297 Ga0157378_10890811 Ga0157378_108908111 233
91 3300025898 Ga0207692_10007117 Ga0207692_100071175 233
92 3300025905 Ga0207685_10037868 Ga0207685_100378682 233
93 3300025906 Ga0207699_10005379 Ga0207699_100053796 233
94 3300025915 Ga0207693_10288347 Ga0207693_102883472 233
95 3300025916 Ga0207663_10151014 Ga0207663_101510142 233
96 3300025928 Ga0207700_10032271 Ga0207700_100322715 233
97 3300025929 Ga0207664_10006874 Ga0207664_100068746 233
98 3300025939 Ga0207665_10003938 Ga0207665_100039383 233
99 3300026078 Ga0207702_10123841 Ga0207702_101238412 233
100 3300048906 Ga0496103_0099455 Ga0496103_0099455_280_1047 233
101 3300048907 Ga0496104_0002504 Ga0496104_0002504_8474_9241 233
102 3300048908 Ga0496105_0007358 Ga0496105_0007358_4298_5065 233
103 3300048909 Ga0496106_0136937 Ga0496106_0136937_991_1758 233
104 3300048911 Ga0496108_0017640 Ga0496108_0017640_2402_3169 233
105 3300048912 Ga0496109_0064891 Ga0496109_0064891_2290_3057 233
106 3300048915 Ga0496112_0003574 Ga0496112_0003574_9751_10518 233
107 3300048916 Ga0496113_0107348 Ga0496113_0107348_1222_1989 233
108 3300049823 Ga0501044_0231816 Ga0501044_0231816_19_720 233
109 3300009093 Ga0105240_10228734 Ga0105240_102287344 235
110 3300025924 Ga0207694_10203386 Ga0207694_102033862 235
111 3300025949 Ga0207667_10168379 Ga0207667_101683794 235
112 3300046689 Ga0495613_0002500 Ga0495613_0002500_3523_4290 237
113 3300047447 Ga0495685_052628 Ga0495685_052628_89_856 237
114 3300005549 Ga0070704_100113827 Ga0070704_1001138272 238
115 3300006871 Ga0075434_100144800 Ga0075434_1001448002 238
116 3300013308 Ga0157375_10330166 Ga0157375_103301662 238
117 3300020081 Ga0206354_11234941 Ga0206354_112349412 238
118 3300035207 Ga0373942_0001589 Ga0373942_0001589_1598_2365 238
119 3300050515 nmdc:mga0a205_47643_c1 nmdc:mga0a205_47643_c1_556_1323 238
120 3300049573 Ga0501037_0350661 Ga0501037_0350661_163_930 239
121 3300035695 Ga0373927_0127070 Ga0373927_0127070_306_1073 241
122 3300037068 Ga0373925_0461146 Ga0373925_0461146_117_884 241
123 3300046476 Ga0495662_0204897 Ga0495662_0204897_179_946 241
124 3300049569 Ga0501032_0030622 Ga0501032_0030622_1842_2609 242
125 3300049570 Ga0501033_0147674 Ga0501033_0147674_74_841 242
126 3300049572 Ga0501036_0010856 Ga0501036_0010856_4815_5582 242
127 3300049573 Ga0501037_0014732 Ga0501037_0014732_77_844 242
128 3300049574 Ga0501038_0015746 Ga0501038_0015746_4643_5410 242
129 3300049579 Ga0501043_0048239 Ga0501043_0048239_656_1423 242
130 3300049581 Ga0501047_0138240 Ga0501047_0138240_876_1643 242
131 3300049586 Ga0501070_0053002 Ga0501070_0053002_67_834 242
132 3300049822 Ga0501035_0101500 Ga0501035_0101500_1084_1851 242
133 3300037068 Ga0373925_0011227 Ga0373925_0011227_3033_3800 243
134 3300041498 Ga0451841_1462667 Ga0451841_1462667_866_1633 243
135 3300046516 Ga0495628_0245824 Ga0495628_0245824_585_1316 243
136 3300046689 Ga0495613_0043054 Ga0495613_0043054_2598_3329 243
137 3300049568 Ga0501031_0032779 Ga0501031_0032779_1464_2231 243
138 3300035171 Ga0373946_0173259 Ga0373946_0173259_148_915 244
139 3300046455 Ga0495603_0000135 Ga0495603_0000135_23825_24592 244
140 3300046459 Ga0495629_0000803 Ga0495629_0000803_12340_13107 244
141 3300046477 Ga0495664_0017893 Ga0495664_0017893_365_1132 244
142 3300046533 Ga0495640_0262400 Ga0495640_0262400_167_934 244
143 3300046543 Ga0495645_0040710 Ga0495645_0040710_2553_3320 244
144 3300046678 Ga0495599_0227010 Ga0495599_0227010_278_1045 244
145 3300046689 Ga0495613_0004340 Ga0495613_0004340_5985_6752 244
146 3300048089 Ga0495614_0000178 Ga0495614_0000178_649_1416 244
147 3300053077 Ga0495601_0070899 Ga0495601_0070899_1214_1981 244
148 3300053078 Ga0495612_0051830 Ga0495612_0051830_279_1046 244
149 3300028794 Ga0307515_10176110 Ga0307515_101761103 247
150 3300031456 Ga0307513_10017836 Ga0307513_100178365 247
151 3300031649 Ga0307514_10005869 Ga0307514_1000586910 247
152 3300035113 Ga0373936_0118567 Ga0373936_0118567_176_943 247
153 3300005548 Ga0070665_100044696 Ga0070665_1000446965 248
154 3300028379 Ga0268266_10029535 Ga0268266_100295353 248
155 3300046558 Ga0495633_0111691 Ga0495633_0111691_67_813 248
156 3300005468 Ga0070707_100009811 Ga0070707_1000098116 249
157 3300005536 Ga0070697_100035905 Ga0070697_1000359052 249
158 3300005563 Ga0068855_100082493 Ga0068855_1000824935 249
159 3300005614 Ga0068856_100136619 Ga0068856_1001366193 249
160 3300013105 Ga0157369_10032399 Ga0157369_100323997 249
161 3300025922 Ga0207646_10048438 Ga0207646_100484383 249
162 3300025949 Ga0207667_10047676 Ga0207667_100476767 249
163 iso_pu_bacteria 2582581312 2585301496 251
164 iso_pu_bacteria 2582581314 2585317108 251
165 iso_pu_bacteria 2616644814 2616700910 251
166 iso_pu_bacteria 2643221601 2644016926 251
167 iso_pu_bacteria 2643221631 2644177754 251
168 iso_pu_bacteria 2643221714 2644626889 251
169 iso_pu_bacteria 2767802112 2768645177 251
170 iso_pu_bacteria 2808606359 2808844949 251
171 iso_pu_bacteria 2818991472 2819744420 251
172 iso_pu_bacteria 2856741275 2856745968 251
173 iso_pu_bacteria 2862178590 2862183960 251
174 iso_pu_bacteria 2873314349 2873319629 251
175 iso_pu_bacteria 2891562705 2891566620 251
176 iso_pu_bacteria 2912757875 2912761959 251
177 iso_pu_bacteria 2997451912 2997455747 251
178 iso_pu_bacteria 2997600082 2997608029 251
179 iso_pu_bacteria 3006321560 3006326445 251
180 iso_pu_bacteria 3006393351 3006398249 251
181 iso_pu_bacteria 8008485437 8008491101 251
182 iso_pu_bacteria 8025478263 8025482461 251
183 iso_pu_bacteria 8025524527 8025530430 251
184 iso_pu_bacteria 8047893842 8047898727 251
185 iso_pu_bacteria 8048356638 8048360191 251
186 iso_pu_bacteria 8048369669 8048375689 251
187 iso_pu_bacteria 8048379754 8048382516 251
188 iso_pu_bacteria 8056447290 8056453501 251
189 iso_pu_bacteria 8056667051 8056668763 251
190 3300048905 Ga0496102_0000221 Ga0496102_0000221_62872_63642 253
191 iso_pu_bacteria 2643221578 2643903831 253
192 iso_pu_bacteria 2643221673 2644402185 253
193 iso_pu_bacteria 2946045630 2946046904 253
194 3300005327 Ga0070658_10174486 Ga0070658_101744862 254
195 3300005455 Ga0070663_100252346 Ga0070663_1002523461 254
196 3300014325 Ga0163163_10086379 Ga0163163_100863795 254
197 3300020081 Ga0206354_10103253 Ga0206354_101032531 254
198 3300045976 Ga0466967_0002802 Ga0466967_0002802_9818_10591 254
199 3300048912 Ga0496109_0664653 Ga0496109_0664653_126_890 254
200 3300048915 Ga0496112_0038446 Ga0496112_0038446_387_1151 254
201 3300049568 Ga0501031_0121352 Ga0501031_0121352_787_1551 254
202 3300049581 Ga0501047_0107365 Ga0501047_0107365_948_1712 254
203 3300049581 Ga0501047_0379619 Ga0501047_0379619_36_800 254
204 3300049823 Ga0501044_0006503 Ga0501044_0006503_8582_9346 254
205 iso_pu_bacteria 3006425503 3006429719 254
206 3300003320 rootH2_10011528 rootH2_100115282 255
207 3300005327 Ga0070658_10253387 Ga0070658_102533873 255
208 3300005329 Ga0070683_100356565 Ga0070683_1003565653 255
209 3300005335 Ga0070666_10135121 Ga0070666_101351211 255
210 3300005337 Ga0070682_100036019 Ga0070682_1000360193 255
211 3300005339 Ga0070660_100154547 Ga0070660_1001545473 255
212 3300005340 Ga0070689_100242913 Ga0070689_1002429133 255
213 3300005344 Ga0070661_100255461 Ga0070661_1002554612 255
214 3300005345 Ga0070692_10131881 Ga0070692_101318813 255
215 3300005355 Ga0070671_100053924 Ga0070671_1000539242 255
216 3300005364 Ga0070673_100113351 Ga0070673_1001133512 255
217 3300005366 Ga0070659_100239581 Ga0070659_1002395811 255
218 3300005367 Ga0070667_100037929 Ga0070667_1000379294 255
219 3300005436 Ga0070713_100004563 Ga0070713_1000045637 255
220 3300005437 Ga0070710_10002491 Ga0070710_100024916 255
221 3300005438 Ga0070701_10038096 Ga0070701_100380963 255
222 3300005439 Ga0070711_100003093 Ga0070711_1000030932 255
223 3300005439 Ga0070711_100398638 Ga0070711_1003986381 255
224 3300005440 Ga0070705_100302067 Ga0070705_1003020671 255
225 3300005441 Ga0070700_100216429 Ga0070700_1002164293 255
226 3300005444 Ga0070694_100178191 Ga0070694_1001781912 255
227 3300005445 Ga0070708_100138566 Ga0070708_1001385663 255
228 3300005445 Ga0070708_100550253 Ga0070708_1005502531 255
229 3300005455 Ga0070663_100335842 Ga0070663_1003358421 255
230 3300005456 Ga0070678_100437161 Ga0070678_1004371611 255
231 3300005467 Ga0070706_100002091 Ga0070706_10000209115 255
232 3300005467 Ga0070706_100006507 Ga0070706_1000065078 255
233 3300005468 Ga0070707_100058627 Ga0070707_1000586274 255
234 3300005471 Ga0070698_100016903 Ga0070698_1000169036 255
235 3300005530 Ga0070679_100290077 Ga0070679_1002900773 255
236 3300005535 Ga0070684_100014004 Ga0070684_1000140043 255
237 3300005535 Ga0070684_100079769 Ga0070684_1000797692 255
238 3300005543 Ga0070672_100068389 Ga0070672_1000683891 255
239 3300005545 Ga0070695_100143786 Ga0070695_1001437862 255
240 3300005545 Ga0070695_100162767 Ga0070695_1001627673 255
241 3300005546 Ga0070696_100131758 Ga0070696_1001317581 255
242 3300005546 Ga0070696_100503632 Ga0070696_1005036321 255
243 3300005547 Ga0070693_100190363 Ga0070693_1001903631 255
244 3300005548 Ga0070665_100048734 Ga0070665_1000487341 255
245 3300005549 Ga0070704_100372880 Ga0070704_1003728802 255
246 3300005563 Ga0068855_100446477 Ga0068855_1004464772 255
247 3300005564 Ga0070664_100196017 Ga0070664_1001960171 255
248 3300005577 Ga0068857_100124486 Ga0068857_1001244863 255
249 3300005618 Ga0068864_100061364 Ga0068864_1000613643 255
250 3300005834 Ga0068851_10109606 Ga0068851_101096061 255
251 3300005840 Ga0068870_10340896 Ga0068870_103408962 255
252 3300005841 Ga0068863_100010463 Ga0068863_1000104637 255
253 3300005843 Ga0068860_100330196 Ga0068860_1003301961 255
254 3300005983 Ga0081540_1000372 Ga0081540_100037232 255
255 3300006028 Ga0070717_10178583 Ga0070717_101785832 255
256 3300006028 Ga0070717_10334974 Ga0070717_103349742 255
257 3300006163 Ga0070715_10009752 Ga0070715_100097522 255
258 3300006163 Ga0070715_10152909 Ga0070715_101529092 255
259 3300006173 Ga0070716_100320057 Ga0070716_1003200571 255
260 3300006175 Ga0070712_100009339 Ga0070712_1000093392 255
261 3300006175 Ga0070712_100165932 Ga0070712_1001659322 255
262 3300006175 Ga0070712_100201288 Ga0070712_1002012882 255
263 3300006237 Ga0097621_100069030 Ga0097621_1000690305 255
264 3300006358 Ga0068871_100155023 Ga0068871_1001550232 255
265 3300006358 Ga0068871_100645678 Ga0068871_1006456781 255
266 3300006871 Ga0075434_100016273 Ga0075434_1000162733 255
267 3300006914 Ga0075436_100048974 Ga0075436_1000489742 255
268 3300006914 Ga0075436_100143228 Ga0075436_1001432283 255
269 3300006914 Ga0075436_100213968 Ga0075436_1002139681 255
270 3300007076 Ga0075435_100012016 Ga0075435_1000120164 255
271 3300007788 Ga0099795_10014308 Ga0099795_100143082 255
272 3300009011 Ga0105251_10032922 Ga0105251_100329223 255
273 3300009093 Ga0105240_10137762 Ga0105240_101377623 255
274 3300009148 Ga0105243_10281794 Ga0105243_102817943 255
275 3300009174 Ga0105241_10051820 Ga0105241_100518202 255
276 3300009174 Ga0105241_10504867 Ga0105241_105048671 255
277 3300009176 Ga0105242_10241356 Ga0105242_102413563 255
278 3300009177 Ga0105248_10031085 Ga0105248_100310857 255
279 3300009551 Ga0105238_10773609 Ga0105238_107736091 255
280 3300009553 Ga0105249_10480588 Ga0105249_104805881 255
281 3300010159 Ga0099796_10067101 Ga0099796_100671013 255
282 3300012515 Ga0157338_1007055 Ga0157338_10070551 255
283 3300013100 Ga0157373_10017055 Ga0157373_100170553 255
284 3300013104 Ga0157370_10165598 Ga0157370_101655982 255
285 3300013105 Ga0157369_10412547 Ga0157369_104125472 255
286 3300013296 Ga0157374_10181600 Ga0157374_101816003 255
287 3300013297 Ga0157378_10202063 Ga0157378_102020632 255
288 3300014325 Ga0163163_10035818 Ga0163163_100358185 255
289 3300014325 Ga0163163_10174172 Ga0163163_101741722 255
290 3300014745 Ga0157377_10038305 Ga0157377_100383054 255
291 3300014968 Ga0157379_10472064 Ga0157379_104720641 255
292 3300020081 Ga0206354_10023125 Ga0206354_100231253 255
293 3300020082 Ga0206353_10457440 Ga0206353_104574402 255
294 3300025885 Ga0207653_10055896 Ga0207653_100558962 255
295 3300025898 Ga0207692_10011039 Ga0207692_100110392 255
296 3300025901 Ga0207688_10044054 Ga0207688_100440542 255
297 3300025903 Ga0207680_10320655 Ga0207680_103206551 255
298 3300025905 Ga0207685_10002720 Ga0207685_100027203 255
299 3300025906 Ga0207699_10004058 Ga0207699_100040588 255
300 3300025906 Ga0207699_10006833 Ga0207699_100068332 255
301 3300025906 Ga0207699_10044442 Ga0207699_100444423 255
302 3300025907 Ga0207645_10145403 Ga0207645_101454032 255
303 3300025908 Ga0207643_10020448 Ga0207643_100204484 255
304 3300025909 Ga0207705_10667824 Ga0207705_106678241 255
305 3300025910 Ga0207684_10002280 Ga0207684_1000228014 255
306 3300025910 Ga0207684_10013750 Ga0207684_100137505 255
307 3300025911 Ga0207654_10045012 Ga0207654_100450122 255
308 3300025911 Ga0207654_10410524 Ga0207654_104105241 255
309 3300025915 Ga0207693_10033573 Ga0207693_100335733 255
310 3300025916 Ga0207663_10054706 Ga0207663_100547062 255
311 3300025916 Ga0207663_10062499 Ga0207663_100624991 255
312 3300025916 Ga0207663_10160499 Ga0207663_101604991 255
313 3300025916 Ga0207663_10219928 Ga0207663_102199282 255
314 3300025918 Ga0207662_10029413 Ga0207662_100294131 255
315 3300025919 Ga0207657_10026274 Ga0207657_100262746 255
316 3300025922 Ga0207646_10004735 Ga0207646_100047352 255
317 3300025924 Ga0207694_10226138 Ga0207694_102261382 255
318 3300025927 Ga0207687_10624917 Ga0207687_106249171 255
319 3300025928 Ga0207700_10001080 Ga0207700_1000108011 255
320 3300025928 Ga0207700_10012073 Ga0207700_100120736 255
321 3300025929 Ga0207664_10016258 Ga0207664_100162583 255
322 3300025929 Ga0207664_10107176 Ga0207664_101071763 255
323 3300025929 Ga0207664_10168529 Ga0207664_101685292 255
324 3300025929 Ga0207664_10320687 Ga0207664_103206872 255
325 3300025931 Ga0207644_10141107 Ga0207644_101411071 255
326 3300025932 Ga0207690_10481025 Ga0207690_104810251 255
327 3300025933 Ga0207706_10050882 Ga0207706_100508823 255
328 3300025935 Ga0207709_10240915 Ga0207709_102409151 255
329 3300025939 Ga0207665_10009530 Ga0207665_100095301 255
330 3300025939 Ga0207665_10160643 Ga0207665_101606432 255
331 3300025940 Ga0207691_10062115 Ga0207691_100621154 255
332 3300025942 Ga0207689_10014748 Ga0207689_100147483 255
333 3300025960 Ga0207651_10235081 Ga0207651_102350813 255
334 3300026023 Ga0207677_10223321 Ga0207677_102233211 255
335 3300026041 Ga0207639_10203090 Ga0207639_102030903 255
336 3300026067 Ga0207678_10016213 Ga0207678_100162136 255
337 3300026075 Ga0207708_10126387 Ga0207708_101263873 255
338 3300026078 Ga0207702_10353729 Ga0207702_103537291 255
339 3300026078 Ga0207702_10773657 Ga0207702_107736571 255
340 3300026088 Ga0207641_10213810 Ga0207641_102138103 255
341 3300026116 Ga0207674_10021991 Ga0207674_100219917 255
342 3300026118 Ga0207675_100177918 Ga0207675_1001779183 255
343 3300026121 Ga0207683_10015880 Ga0207683_100158804 255
344 3300028379 Ga0268266_10473301 Ga0268266_104733012 255
345 3300028381 Ga0268264_10937516 Ga0268264_109375161 255
346 3300028786 Ga0307517_10003996 Ga0307517_1000399618 255
347 3300028786 Ga0307517_10082973 Ga0307517_100829732 255
348 3300028794 Ga0307515_10100229 Ga0307515_101002292 255
349 3300030521 Ga0307511_10103126 Ga0307511_101031263 255
350 3300031507 Ga0307509_10526326 Ga0307509_105263261 255
351 3300031616 Ga0307508_10006889 Ga0307508_100068894 255
352 3300031616 Ga0307508_10008020 Ga0307508_100080203 255
353 3300031649 Ga0307514_10017946 Ga0307514_100179463 255
354 3300031649 Ga0307514_10109544 Ga0307514_101095442 255
355 3300031730 Ga0307516_10009624 Ga0307516_100096244 255
356 3300031838 Ga0307518_10001359 Ga0307518_1000135910 255
357 3300033179 Ga0307507_10000001 Ga0307507_10000001178 255
358 3300033179 Ga0307507_10046326 Ga0307507_100463264 255
359 3300033180 Ga0307510_10163415 Ga0307510_101634153 255
360 3300034817 Ga0373948_0060325 Ga0373948_0060325_25_792 255
361 3300034818 Ga0373950_0004197 Ga0373950_0004197_1014_1781 255
362 3300034957 Ga0373938_0027600 Ga0373938_0027600_79_846 255
363 3300035083 Ga0373926_0002249 Ga0373926_0002249_3020_3814 255
364 3300035084 Ga0373928_0027356 Ga0373928_0027356_309_1076 255
365 3300035085 Ga0373929_0008712 Ga0373929_0008712_27_794 255
366 3300035088 Ga0373940_0010414 Ga0373940_0010414_854_1621 255
367 3300035089 Ga0373944_0031331 Ga0373944_0031331_23_790 255
368 3300035091 Ga0373951_0002912 Ga0373951_0002912_1155_1922 255
369 3300035091 Ga0373951_0012983 Ga0373951_0012983_391_1158 255
370 3300035092 Ga0373952_0012635 Ga0373952_0012635_253_1020 255
371 3300035092 Ga0373952_0014464 Ga0373952_0014464_793_1560 255
372 3300035111 Ga0373923_0000435 Ga0373923_0000435_8807_9601 255
373 3300035113 Ga0373936_0041467 Ga0373936_0041467_826_1620 255
374 3300035116 Ga0373945_0004083 Ga0373945_0004083_2940_3707 255
375 3300035116 Ga0373945_0030614 Ga0373945_0030614_305_1099 255
376 3300035117 Ga0373953_0025805 Ga0373953_0025805_960_1727 255
377 3300035118 Ga0373954_0021708 Ga0373954_0021708_2058_2825 255
378 3300035118 Ga0373954_0022369 Ga0373954_0022369_776_1543 255
379 3300035118 Ga0373954_0042000 Ga0373954_0042000_526_1320 255
380 3300035119 Ga0373956_0004929 Ga0373956_0004929_2142_2909 255
381 3300035119 Ga0373956_0017432 Ga0373956_0017432_2195_2989 255
382 3300035120 Ga0373957_0004915 Ga0373957_0004915_1936_2703 255
383 3300035170 Ga0373943_0013389 Ga0373943_0013389_102_896 255
384 3300035171 Ga0373946_0149562 Ga0373946_0149562_23_790 255
385 3300035172 Ga0373955_0005979 Ga0373955_0005979_2513_3280 255
386 3300035172 Ga0373955_0057093 Ga0373955_0057093_433_1227 255
387 3300035241 Ga0373961_0003784 Ga0373961_0003784_1254_2021 255
388 3300035242 Ga0373962_0024557 Ga0373962_0024557_385_1152 255
389 3300035410 Ga0373924_0000454 Ga0373924_0000454_143_937 255
390 3300035410 Ga0373924_0004238 Ga0373924_0004238_662_1429 255
391 3300035692 Ga0373935_0016635 Ga0373935_0016635_826_1620 255
392 3300035692 Ga0373935_0017464 Ga0373935_0017464_3563_4330 255
393 3300035695 Ga0373927_0004257 Ga0373927_0004257_9234_10028 255
394 3300035724 Ga0373933_0005701 Ga0373933_0005701_749_1516 255
395 3300035724 Ga0373933_0081207 Ga0373933_0081207_396_1190 255
396 3300035724 Ga0373933_0153897 Ga0373933_0153897_559_1326 255
397 3300036401 Ga0373937_0121282 Ga0373937_0121282_1345_2112 255
398 3300037068 Ga0373925_0012060 Ga0373925_0012060_4252_5019 255
399 3300037068 Ga0373925_0042762 Ga0373925_0042762_1865_2659 255
400 3300037068 Ga0373925_0070660 Ga0373925_0070660_1245_2012 255
401 3300044656 Ga0466969_0072327 Ga0466969_0072327_658_1425 255
402 3300044693 Ga0466961_0049742 Ga0466961_0049742_1514_2281 255
403 3300044693 Ga0466961_0182511 Ga0466961_0182511_428_1231 255
404 3300044719 Ga0466971_0000965 Ga0466971_0000965_363_1130 255
405 3300044901 Ga0466960_0006561 Ga0466960_0006561_879_1646 255
406 3300045049 Ga0466959_0080113 Ga0466959_0080113_439_1209 255
407 3300045049 Ga0466959_0152618 Ga0466959_0152618_643_1410 255
408 3300045976 Ga0466967_0084091 Ga0466967_0084091_1344_2111 255
409 3300046452 Ga0495617_026579 Ga0495617_026579_731_1498 255
410 3300046454 Ga0495592_0014690 Ga0495592_0014690_2757_3524 255
411 3300046454 Ga0495592_0033900 Ga0495592_0033900_2385_3152 255
412 3300046454 Ga0495592_0045453 Ga0495592_0045453_266_1033 255
413 3300046454 Ga0495592_0045497 Ga0495592_0045497_2411_3178 255
414 3300046454 Ga0495592_0053639 Ga0495592_0053639_1159_1953 255
415 3300046455 Ga0495603_0012804 Ga0495603_0012804_2576_3343 255
416 3300046455 Ga0495603_0016005 Ga0495603_0016005_685_1479 255
417 3300046455 Ga0495603_0038840 Ga0495603_0038840_416_1183 255
418 3300046455 Ga0495603_0179274 Ga0495603_0179274_159_926 255
419 3300046459 Ga0495629_0000836 Ga0495629_0000836_20780_21547 255
420 3300046459 Ga0495629_0004490 Ga0495629_0004490_9290_10057 255
421 3300046459 Ga0495629_0005491 Ga0495629_0005491_3997_4764 255
422 3300046459 Ga0495629_0006360 Ga0495629_0006360_6229_7065 255
423 3300046459 Ga0495629_0010061 Ga0495629_0010061_945_1712 255
424 3300046459 Ga0495629_0024501 Ga0495629_0024501_2808_3602 255
425 3300046459 Ga0495629_0061358 Ga0495629_0061358_1763_2530 255
426 3300046459 Ga0495629_0072046 Ga0495629_0072046_625_1392 255
427 3300046460 Ga0495638_0056436 Ga0495638_0056436_863_1630 255
428 3300046460 Ga0495638_0091605 Ga0495638_0091605_1000_1767 255
429 3300046461 Ga0495641_0024973 Ga0495641_0024973_162_956 255
430 3300046462 Ga0495651_0001022 Ga0495651_0001022_14736_15503 255
431 3300046462 Ga0495651_0023969 Ga0495651_0023969_727_1494 255
432 3300046462 Ga0495651_0093672 Ga0495651_0093672_559_1326 255
433 3300046462 Ga0495651_0170996 Ga0495651_0170996_527_1321 255
434 3300046463 Ga0495653_0004386 Ga0495653_0004386_2385_3152 255
435 3300046463 Ga0495653_0111899 Ga0495653_0111899_464_1258 255
436 3300046472 Ga0495580_0147458 Ga0495580_0147458_549_1316 255
437 3300046473 Ga0495582_0003713 Ga0495582_0003713_6330_7097 255
438 3300046473 Ga0495582_0004944 Ga0495582_0004944_5981_6775 255
439 3300046473 Ga0495582_0258441 Ga0495582_0258441_74_841 255
440 3300046474 Ga0495605_0002245 Ga0495605_0002245_5317_6084 255
441 3300046475 Ga0495639_0007870 Ga0495639_0007870_3561_4355 255
442 3300046475 Ga0495639_0010514 Ga0495639_0010514_2770_3537 255
443 3300046475 Ga0495639_0141643 Ga0495639_0141643_25_792 255
444 3300046476 Ga0495662_0004950 Ga0495662_0004950_442_1209 255
445 3300046476 Ga0495662_0007733 Ga0495662_0007733_1865_2659 255
446 3300046477 Ga0495664_0001319 Ga0495664_0001319_9881_10648 255
447 3300046477 Ga0495664_0007276 Ga0495664_0007276_2638_3405 255
448 3300046477 Ga0495664_0152538 Ga0495664_0152538_250_1017 255
449 3300046499 Ga0495594_0001045 Ga0495594_0001045_4078_4845 255
450 3300046499 Ga0495594_0009856 Ga0495594_0009856_766_1533 255
451 3300046499 Ga0495594_0035381 Ga0495594_0035381_1799_2566 255
452 3300046499 Ga0495594_0047042 Ga0495594_0047042_650_1444 255
453 3300046499 Ga0495594_0190126 Ga0495594_0190126_74_841 255
454 3300046499 Ga0495594_0191644 Ga0495594_0191644_87_854 255
455 3300046501 Ga0495607_0042005 Ga0495607_0042005_1599_2366 255
456 3300046501 Ga0495607_0151885 Ga0495607_0151885_24_791 255
457 3300046507 Ga0495606_0025633 Ga0495606_0025633_558_1325 255
458 3300046511 Ga0495608_0010309 Ga0495608_0010309_18_785 255
459 3300046511 Ga0495608_0027396 Ga0495608_0027396_726_1493 255
460 3300046514 Ga0495618_0023883 Ga0495618_0023883_2687_3481 255
461 3300046514 Ga0495618_0256398 Ga0495618_0256398_96_863 255
462 3300046515 Ga0495620_0000455 Ga0495620_0000455_12081_12848 255
463 3300046516 Ga0495628_0015023 Ga0495628_0015023_4881_5648 255
464 3300046516 Ga0495628_0034078 Ga0495628_0034078_1825_2619 255
465 3300046516 Ga0495628_0049501 Ga0495628_0049501_1281_2048 255
466 3300046516 Ga0495628_0069077 Ga0495628_0069077_1327_2094 255
467 3300046516 Ga0495628_0348837 Ga0495628_0348837_93_860 255
468 3300046517 Ga0495630_0012682 Ga0495630_0012682_1433_2200 255
469 3300046517 Ga0495630_0131920 Ga0495630_0131920_799_1593 255
470 3300046518 Ga0495631_0013538 Ga0495631_0013538_2237_3004 255
471 3300046519 Ga0495632_0018577 Ga0495632_0018577_959_1726 255
472 3300046520 Ga0495637_0134948 Ga0495637_0134948_134_901 255
473 3300046522 Ga0495643_0002871 Ga0495643_0002871_6078_6845 255
474 3300046524 Ga0495648_0199047 Ga0495648_0199047_95_862 255
475 3300046526 Ga0495666_0001661 Ga0495666_0001661_9748_10542 255
476 3300046526 Ga0495666_0002088 Ga0495666_0002088_4775_5542 255
477 3300046526 Ga0495666_0033644 Ga0495666_0033644_908_1675 255
478 3300046529 Ga0495652_0002425 Ga0495652_0002425_8091_8858 255
479 3300046529 Ga0495652_0162716 Ga0495652_0162716_747_1514 255
480 3300046529 Ga0495652_0282997 Ga0495652_0282997_190_957 255
481 3300046531 Ga0495665_0004492 Ga0495665_0004492_1434_2201 255
482 3300046531 Ga0495665_0014555 Ga0495665_0014555_1916_2683 255
483 3300046531 Ga0495665_0070032 Ga0495665_0070032_439_1206 255
484 3300046533 Ga0495640_0005341 Ga0495640_0005341_8899_9666 255
485 3300046533 Ga0495640_0012603 Ga0495640_0012603_1469_2305 255
486 3300046533 Ga0495640_0013060 Ga0495640_0013060_5292_6059 255
487 3300046533 Ga0495640_0015518 Ga0495640_0015518_433_1227 255
488 3300046533 Ga0495640_0151474 Ga0495640_0151474_577_1344 255
489 3300046533 Ga0495640_0326025 Ga0495640_0326025_52_819 255
490 3300046535 Ga0495586_0002343 Ga0495586_0002343_1233_2000 255
491 3300046535 Ga0495586_0063470 Ga0495586_0063470_889_1683 255
492 3300046535 Ga0495586_0127673 Ga0495586_0127673_625_1392 255
493 3300046536 Ga0495587_0027475 Ga0495587_0027475_2637_3404 255
494 3300046536 Ga0495587_0030120 Ga0495587_0030120_2259_3026 255
495 3300046536 Ga0495587_0036601 Ga0495587_0036601_294_1088 255
496 3300046536 Ga0495587_0060874 Ga0495587_0060874_13_780 255
497 3300046543 Ga0495645_0002788 Ga0495645_0002788_9465_10232 255
498 3300046543 Ga0495645_0083489 Ga0495645_0083489_960_1727 255
499 3300046543 Ga0495645_0097731 Ga0495645_0097731_1070_1864 255
500 3300046557 Ga0495622_0009578 Ga0495622_0009578_2952_3719 255
501 3300046557 Ga0495622_0012820 Ga0495622_0012820_745_1512 255
502 3300046557 Ga0495622_0137750 Ga0495622_0137750_303_1097 255
503 3300046558 Ga0495633_0119215 Ga0495633_0119215_130_897 255
504 3300046559 Ga0495667_0003857 Ga0495667_0003857_6072_6839 255
505 3300046559 Ga0495667_0041644 Ga0495667_0041644_2025_2819 255
506 3300046559 Ga0495667_0081560 Ga0495667_0081560_164_931 255
507 3300046616 Ga0495668_0028920 Ga0495668_0028920_895_1662 255
508 3300046642 Ga0495634_0004501 Ga0495634_0004501_5001_5768 255
509 3300046642 Ga0495634_0021767 Ga0495634_0021767_2906_3700 255
510 3300046642 Ga0495634_0021868 Ga0495634_0021868_35_802 255
511 3300046642 Ga0495634_0023671 Ga0495634_0023671_1263_2099 255
512 3300046642 Ga0495634_0045897 Ga0495634_0045897_1478_2245 255
513 3300046642 Ga0495634_0082931 Ga0495634_0082931_491_1258 255
514 3300046642 Ga0495634_0245846 Ga0495634_0245846_311_1078 255
515 3300046648 Ga0495611_0024512 Ga0495611_0024512_28_795 255
516 3300046660 Ga0495625_0007372 Ga0495625_0007372_6598_7365 255
517 3300046660 Ga0495625_0010156 Ga0495625_0010156_3435_4262 255
518 3300046663 Ga0495635_0007633 Ga0495635_0007633_6646_7413 255
519 3300046663 Ga0495635_0008131 Ga0495635_0008131_5399_6166 255
520 3300046663 Ga0495635_0015068 Ga0495635_0015068_4468_5262 255
521 3300046663 Ga0495635_0053396 Ga0495635_0053396_1458_2225 255
522 3300046674 Ga0495588_0004093 Ga0495588_0004093_4461_5228 255
523 3300046674 Ga0495588_0114447 Ga0495588_0114447_204_998 255
524 3300046675 Ga0495657_0010807 Ga0495657_0010807_3704_4471 255
525 3300046675 Ga0495657_0010888 Ga0495657_0010888_217_984 255
526 3300046675 Ga0495657_0031604 Ga0495657_0031604_1885_2721 255
527 3300046675 Ga0495657_0032391 Ga0495657_0032391_2636_3430 255
528 3300046675 Ga0495657_0049099 Ga0495657_0049099_1379_2146 255
529 3300046678 Ga0495599_0007565 Ga0495599_0007565_621_1388 255
530 3300046678 Ga0495599_0012736 Ga0495599_0012736_133_900 255
531 3300046678 Ga0495599_0089283 Ga0495599_0089283_13_780 255
532 3300046679 Ga0495623_0008306 Ga0495623_0008306_2785_3552 255
533 3300046679 Ga0495623_0064087 Ga0495623_0064087_146_940 255
534 3300046679 Ga0495623_0064595 Ga0495623_0064595_750_1517 255
535 3300046679 Ga0495623_0189449 Ga0495623_0189449_141_908 255
536 3300046680 Ga0495646_0019984 Ga0495646_0019984_1332_2099 255
537 3300046680 Ga0495646_0062755 Ga0495646_0062755_695_1462 255
538 3300046680 Ga0495646_0136976 Ga0495646_0136976_433_1227 255
539 3300046681 Ga0495647_0026156 Ga0495647_0026156_1021_1815 255
540 3300046681 Ga0495647_0072686 Ga0495647_0072686_150_917 255
541 3300046683 Ga0495658_0005743 Ga0495658_0005743_5032_5799 255
542 3300046683 Ga0495658_0010831 Ga0495658_0010831_2848_3642 255
543 3300046689 Ga0495613_0003025 Ga0495613_0003025_4126_4893 255
544 3300046689 Ga0495613_0005122 Ga0495613_0005122_4510_5277 255
545 3300046689 Ga0495613_0023132 Ga0495613_0023132_3547_4314 255
546 3300046689 Ga0495613_0029702 Ga0495613_0029702_1932_2699 255
547 3300046689 Ga0495613_0060637 Ga0495613_0060637_211_978 255
548 3300046689 Ga0495613_0069303 Ga0495613_0069303_471_1265 255
549 3300046690 Ga0495624_0039786 Ga0495624_0039786_1542_2309 255
550 3300046690 Ga0495624_0051884 Ga0495624_0051884_1434_2201 255
551 3300046690 Ga0495624_0087868 Ga0495624_0087868_899_1693 255
552 3300046690 Ga0495624_0119267 Ga0495624_0119267_426_1193 255
553 3300046690 Ga0495624_0182519 Ga0495624_0182519_101_868 255
554 3300046691 Ga0495670_0015625 Ga0495670_0015625_1841_2608 255
555 3300046794 Ga0495589_0003390 Ga0495589_0003390_2851_3618 255
556 3300046794 Ga0495589_0052648 Ga0495589_0052648_1137_1904 255
557 3300046809 Ga0495600_0050328 Ga0495600_0050328_284_1051 255
558 3300046809 Ga0495600_0064913 Ga0495600_0064913_146_913 255
559 3300046809 Ga0495600_0288394 Ga0495600_0288394_13_780 255
560 3300046810 Ga0495660_0016153 Ga0495660_0016153_3297_4064 255
561 3300046810 Ga0495660_0074594 Ga0495660_0074594_525_1292 255
562 3300047315 Ga0495581_0005449 Ga0495581_0005449_4872_5639 255
563 3300047317 Ga0495604_0001004 Ga0495604_0001004_8655_9422 255
564 3300047317 Ga0495604_0012553 Ga0495604_0012553_4518_5285 255
565 3300047317 Ga0495604_0030807 Ga0495604_0030807_27_794 255
566 3300047317 Ga0495604_0037705 Ga0495604_0037705_987_1781 255
567 3300047319 Ga0495674_0014892 Ga0495674_0014892_455_1222 255
568 3300047319 Ga0495674_0036738 Ga0495674_0036738_2941_3708 255
569 3300047319 Ga0495674_0179172 Ga0495674_0179172_826_1620 255
570 3300047321 Ga0495676_0003552 Ga0495676_0003552_13184_13951 255
571 3300047321 Ga0495676_0013326 Ga0495676_0013326_6320_7156 255
572 3300047321 Ga0495676_0014465 Ga0495676_0014465_3075_3842 255
573 3300047321 Ga0495676_0058495 Ga0495676_0058495_1164_1958 255
574 3300047322 Ga0495680_0006725 Ga0495680_0006725_218_1012 255
575 3300047322 Ga0495680_0014193 Ga0495680_0014193_5362_6129 255
576 3300047322 Ga0495680_0021859 Ga0495680_0021859_116_883 255
577 3300047322 Ga0495680_0115465 Ga0495680_0115465_782_1549 255
578 3300047323 Ga0495683_0096765 Ga0495683_0096765_548_1315 255
579 3300047323 Ga0495683_0106159 Ga0495683_0106159_156_923 255
580 3300047443 Ga0495687_013487 Ga0495687_013487_15_782 255
581 3300047443 Ga0495687_036461 Ga0495687_036461_280_1047 255
582 3300047444 Ga0495675_0010768 Ga0495675_0010768_1266_2033 255
583 3300047444 Ga0495675_0021793 Ga0495675_0021793_1907_2674 255
584 3300047444 Ga0495675_0052262 Ga0495675_0052262_1658_2452 255
585 3300047447 Ga0495685_000145 Ga0495685_000145_9593_10360 255
586 3300047470 Ga0495681_0003982 Ga0495681_0003982_8883_9650 255
587 3300047471 Ga0495684_0014703 Ga0495684_0014703_621_1388 255
588 3300047471 Ga0495684_0073969 Ga0495684_0073969_1095_1862 255
589 3300047472 Ga0495686_0075165 Ga0495686_0075165_305_1072 255
590 3300047472 Ga0495686_0105025 Ga0495686_0105025_516_1283 255
591 3300047673 Ga0495593_0003238 Ga0495593_0003238_926_1720 255
592 3300047673 Ga0495593_0003876 Ga0495593_0003876_337_1104 255
593 3300047673 Ga0495593_0111406 Ga0495593_0111406_499_1266 255
594 3300048088 Ga0495602_0049852 Ga0495602_0049852_2530_3297 255
595 3300048088 Ga0495602_0070060 Ga0495602_0070060_133_900 255
596 3300048088 Ga0495602_0137503 Ga0495602_0137503_18_785 255
597 3300048089 Ga0495614_0003028 Ga0495614_0003028_292_1059 255
598 3300048089 Ga0495614_0004258 Ga0495614_0004258_3480_4247 255
599 3300048089 Ga0495614_0025498 Ga0495614_0025498_560_1354 255
600 3300048089 Ga0495614_0037431 Ga0495614_0037431_295_1062 255
601 3300048903 Ga0496100_0099229 Ga0496100_0099229_471_1238 255
602 3300048903 Ga0496100_0199183 Ga0496100_0199183_382_1149 255
603 3300048904 Ga0496101_0064146 Ga0496101_0064146_1558_2325 255
604 3300048904 Ga0496101_0092880 Ga0496101_0092880_688_1455 255
605 3300048905 Ga0496102_0093559 Ga0496102_0093559_388_1155 255
606 3300048906 Ga0496103_0223958 Ga0496103_0223958_82_849 255
607 3300048907 Ga0496104_0232228 Ga0496104_0232228_80_847 255
608 3300048907 Ga0496104_0233646 Ga0496104_0233646_27_794 255
609 3300048907 Ga0496104_0338918 Ga0496104_0338918_365_1132 255
610 3300048908 Ga0496105_0015001 Ga0496105_0015001_4544_5311 255
611 3300048908 Ga0496105_0266428 Ga0496105_0266428_548_1315 255
612 3300048909 Ga0496106_0031752 Ga0496106_0031752_196_963 255
613 3300048910 Ga0496107_0101353 Ga0496107_0101353_1168_1935 255
614 3300048910 Ga0496107_0105321 Ga0496107_0105321_1047_1814 255
615 3300048911 Ga0496108_0230016 Ga0496108_0230016_458_1225 255
616 3300048913 Ga0496110_0174299 Ga0496110_0174299_24_791 255
617 3300048913 Ga0496110_0618668 Ga0496110_0618668_43_810 255
618 3300048914 Ga0496111_0015895 Ga0496111_0015895_330_1097 255
619 3300048915 Ga0496112_0018611 Ga0496112_0018611_2878_3645 255
620 3300048916 Ga0496113_0145661 Ga0496113_0145661_1042_1809 255
621 3300048916 Ga0496113_0600300 Ga0496113_0600300_33_800 255
622 3300048918 Ga0496115_0025010 Ga0496115_0025010_2862_3629 255
623 3300048918 Ga0496115_0430117 Ga0496115_0430117_16_783 255
624 3300048929 Ga0496126_0013418 Ga0496126_0013418_4181_4987 255
625 3300049459 Ga0495678_088253 Ga0495678_088253_285_1052 255
626 3300049568 Ga0501031_0004715 Ga0501031_0004715_2760_3527 255
627 3300049569 Ga0501032_0005462 Ga0501032_0005462_2720_3487 255
628 3300049569 Ga0501032_0213173 Ga0501032_0213173_32_799 255
629 3300049570 Ga0501033_0145999 Ga0501033_0145999_656_1423 255
630 3300049570 Ga0501033_0228351 Ga0501033_0228351_210_977 255
631 3300049571 Ga0501034_0203104 Ga0501034_0203104_1032_1799 255
632 3300049572 Ga0501036_0315567 Ga0501036_0315567_265_1032 255
633 3300049573 Ga0501037_0178252 Ga0501037_0178252_578_1345 255
634 3300049574 Ga0501038_0000899 Ga0501038_0000899_23404_24171 255
635 3300049579 Ga0501043_0376656 Ga0501043_0376656_149_916 255
636 3300049580 Ga0501046_0079534 Ga0501046_0079534_1513_2280 255
637 3300049581 Ga0501047_0134540 Ga0501047_0134540_1433_2200 255
638 3300049582 Ga0501048_0000934 Ga0501048_0000934_2264_3031 255
639 3300049586 Ga0501070_0010297 Ga0501070_0010297_4888_5655 255
640 3300049822 Ga0501035_0039216 Ga0501035_0039216_2880_3647 255
641 3300049822 Ga0501035_0049256 Ga0501035_0049256_287_1054 255
642 3300049822 Ga0501035_0093900 Ga0501035_0093900_1733_2542 255
643 3300049822 Ga0501035_0404934 Ga0501035_0404934_150_917 255
644 3300049823 Ga0501044_0066344 Ga0501044_0066344_285_1052 255
645 3300049823 Ga0501044_0327653 Ga0501044_0327653_342_1151 255
646 3300049823 Ga0501044_0331937 Ga0501044_0331937_194_961 255
647 3300049824 Ga0501045_0609658 Ga0501045_0609658_10_777 255
648 3300050513 nmdc:mga0rr50_4166_c1 nmdc:mga0rr50_4166_c1_5094_5861 255
649 3300050514 nmdc:mga08x19_6725_c1 nmdc:mga08x19_6725_c1_2221_2988 255
650 3300050515 nmdc:mga0a205_279410_c1 nmdc:mga0a205_279410_c1_558_1325 255
651 3300053077 Ga0495601_0001830 Ga0495601_0001830_10795_11589 255
652 3300053077 Ga0495601_0005325 Ga0495601_0005325_4472_5239 255
653 3300053077 Ga0495601_0015275 Ga0495601_0015275_1117_1884 255
654 3300053077 Ga0495601_0021647 Ga0495601_0021647_477_1244 255
655 3300053077 Ga0495601_0057414 Ga0495601_0057414_30_797 255
656 3300053078 Ga0495612_0001000 Ga0495612_0001000_7197_7964 255
657 3300053078 Ga0495612_0004060 Ga0495612_0004060_4790_5557 255
658 3300053078 Ga0495612_0006137 Ga0495612_0006137_73_840 255
659 3300053083 Ga0495655_0008073 Ga0495655_0008073_676_1443 255
660 3300053084 Ga0495595_0009343 Ga0495595_0009343_2785_3552 255
661 3300053084 Ga0495595_0051040 Ga0495595_0051040_81_875 255
662 3300053084 Ga0495595_0077779 Ga0495595_0077779_463_1230 255
663 3300053085 Ga0495619_0002227 Ga0495619_0002227_5570_6337 255
664 3300053085 Ga0495619_0020414 Ga0495619_0020414_1769_2563 255
665 3300053085 Ga0495619_0068323 Ga0495619_0068323_249_1016 255
666 3300053086 Ga0500578_0009224 Ga0500578_0009224_4685_5452 255
667 3300053099 Ga0500654_064699 Ga0500654_064699_940_1707 255
668 3300053100 Ga0500660_076483 Ga0500660_076483_567_1334 255
669 3300053107 Ga0500560_001138 Ga0500560_001138_3502_4269 255
670 3300053131 Ga0500652_007209 Ga0500652_007209_1882_2649 255
671 3300053134 Ga0500658_0000847 Ga0500658_0000847_10033_10800 255
672 3300053137 Ga0500561_0000168 Ga0500561_0000168_8494_9261 255
673 3300053140 Ga0500573_0002584 Ga0500573_0002584_5455_6222 255
674 3300053143 Ga0500579_056230 Ga0500579_056230_611_1378 255
675 3300053149 Ga0500600_0002727 Ga0500600_0002727_8603_9370 255
676 3300053149 Ga0500600_0137658 Ga0500600_0137658_420_1187 255
677 3300053153 Ga0500616_0029487 Ga0500616_0029487_1607_2374 255
678 3300053160 Ga0500633_0000369 Ga0500633_0000369_296_1063 255
679 3300053161 Ga0500634_0001537 Ga0500634_0001537_296_1063 255
680 3300053739 Ga0500587_000305 Ga0500587_000305_3297_4064 255
681 3300061719 Ga0466962_0009387 Ga0466962_0009387_3331_4098 255
682 iso_pu_bacteria 2867369537 2867374860 255
683 iso_pu_bacteria 8055157932 8055158856 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

34

269

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tb5-assembly2.cif.gz_B crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.9755 1 254
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9738 1 253
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.972 1 253
5yoi-assembly1.cif.gz_A mycobacterium tuberculosis methionine aminopeptidase type 1c (c105t mutant) in complex with methionine 0.9698 4 255
5yoh-assembly1.cif.gz_A mycobacterium tuberculosis methionine aminopeptidase type 1c (c105m mutant) in complex with methionine 0.9698 4 255
ID Description Score Start End Superfamily
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9751 1 253 3.90.230.10
af_P9WK19_6_284_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9702 4 253 3.90.230.10
af_Q9VKV9_33_317_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.969 1 253 3.90.230.10
af_Q4VBS4_53_336_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.969 1 255 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9685 1 255 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A6B1P9B0-F1-model_v4 deleted 0.9967 1 214
AF-A0A7K1B200-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.996 13 255 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A0K2RSB2-F1-model_v4 Methionine aminopeptidase 1 0.9936 105 255 GO:0005829
GO:0070006
AF-A0A7W3T825-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9927 67 255 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A6B1P9B0-F1-model_v4 deleted 0.992 1 214

Feature Viewer

pLDDT pTM Quality
97.35 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map