F474926

General Info

Members Datasets Scaffolds Average Seq Length
682 416 596 235

Family's Representative Sequence

Representative Sequence 3300042156|Ga0439446_0050007|Ga0439446_0050007_262_972
Length 236
Sequence MPDLTRFAITRKWPAAHPDRLQLYSLPTPNGVKVSIALEELGLPYEAHRVAFDTNDQLSPEFLSLNPNNKIPAIIDPDGPGGQPLALFESGAILVYLAEKTGRLLPRAAAAAGRYETLQWVMWQMGGVGPMFGQVGFFHKFAGKDYEDKRPRDRYVEESKRLLRVLDGRLAGRSWIMGEDFTIADIATLPWVRNLIGFYGARELVGFDQFENVARVLNAFIDRPAVARGLTIPAAP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
4 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
5 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
6 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
7 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
8 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
9 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
10 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
11 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
12 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
13 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
14 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
15 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
16 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
17 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
18 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
19 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
20 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
21 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
22 2643221638 Duganella sp. Root336D2 Isolate Unclassified
23 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
24 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
25 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
26 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
27 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
28 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
29 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
30 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
31 2738541307 Variovorax sp. GV008 Isolate Unclassified
32 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
33 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
34 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
35 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
36 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
37 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
38 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
39 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
40 2818991446 Variovorax sp. 1180 Isolate Unclassified
41 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
42 2831864461 Roseateles noduli HZ7 Isolate Nodule
43 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
44 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
45 2842711865 Duganella sp. R-73148 Isolate Unclassified
46 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
47 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
48 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
49 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
50 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
51 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
52 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
53 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
54 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
55 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
56 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
57 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
58 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
59 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
60 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
61 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
62 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
63 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
64 2928037797 Variovorax sp. 1126 Isolate Unclassified
65 2928044640 Variovorax sp. 1128 Isolate Unclassified
66 2928051484 Variovorax sp. 1133 Isolate Unclassified
67 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
68 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
69 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
70 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
71 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
72 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
73 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
74 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
75 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
76 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
77 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
78 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
79 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
80 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
81 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
82 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
83 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
84 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
85 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
86 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
87 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
88 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
89 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
90 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
91 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
92 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
93 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
94 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
95 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
96 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
97 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
98 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
99 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
100 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
101 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
102 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
103 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
104 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
105 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
106 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
107 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
108 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
109 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
110 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
111 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
112 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
113 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
114 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
115 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
116 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
117 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
118 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
119 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
120 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
121 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
122 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
123 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
124 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
125 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
126 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
127 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
128 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
129 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
130 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
131 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
132 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
133 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
134 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
135 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
136 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
137 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
138 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
139 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
140 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
141 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
142 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
143 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
144 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
145 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
146 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
147 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
148 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
149 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
150 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
151 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
152 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
153 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
154 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
155 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
156 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
157 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
158 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
159 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
160 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
161 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
162 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
163 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
164 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
165 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
166 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
167 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
168 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
169 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
170 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
171 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
172 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
173 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
174 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
175 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
176 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
177 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
178 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
179 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
180 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
181 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
182 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
183 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
184 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
185 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
186 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
187 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
188 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
189 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
190 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
191 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
192 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
193 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
199 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
201 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
202 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
203 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
205 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
206 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
207 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
208 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
211 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
212 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
214 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
215 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
216 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
218 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
219 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
262 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
263 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
267 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
268 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
269 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
270 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
271 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
272 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
273 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
274 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
275 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
276 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
277 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
278 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
279 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
280 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
281 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
282 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
283 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
284 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
285 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
286 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
287 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
288 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
289 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
290 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
291 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
292 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
293 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
294 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
295 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
296 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
297 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
298 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
299 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
300 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
301 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
302 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
303 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
304 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
305 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
306 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
307 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
308 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
309 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
310 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
311 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
312 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
313 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
314 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
315 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
316 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
317 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
318 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
319 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
320 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
321 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
322 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
323 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
324 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
325 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
326 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
327 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
328 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
329 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
330 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
331 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
332 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
333 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
334 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
335 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
336 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
337 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
338 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
339 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
340 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
341 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
342 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
343 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
344 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
345 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
346 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
347 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
348 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
349 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
350 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
351 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
352 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
353 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
354 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
355 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
356 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
357 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
358 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
359 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
360 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
361 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
362 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
363 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
364 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
365 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
366 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
367 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
368 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
369 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
370 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
371 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
372 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
373 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
374 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
375 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
376 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
377 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
378 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
379 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
380 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
381 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
382 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
383 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
384 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
390 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
391 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
392 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
393 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
394 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
395 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
396 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
397 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
400 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
401 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
402 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
403 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
404 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
405 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
406 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
407 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
408 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
409 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
410 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
411 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
412 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
413 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
414 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
415 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
416 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.39
Metatranscriptomes 0
Isolates 12.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.9
Nodule 1.17
Rhizoplane 2.79
Rhizosphere 67.74
Stem 0
Stem Tuber 0
Unclassified 15.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2416600 2162886007 Bacteria 5529
2 JGI24741J21665_1008640 3300001915 Bacteria 1913
3 JGI24752J21851_1000730 3300001976 Bacteria 4392
4 JGI24737J22298_10050897 3300001990 Bacteria 1258
5 JGI24749J21850_1002277 3300002076 Bacteria 2701
6 JGI25155J39150_1002715 3300002704 Bacteria 938
7 JGI25156J39149_1002008 3300002705 Bacteria 7782
8 JGI25162J39368_1005774 3300002737 Bacteria 2312
9 JGI25154J39366_1000208 3300002738 Bacteria 41989
10 JGI25154J39366_1008483 3300002738 Bacteria 1319
11 JGI25152J39213_1004941 3300002773 Bacteria 4041
12 JGI25151J46595_10006396 3300003187 Bacteria 5921
13 JGI25151J46595_10021764 3300003187 Bacteria 2675
14 JGI25153J46596_10006450 3300003215 Bacteria 5921
15 JGI25153J46596_10018272 3300003215 Bacteria 2730
16 rootL2_10049679 3300003322 Bacteria 3654
17 JGI25160J50197_1010960 3300003354 Bacteria 3246
18 Ga0055538_1000386 3300003751 Bacteria 18042
19 Ga0055539_1000383 3300003752 Bacteria 18042
20 Ga0055533_1000378 3300003756 Bacteria 18026
21 Ga0055533_1000535 3300003756 Bacteria 13593
22 Ga0055532_1000473 3300003758 Bacteria 18042
23 Ga0055525_1000539 3300003759 Bacteria 18042
24 Ga0055529_1000080 3300003763 Bacteria 148614
25 Ga0055526_1000198 3300003771 Bacteria 51889
26 Ga0055526_1000827 3300003771 Bacteria 23107
27 Ga0055526_1009948 3300003771 Bacteria 4496
28 Ga0055526_1013069 3300003771 Bacteria 3549
29 Ga0055537_1000035 3300003773 Bacteria 96274
30 Ga0055537_1000111 3300003773 Bacteria 61884
31 Ga0055524_1001079 3300003775 Bacteria 16748
32 Ga0055524_1010543 3300003775 Bacteria 3672
33 Ga0055534_1000268 3300003784 Bacteria 35791
34 Ga0055528_1000178 3300003790 Bacteria 53709
35 Ga0055528_1009461 3300003790 Bacteria 4067
36 Ga0055530_10000246 3300003791 Bacteria 48934
37 Ga0055540_1006912 3300003792 Bacteria 4393
38 Ga0055540_1010127 3300003792 Bacteria 3166
39 Ga0055531_10007008 3300003794 Bacteria 6251
40 Ga0055541_1000272 3300003841 Bacteria 18042
41 Ga0055543_1005569 3300004625 Bacteria 3194
42 Ga0065165_1000281 3300005262 Bacteria 86863
43 Ga0065165_1001147 3300005262 Bacteria 30992
44 Ga0065165_1023503 3300005262 Bacteria 2088
45 Ga0065714_10066496 3300005288 Bacteria 6744
46 Ga0065714_10067661 3300005288 Bacteria 5301
47 Ga0065704_10025345 3300005289 Bacteria 926
48 Ga0065704_10074885 3300005289 Bacteria 5940
49 Ga0065712_10077793 3300005290 Bacteria 3439
50 Ga0070690_100003271 3300005330 Bacteria 8849
51 Ga0070670_100001979 3300005331 Bacteria 16757
52 Ga0070670_100010285 3300005331 Bacteria 7986
53 Ga0070666_10119256 3300005335 Bacteria 1828
54 Ga0070682_100480985 3300005337 Bacteria 958
55 Ga0068868_100123900 3300005338 Bacteria 2109
56 Ga0070660_100000231 3300005339 Bacteria 37089
57 Ga0070660_100004985 3300005339 Bacteria 9177
58 Ga0070689_100050552 3300005340 Bacteria 3212
59 Ga0070687_100129618 3300005343 Bacteria 1454
60 Ga0070661_100116100 3300005344 Bacteria 2002
61 Ga0070661_100808608 3300005344 Bacteria 770
62 Ga0070669_100002053 3300005353 Bacteria 14576
63 Ga0070659_100000015 3300005366 Bacteria 176475
64 Ga0070709_10000782 3300005434 Bacteria 17817
65 Ga0070714_100029785 3300005435 Bacteria 4540
66 Ga0070713_100059757 3300005436 Bacteria 3185
67 Ga0070710_10000207 3300005437 Bacteria 27705
68 Ga0070701_10001290 3300005438 Bacteria 9205
69 Ga0070705_100008425 3300005440 Bacteria 5107
70 Ga0070708_100635414 3300005445 Bacteria 1006
71 Ga0070663_100014052 3300005455 Bacteria 5129
72 Ga0070662_100004404 3300005457 Bacteria 8902
73 Ga0070662_100220864 3300005457 Bacteria 1512
74 Ga0070681_10002559 3300005458 Bacteria 16698
75 Ga0070685_10213857 3300005466 Bacteria 1260
76 Ga0070679_100002918 3300005530 Bacteria 15548
77 Ga0068853_100004517 3300005539 Bacteria 10796
78 Ga0068853_100011119 3300005539 Bacteria 7302
79 Ga0070686_100005718 3300005544 Bacteria 6890
80 Ga0070695_100038851 3300005545 Bacteria 3006
81 Ga0070693_100094935 3300005547 Bacteria 1805
82 Ga0070665_100086639 3300005548 Bacteria 3137
83 Ga0068855_100338899 3300005563 Bacteria 1658
84 Ga0070664_100413444 3300005564 Bacteria 1234
85 Ga0068856_100219240 3300005614 Bacteria 1918
86 Ga0068856_100329245 3300005614 Bacteria 1545
87 Ga0070702_100064864 3300005615 Bacteria 2137
88 Ga0068859_100011998 3300005617 Bacteria 8703
89 Ga0068859_100066707 3300005617 Bacteria 3634
90 Ga0068859_100191158 3300005617 Bacteria 2131
91 Ga0068859_100337589 3300005617 Bacteria 1601
92 Ga0068864_100004227 3300005618 Bacteria 11819
93 Ga0068864_100077853 3300005618 Bacteria 2901
94 Ga0068864_100722411 3300005618 Bacteria 974
95 Ga0068861_100023338 3300005719 Bacteria 4461
96 Ga0068851_10000273 3300005834 Bacteria 23911
97 Ga0068851_10130711 3300005834 Bacteria 1357
98 Ga0068863_100074738 3300005841 Bacteria 3206
99 Ga0068863_100146645 3300005841 Bacteria 2257
100 Ga0068863_100212496 3300005841 Bacteria 1863
101 Ga0068858_100000285 3300005842 Bacteria 54696
102 Ga0068858_100641629 3300005842 Bacteria 1032
103 Ga0068860_100013959 3300005843 Bacteria 7875
104 Ga0068860_100290602 3300005843 Bacteria 1599
105 Ga0068862_100015829 3300005844 Bacteria 6265
106 Ga0070717_10075228 3300006028 Bacteria 2824
107 Ga0070716_100030938 3300006173 Bacteria 2909
108 Ga0070712_100078925 3300006175 Bacteria 2378
109 Ga0075366_10216863 3300006195 Bacteria 1166
110 Ga0075370_10053546 3300006353 Bacteria 2290
111 Ga0075430_100716792 3300006846 Bacteria 825
112 Ga0068865_100430416 3300006881 Bacteria 1087
113 Ga0097620_100011997 3300006931 Bacteria 8703
114 Ga0097620_100066707 3300006931 Bacteria 3634
115 Ga0097620_100191154 3300006931 Bacteria 2131
116 Ga0097620_100337598 3300006931 Bacteria 1601
117 Ga0079104_1001829 3300006946 Bacteria 13058
118 Ga0105251_10046423 3300009011 Bacteria 2090
119 Ga0105251_10083766 3300009011 Bacteria 1472
120 Ga0105244_10003158 3300009036 Bacteria 11966
121 Ga0105244_10004629 3300009036 Bacteria 9410
122 Ga0105244_10006440 3300009036 Bacteria 7599
123 Ga0105250_10000065 3300009092 Bacteria 100401
124 Ga0105250_10019596 3300009092 Bacteria 2735
125 Ga0105250_10048309 3300009092 Bacteria 1707
126 Ga0105250_10066784 3300009092 Bacteria 1451
127 Ga0105240_10005720 3300009093 Bacteria 18444
128 Ga0105240_10203804 3300009093 Bacteria 2317
129 Ga0111539_10003810 3300009094 Bacteria 19845
130 Ga0105245_10026508 3300009098 Bacteria 5102
131 Ga0105247_10000072 3300009101 Bacteria 113959
132 Ga0105243_10054928 3300009148 Bacteria 3163
133 Ga0105241_10189101 3300009174 Bacteria 1713
134 Ga0105242_10027447 3300009176 Bacteria 4520
135 Ga0105248_10006780 3300009177 Bacteria 12559
136 Ga0105248_10213409 3300009177 Bacteria 2174
137 Ga0105248_10217977 3300009177 Bacteria 2149
138 Ga0105248_10453804 3300009177 Bacteria 1444
139 Ga0105248_10753077 3300009177 Bacteria 1099
140 Ga0105237_10006481 3300009545 Bacteria 12973
141 Ga0105238_10009396 3300009551 Bacteria 9788
142 Ga0105238_10136319 3300009551 Bacteria 2432
143 Ga0105249_10010344 3300009553 Bacteria 8200
144 Ga0105239_10036491 3300010375 Bacteria 5397
145 Ga0105246_10008968 3300011119 Bacteria 6158
146 Ga0105246_10020533 3300011119 Bacteria 4238
147 Ga0157347_1000303 3300012502 Bacteria 2979
148 Ga0157373_10007991 3300013100 Bacteria 7866
149 Ga0157373_10011875 3300013100 Bacteria 6399
150 Ga0157373_10015556 3300013100 Bacteria 5561
151 Ga0157373_10033171 3300013100 Bacteria 3716
152 Ga0157373_10178490 3300013100 Bacteria 1495
153 Ga0157371_10361141 3300013102 Bacteria 1058
154 Ga0157370_10220155 3300013104 Bacteria 1758
155 Ga0157369_10007939 3300013105 Bacteria 12204
156 Ga0157369_10010059 3300013105 Bacteria 10800
157 Ga0157369_10025471 3300013105 Bacteria 6568
158 Ga0157369_10296179 3300013105 Bacteria 1683
159 Ga0157374_10333844 3300013296 Bacteria 1504
160 Ga0163162_10009132 3300013306 Bacteria 9642
161 Ga0163162_10032279 3300013306 Bacteria 5200
162 Ga0163162_10067823 3300013306 Bacteria 3618
163 Ga0157372_10043193 3300013307 Bacteria 4990
164 Ga0157375_10000888 3300013308 Bacteria 25930
165 Ga0157375_10050889 3300013308 Bacteria 4065
166 Ga0157375_10319742 3300013308 Bacteria 1716
167 Ga0163163_10028581 3300014325 Bacteria 5357
168 Ga0182008_10001274 3300014497 Bacteria 17277
169 Ga0182008_10001882 3300014497 Bacteria 13645
170 Ga0182008_10050488 3300014497 Bacteria 2065
171 Ga0182006_1008795 3300015261 Bacteria 4565
172 Ga0182006_1013376 3300015261 Bacteria 3563
173 Ga0182007_10001259 3300015262 Bacteria 13769
174 Ga0163161_10009764 3300017792 Bacteria 6651
175 Ga0163161_10011374 3300017792 Bacteria 6171
176 Ga0163161_10042828 3300017792 Bacteria 3258
177 Ga0163161_10056011 3300017792 Bacteria 2863
178 Ga0213872_10000323 3300021361 Bacteria 40600
179 Ga0213872_10003505 3300021361 Bacteria 8674
180 Ga0213872_10028707 3300021361 Bacteria 2551
181 Ga0209435_100289 3300025206 Bacteria 12211
182 Ga0209435_102782 3300025206 Bacteria 2025
183 Ga0209436_105020 3300025208 Bacteria 3142
184 Ga0209784_100116 3300025224 Bacteria 87164
185 Ga0209566_100141 3300025225 Bacteria 87164
186 Ga0209674_100110 3300025226 Bacteria 149245
187 Ga0209674_100162 3300025226 Bacteria 87164
188 Ga0209147_100170 3300025229 Bacteria 87164
189 Ga0209563_100138 3300025230 Bacteria 87164
190 Ga0209437_100456 3300025233 Bacteria 32812
191 Ga0209437_109956 3300025233 Bacteria 1467
192 Ga0209258_100287 3300025242 Bacteria 82980
193 Ga0207425_1000318 3300025245 Bacteria 34531
194 Ga0207425_1006488 3300025245 Bacteria 3196
195 Ga0209646_1000052 3300025246 Bacteria 286370
196 Ga0209646_1000239 3300025246 Bacteria 57211
197 Ga0209026_1003815 3300025250 Bacteria 4758
198 Ga0209677_100111 3300025253 Bacteria 87164
199 Ga0209759_1000128 3300025256 Bacteria 132419
200 Ga0209759_1000253 3300025256 Bacteria 79223
201 Ga0209129_1004938 3300025258 Bacteria 4957
202 Ga0209233_1002480 3300025261 Bacteria 6758
203 Ga0209565_1000009 3300025263 Bacteria 751701
204 Ga0209565_1000461 3300025263 Bacteria 31259
205 Ga0209565_1000570 3300025263 Bacteria 25143
206 Ga0209455_1000037 3300025272 Bacteria 464097
207 Ga0209673_1000036 3300025273 Bacteria 323162
208 Ga0209673_1000260 3300025273 Bacteria 99762
209 Ga0209673_1006964 3300025273 Bacteria 5334
210 Ga0209130_1002311 3300025284 Bacteria 9744
211 Ga0209675_1000013 3300025291 Bacteria 448220
212 Ga0209675_1001088 3300025291 Bacteria 16712
213 Ga0209676_1000004 3300025292 Bacteria 1138360
214 Ga0209676_1047066 3300025292 Bacteria 1162
215 Ga0209025_1000096 3300025294 Bacteria 239153
216 Ga0209025_1003816 3300025294 Bacteria 13763
217 Ga0209025_1004142 3300025294 Bacteria 12875
218 Ga0209564_1000003 3300025295 Bacteria 1585848
219 Ga0209564_1000009 3300025295 Bacteria 950196
220 Ga0209564_1000122 3300025295 Bacteria 203709
221 Ga0209564_1000267 3300025295 Bacteria 109962
222 Ga0209758_1000675 3300025297 Bacteria 50917
223 Ga0209758_1005265 3300025297 Bacteria 10117
224 Ga0209050_1000002 3300025298 Bacteria 1792849
225 Ga0209256_1000106 3300025299 Bacteria 187258
226 Ga0209256_1000222 3300025299 Bacteria 105596
227 Ga0209256_1000398 3300025299 Bacteria 68796
228 Ga0209256_1020242 3300025299 Bacteria 2084
229 Ga0207426_1002483 3300025302 Bacteria 11731
230 Ga0209051_1000002 3300025303 Bacteria 1631846
231 Ga0209051_1008225 3300025303 Bacteria 5556
232 Ga0209257_1000002 3300025304 Bacteria 1767052
233 Ga0207656_10000028 3300025321 Bacteria 76155
234 Ga0207696_1000081 3300025711 Bacteria 198887
235 Ga0207696_1001871 3300025711 Bacteria 10785
236 Ga0207696_1013317 3300025711 Bacteria 2872
237 Ga0207696_1022599 3300025711 Bacteria 1995
238 Ga0207696_1045450 3300025711 Bacteria 1270
239 Ga0207655_1005785 3300025728 Bacteria 8329
240 Ga0207655_1021497 3300025728 Bacteria 3273
241 Ga0207713_1002126 3300025735 Bacteria 14767
242 Ga0207713_1008105 3300025735 Bacteria 6094
243 Ga0207710_10000303 3300025900 Bacteria 39280
244 Ga0207680_10155200 3300025903 Bacteria 1530
245 Ga0207699_10000379 3300025906 Bacteria 23393
246 Ga0207705_10316721 3300025909 Bacteria 1198
247 Ga0207707_10005932 3300025912 Bacteria 10689
248 Ga0207695_10028726 3300025913 Bacteria 6157
249 Ga0207695_10032198 3300025913 Bacteria 5741
250 Ga0207671_10678940 3300025914 Bacteria 820
251 Ga0207693_10013170 3300025915 Bacteria 6671
252 Ga0207657_10000014 3300025919 Bacteria 175779
253 Ga0207657_10015620 3300025919 Bacteria 7346
254 Ga0207657_10139180 3300025919 Bacteria 1984
255 Ga0207649_10409556 3300025920 Bacteria 1016
256 Ga0207652_10005287 3300025921 Bacteria 10478
257 Ga0207681_10000892 3300025923 Bacteria 19489
258 Ga0207694_10038314 3300025924 Bacteria 3686
259 Ga0207694_10082776 3300025924 Bacteria 2523
260 Ga0207694_10171502 3300025924 Bacteria 1757
261 Ga0207650_10000086 3300025925 Bacteria 123722
262 Ga0207650_10000732 3300025925 Bacteria 25329
263 Ga0207650_10019476 3300025925 Bacteria 4768
264 Ga0207650_10081053 3300025925 Bacteria 2461
265 Ga0207687_10228928 3300025927 Bacteria 1468
266 Ga0207700_10029114 3300025928 Bacteria 3894
267 Ga0207664_10009594 3300025929 Bacteria 6800
268 Ga0207644_10013499 3300025931 Bacteria 5448
269 Ga0207690_10000023 3300025932 Bacteria 196155
270 Ga0207690_10480885 3300025932 Bacteria 1002
271 Ga0207706_10000172 3300025933 Bacteria 72049
272 Ga0207670_10006847 3300025936 Bacteria 6343
273 Ga0207711_10069809 3300025941 Bacteria 3047
274 Ga0207711_10083605 3300025941 Bacteria 2793
275 Ga0207711_10141823 3300025941 Bacteria 2163
276 Ga0207667_10010259 3300025949 Bacteria 10964
277 Ga0207667_10360637 3300025949 Bacteria 1482
278 Ga0207712_10016272 3300025961 Bacteria 4812
279 Ga0207658_10050361 3300025986 Bacteria 3064
280 Ga0207658_10050849 3300025986 Bacteria 3051
281 Ga0207658_10228913 3300025986 Bacteria 1568
282 Ga0207677_10021826 3300026023 Bacteria 3922
283 Ga0207703_10001441 3300026035 Bacteria 21708
284 Ga0207703_10259991 3300026035 Bacteria 1569
285 Ga0207639_10017658 3300026041 Bacteria 5059
286 Ga0207639_10026033 3300026041 Bacteria 4248
287 Ga0207678_10025545 3300026067 Bacteria 5155
288 Ga0207708_10274489 3300026075 Bacteria 1364
289 Ga0207702_10259688 3300026078 Bacteria 1635
290 Ga0207641_10011245 3300026088 Bacteria 7341
291 Ga0207641_10012333 3300026088 Bacteria 7012
292 Ga0207676_10098533 3300026095 Bacteria 2417
293 Ga0207676_10131418 3300026095 Bacteria 2129
294 Ga0207674_10138887 3300026116 Bacteria 2391
295 Ga0207674_10784179 3300026116 Bacteria 920
296 Ga0207675_100009401 3300026118 Bacteria 9160
297 Ga0207698_10153986 3300026142 Bacteria 2000
298 Ga0209281_1000008 3300027111 Bacteria 867470
299 Ga0207428_10034074 3300027907 Bacteria 4176
300 Ga0268266_10030215 3300028379 Bacteria 4604
301 Ga0268265_10014914 3300028380 Bacteria 5305
302 Ga0268265_10127672 3300028380 Bacteria 2108
303 Ga0268264_10158134 3300028381 Bacteria 2038
304 Ga0268264_10213008 3300028381 Bacteria 1774
305 Ga0307517_10083751 3300028786 Bacteria 2692
306 Ga0307515_10000049 3300028794 Bacteria 278611
307 Ga0307515_10179926 3300028794 Bacteria 2069
308 Ga0307511_10044168 3300030521 Bacteria 3707
309 Ga0307509_10343109 3300031507 Bacteria 1220
310 Ga0307408_100002456 3300031548 Bacteria 13003
311 Ga0265314_10122879 3300031711 Bacteria 1631
312 Ga0307405_10004623 3300031731 Bacteria 6532
313 Ga0307416_100236177 3300032002 Bacteria 1767
314 Ga0307416_100293228 3300032002 Bacteria 1612
315 Ga0307415_100148894 3300032126 Bacteria 1799
316 Ga0307510_10000013 3300033180 Bacteria 274569
317 Ga0373960_0000337 3300035121 Bacteria 8991
318 Ga0373931_0015579 3300035691 Bacteria 3731
319 Ga0373937_0201026 3300036401 Bacteria 1873
320 Ga0395905_0002838 3300037471 Bacteria 18978
321 Ga0400483_108130 3300039062 Bacteria 3601
322 Ga0400483_277780 3300039062 Bacteria 6006
323 Ga0400483_286606 3300039062 Bacteria 2924
324 Ga0436361_0104721 3300039447 Bacteria 28445
325 Ga0436361_0470493 3300039447 Bacteria 2893
326 Ga0436361_0488174 3300039447 Bacteria 24593
327 Ga0436361_0602168 3300039447 Bacteria 35623
328 Ga0436361_1047176 3300039447 Bacteria 7133
329 Ga0436361_1223139 3300039447 Bacteria 18884
330 Ga0436363_0918195 3300039450 Bacteria 1470
331 Ga0439466_0024026 3300041411 Bacteria 2140
332 Ga0439431_0038124 3300041997 Bacteria 1215
333 Ga0439432_000008 3300042006 Bacteria 89915
334 Ga0450911_000366 3300042115 Bacteria 15046
335 Ga0450890_007679 3300042127 Bacteria 1379
336 Ga0450904_000031 3300042139 Bacteria 31326
337 Ga0450905_018750 3300042142 Bacteria 1010
338 Ga0439446_0050007 3300042156 Bacteria 1247
339 Ga0439459_0000672 3300042438 Bacteria 4661
340 Ga0466972_0018830 3300044658 Bacteria 3451
341 Ga0495627_007626 3300046453 Bacteria 4131
342 Ga0495603_0130388 3300046455 Bacteria 1464
343 Ga0495590_0000008 3300046457 Bacteria 330520
344 Ga0495591_002224 3300046458 Bacteria 11066
345 Ga0495629_0009959 3300046459 Bacteria 6938
346 Ga0495629_0090526 3300046459 Bacteria 2134
347 Ga0495638_0002309 3300046460 Bacteria 15708
348 Ga0495653_0013580 3300046463 Bacteria 6637
349 Ga0495653_0042708 3300046463 Bacteria 3528
350 Ga0495650_0000161 3300046471 Bacteria 149996
351 Ga0495650_0000239 3300046471 Bacteria 109891
352 Ga0495650_0017036 3300046471 Bacteria 3655
353 Ga0495580_0296961 3300046472 Bacteria 1100
354 Ga0495580_0428628 3300046472 Bacteria 889
355 Ga0495582_0010242 3300046473 Bacteria 5162
356 Ga0495582_0033315 3300046473 Bacteria 2832
357 Ga0495605_0000921 3300046474 Bacteria 20179
358 Ga0495605_0017045 3300046474 Bacteria 3922
359 Ga0495639_0070025 3300046475 Bacteria 1619
360 Ga0495584_0022440 3300046491 Bacteria 3203
361 Ga0495584_0227752 3300046491 Bacteria 947
362 Ga0495584_0272300 3300046491 Bacteria 861
363 Ga0495585_0010191 3300046492 Bacteria 5611
364 Ga0495585_0063604 3300046492 Bacteria 2024
365 Ga0495594_0080073 3300046499 Bacteria 1823
366 Ga0495594_0109332 3300046499 Bacteria 1558
367 Ga0495594_0122781 3300046499 Bacteria 1468
368 Ga0495596_0003871 3300046500 Bacteria 7428
369 Ga0495596_0006209 3300046500 Bacteria 5530
370 Ga0495607_0000561 3300046501 Bacteria 36225
371 Ga0495607_0003529 3300046501 Bacteria 11920
372 Ga0495607_0030932 3300046501 Bacteria 3280
373 Ga0495607_0059146 3300046501 Bacteria 2187
374 Ga0495583_0000160 3300046506 Bacteria 113560
375 Ga0495583_0000544 3300046506 Bacteria 53022
376 Ga0495583_0002756 3300046506 Bacteria 14514
377 Ga0495606_0016874 3300046507 Bacteria 5545
378 Ga0495606_0022629 3300046507 Bacteria 4572
379 Ga0495606_0034545 3300046507 Bacteria 3470
380 Ga0495610_0003073 3300046512 Bacteria 13334
381 Ga0495610_0004990 3300046512 Bacteria 9609
382 Ga0495610_0016181 3300046512 Bacteria 4306
383 Ga0495610_0032603 3300046512 Bacteria 2704
384 Ga0495610_0088208 3300046512 Bacteria 1410
385 Ga0495616_0002763 3300046513 Bacteria 11483
386 Ga0495616_0019465 3300046513 Bacteria 3704
387 Ga0495620_0000442 3300046515 Bacteria 27759
388 Ga0495620_0007504 3300046515 Bacteria 5914
389 Ga0495628_0125633 3300046516 Bacteria 1965
390 Ga0495631_0002610 3300046518 Bacteria 10070
391 Ga0495631_0002645 3300046518 Bacteria 9996
392 Ga0495631_0051043 3300046518 Bacteria 1807
393 Ga0495631_0129907 3300046518 Bacteria 1082
394 Ga0495632_0000621 3300046519 Bacteria 32779
395 Ga0495632_0001302 3300046519 Bacteria 21119
396 Ga0495632_0007221 3300046519 Bacteria 7012
397 Ga0495643_0000142 3300046522 Bacteria 115533
398 Ga0495643_0001231 3300046522 Bacteria 24701
399 Ga0495643_0041936 3300046522 Bacteria 2494
400 Ga0495644_0003117 3300046523 Bacteria 6562
401 Ga0495644_0050847 3300046523 Bacteria 1556
402 Ga0495644_0053999 3300046523 Bacteria 1509
403 Ga0495648_0000188 3300046524 Bacteria 71222
404 Ga0495648_0108770 3300046524 Bacteria 1513
405 Ga0495648_0121198 3300046524 Bacteria 1405
406 Ga0495663_0011932 3300046525 Bacteria 2421
407 Ga0495666_0003824 3300046526 Bacteria 7617
408 Ga0495666_0012332 3300046526 Bacteria 4261
409 Ga0495642_0002438 3300046528 Bacteria 7573
410 Ga0495642_0003247 3300046528 Bacteria 6437
411 Ga0495642_0008182 3300046528 Bacteria 3999
412 Ga0495642_0013991 3300046528 Bacteria 3108
413 Ga0495642_0016015 3300046528 Bacteria 2919
414 Ga0495652_0011549 3300046529 Bacteria 7984
415 Ga0495654_0000813 3300046530 Bacteria 23840
416 Ga0495654_0009048 3300046530 Bacteria 5467
417 Ga0495654_0105266 3300046530 Bacteria 1293
418 Ga0495665_0001605 3300046531 Bacteria 12096
419 Ga0495665_0006890 3300046531 Bacteria 6134
420 Ga0495665_0064220 3300046531 Bacteria 1937
421 Ga0495586_0005366 3300046535 Bacteria 6854
422 Ga0495586_0014722 3300046535 Bacteria 4156
423 Ga0495587_0122881 3300046536 Bacteria 1486
424 Ga0495609_0000269 3300046538 Bacteria 48750
425 Ga0495609_0008841 3300046538 Bacteria 4902
426 Ga0495597_0000908 3300046542 Bacteria 22977
427 Ga0495597_0001319 3300046542 Bacteria 18169
428 Ga0495597_0006885 3300046542 Bacteria 5834
429 Ga0495597_0015954 3300046542 Bacteria 3551
430 Ga0495645_0305518 3300046543 Bacteria 1038
431 Ga0495622_0002221 3300046557 Bacteria 9459
432 Ga0495622_0005278 3300046557 Bacteria 5993
433 Ga0495622_0164441 3300046557 Bacteria 1000
434 Ga0495633_0020687 3300046558 Bacteria 3304
435 Ga0495633_0047928 3300046558 Bacteria 2018
436 Ga0495633_0107383 3300046558 Bacteria 1294
437 Ga0495667_0202782 3300046559 Bacteria 1269
438 Ga0495656_0003837 3300046615 Bacteria 5110
439 Ga0495656_0009410 3300046615 Bacteria 3512
440 Ga0495656_0170685 3300046615 Bacteria 1063
441 Ga0495668_0005378 3300046616 Bacteria 8709
442 Ga0495668_0022791 3300046616 Bacteria 3577
443 Ga0495668_0031556 3300046616 Bacteria 2985
444 Ga0495634_0011374 3300046642 Bacteria 6483
445 Ga0495611_0009405 3300046648 Bacteria 4130
446 Ga0495611_0020658 3300046648 Bacteria 2836
447 Ga0495611_0051781 3300046648 Bacteria 1851
448 Ga0495611_0235299 3300046648 Bacteria 850
449 Ga0495625_0001214 3300046660 Bacteria 32679
450 Ga0495625_0003510 3300046660 Bacteria 15538
451 Ga0495625_0039690 3300046660 Bacteria 3436
452 Ga0495625_0266604 3300046660 Bacteria 1107
453 Ga0495635_0143014 3300046663 Bacteria 1629
454 Ga0495661_0000817 3300046665 Bacteria 29232
455 Ga0495661_0006103 3300046665 Bacteria 8490
456 Ga0495661_0012970 3300046665 Bacteria 5613
457 Ga0495661_0132127 3300046665 Bacteria 1367
458 Ga0495661_0214803 3300046665 Bacteria 999
459 Ga0495588_0106086 3300046674 Bacteria 1478
460 Ga0495588_0179565 3300046674 Bacteria 1118
461 Ga0495588_0247380 3300046674 Bacteria 940
462 Ga0495623_0031373 3300046679 Bacteria 3416
463 Ga0495623_0110862 3300046679 Bacteria 1663
464 Ga0495623_0122597 3300046679 Bacteria 1563
465 Ga0495669_0008797 3300046684 Bacteria 4253
466 Ga0495669_0070195 3300046684 Bacteria 1595
467 Ga0495613_0053494 3300046689 Bacteria 2971
468 Ga0495670_0011246 3300046691 Bacteria 4400
469 Ga0495670_0031347 3300046691 Bacteria 2641
470 Ga0495670_0158476 3300046691 Bacteria 1188
471 Ga0495671_0012871 3300046692 Bacteria 4554
472 Ga0495649_0000028 3300046694 Bacteria 163229
473 Ga0495649_0003341 3300046694 Bacteria 10885
474 Ga0495649_0005820 3300046694 Bacteria 7761
475 Ga0495589_0000657 3300046794 Bacteria 22640
476 Ga0495589_0003182 3300046794 Bacteria 8968
477 Ga0495589_0008613 3300046794 Bacteria 5319
478 Ga0495589_0055905 3300046794 Bacteria 1943
479 Ga0495589_0122299 3300046794 Bacteria 1253
480 Ga0495660_0005279 3300046810 Bacteria 7745
481 Ga0495660_0005568 3300046810 Bacteria 7537
482 Ga0495581_0004376 3300047315 Bacteria 8161
483 Ga0495581_0026792 3300047315 Bacteria 3341
484 Ga0495604_0017445 3300047317 Bacteria 5746
485 Ga0495604_0065370 3300047317 Bacteria 2769
486 Ga0495674_0006932 3300047319 Bacteria 10836
487 Ga0495672_0000189 3300047320 Bacteria 89175
488 Ga0495672_0001634 3300047320 Bacteria 21817
489 Ga0495672_0082896 3300047320 Bacteria 1782
490 Ga0495672_0104572 3300047320 Bacteria 1529
491 Ga0495676_0000017 3300047321 Bacteria 181815
492 Ga0495676_0071133 3300047321 Bacteria 2675
493 Ga0495676_0198705 3300047321 Bacteria 1394
494 Ga0495683_0004154 3300047323 Bacteria 8285
495 Ga0495683_0179020 3300047323 Bacteria 969
496 Ga0495675_0012620 3300047444 Bacteria 5317
497 Ga0495677_0006940 3300047445 Bacteria 4253
498 Ga0495677_0010213 3300047445 Bacteria 3451
499 Ga0495679_000699 3300047446 Bacteria 21818
500 Ga0495679_009218 3300047446 Bacteria 3964
501 Ga0495681_0003295 3300047470 Bacteria 11254
502 Ga0495681_0004009 3300047470 Bacteria 10130
503 Ga0495681_0022031 3300047470 Bacteria 3418
504 Ga0495686_0000076 3300047472 Bacteria 206039
505 Ga0495593_0070071 3300047673 Bacteria 1822
506 Ga0495602_0108551 3300048088 Bacteria 2259
507 Ga0495614_0012640 3300048089 Bacteria 3702
508 Ga0495614_0036870 3300048089 Bacteria 2098
509 Ga0495626_0004982 3300048091 Bacteria 7951
510 Ga0495626_0026298 3300048091 Bacteria 2838
511 Ga0496102_0009591 3300048905 Bacteria 8325
512 Ga0496102_0044162 3300048905 Bacteria 4044
513 Ga0496102_0425028 3300048905 Bacteria 1248
514 Ga0496102_0812186 3300048905 Bacteria 857
515 Ga0496103_0002329 3300048906 Bacteria 12004
516 Ga0496104_0224418 3300048907 Bacteria 1791
517 Ga0496107_0110786 3300048910 Bacteria 2017
518 Ga0496112_0170695 3300048915 Bacteria 2140
519 Ga0496115_0225156 3300048918 Bacteria 1547
520 Ga0496115_0386130 3300048918 Bacteria 1138
521 Ga0496116_0011501 3300048919 Bacteria 7316
522 Ga0496116_0077358 3300048919 Bacteria 2079
523 Ga0496117_0001169 3300048920 Bacteria 39465
524 Ga0496117_0001494 3300048920 Bacteria 33517
525 Ga0496117_0003096 3300048920 Bacteria 19916
526 Ga0496117_0008511 3300048920 Bacteria 9730
527 Ga0496117_0017465 3300048920 Bacteria 5990
528 Ga0496118_0004011 3300048921 Bacteria 17911
529 Ga0496118_0064556 3300048921 Bacteria 2685
530 Ga0496118_0162404 3300048921 Bacteria 1379
531 Ga0496119_0002476 3300048922 Bacteria 20252
532 Ga0496120_0000115 3300048923 Bacteria 136364
533 Ga0496120_0001738 3300048923 Bacteria 24768
534 Ga0496120_0034298 3300048923 Bacteria 3041
535 Ga0496121_0000808 3300048924 Bacteria 57011
536 Ga0496121_0004158 3300048924 Bacteria 19793
537 Ga0496121_0011779 3300048924 Bacteria 9645
538 Ga0496121_0018162 3300048924 Bacteria 7110
539 Ga0496121_0051608 3300048924 Bacteria 3462
540 Ga0496121_0115813 3300048924 Bacteria 2034
541 Ga0496121_0119273 3300048924 Bacteria 1995
542 Ga0496121_0307926 3300048924 Bacteria 1072
543 Ga0496122_0029677 3300048925 Bacteria 4604
544 Ga0496122_0060371 3300048925 Bacteria 2793
545 Ga0496122_0131758 3300048925 Bacteria 1586
546 Ga0496123_0027588 3300048926 Bacteria 4225
547 Ga0496123_0056828 3300048926 Bacteria 2553
548 Ga0496124_0016672 3300048927 Bacteria 6970
549 Ga0496124_0020425 3300048927 Bacteria 6119
550 Ga0496124_0025805 3300048927 Bacteria 5312
551 Ga0496124_0050080 3300048927 Bacteria 3560
552 Ga0496125_0000126 3300048928 Bacteria 166246
553 Ga0496125_0000236 3300048928 Bacteria 113354
554 Ga0496125_0000256 3300048928 Bacteria 109696
555 Ga0496125_0000775 3300048928 Bacteria 52219
556 Ga0496125_0004735 3300048928 Bacteria 15510
557 Ga0496125_0005065 3300048928 Bacteria 14855
558 Ga0496125_0007863 3300048928 Bacteria 11268
559 Ga0496125_0012759 3300048928 Bacteria 8308
560 Ga0496125_0020759 3300048928 Bacteria 6156
561 Ga0496125_0025048 3300048928 Bacteria 5474
562 Ga0496125_0027433 3300048928 Bacteria 5160
563 Ga0496125_0061939 3300048928 Bacteria 2996
564 Ga0496125_0163576 3300048928 Bacteria 1507
565 Ga0496126_0012108 3300048929 Bacteria 8855
566 Ga0496126_0043734 3300048929 Bacteria 4129
567 Ga0496126_0045038 3300048929 Bacteria 4058
568 Ga0495678_000025 3300049459 Bacteria 227891
569 Ga0495678_000402 3300049459 Bacteria 43680
570 Ga0495678_005276 3300049459 Bacteria 7179
571 Ga0501031_0074616 3300049568 Bacteria 2209
572 Ga0501033_0388674 3300049570 Bacteria 974
573 Ga0501038_0060044 3300049574 Bacteria 3255
574 Ga0501047_0072612 3300049581 Bacteria 3312
575 Ga0501048_0163807 3300049582 Bacteria 1574
576 Ga0501070_0000047 3300049586 Bacteria 107704
577 Ga0501223_000001 3300049663 Bacteria 156895
578 Ga0501224_000003 3300049664 Bacteria 189031
579 Ga0501233_000030 3300049668 Bacteria 18329
580 Ga0501235_000182 3300049669 Bacteria 10992
581 Ga0501225_0000001 3300049705 Bacteria 185804
582 Ga0501234_000234 3300049707 Bacteria 8036
583 Ga0501080_0000366 3300049742 Bacteria 34958
584 Ga0501035_0018191 3300049822 Bacteria 6471
585 Ga0501044_0000086 3300049823 Bacteria 114287
586 Ga0501044_0001727 3300049823 Bacteria 25577
587 Ga0501226_000007 3300049853 Bacteria 227827
588 Ga0501226_000013 3300049853 Bacteria 175177
589 nmdc:mga0k408_290689_c1 3300050493 Bacteria 975
590 nmdc:mga08y16_39763_c1 3300050511 Bacteria 4933
591 Ga0500594_0003057 3300053118 Bacteria 3663
592 Ga0500617_177930 3300053124 Bacteria 808
593 Ga0500642_0208756 3300053130 Bacteria 907
594 Ga0500622_0000970 3300053156 Bacteria 24316
595 Ga0500634_0003030 3300053161 Bacteria 7341
596 Ga0500634_0106549 3300053161 Bacteria 1392

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0020425 Ga0496124_0020425_3479_4153 184
2 3300048928 Ga0496125_0061939 Ga0496125_0061939_613_1287 184
3 3300048929 Ga0496126_0045038 Ga0496126_0045038_1107_1781 184
4 3300042115 Ga0450911_000366 Ga0450911_000366_10226_10951 201
5 3300048924 Ga0496121_0018162 Ga0496121_0018162_2708_3433 201
6 3300048928 Ga0496125_0007863 Ga0496125_0007863_5614_6339 201
7 3300048928 Ga0496125_0012759 Ga0496125_0012759_6375_7106 202
8 3300005337 Ga0070682_100480985 Ga0070682_1004809851 223
9 3300005344 Ga0070661_100116100 Ga0070661_1001161003 223
10 3300005458 Ga0070681_10002559 Ga0070681_100025596 223
11 3300005530 Ga0070679_100002918 Ga0070679_1000029188 223
12 3300005539 Ga0068853_100004517 Ga0068853_1000045176 223
13 3300009174 Ga0105241_10189101 Ga0105241_101891013 223
14 3300013100 Ga0157373_10033171 Ga0157373_100331714 223
15 3300013307 Ga0157372_10043193 Ga0157372_100431933 223
16 3300025912 Ga0207707_10005932 Ga0207707_100059323 223
17 3300025921 Ga0207652_10005287 Ga0207652_100052876 223
18 3300026041 Ga0207639_10017658 Ga0207639_100176582 223
19 3300026116 Ga0207674_10138887 Ga0207674_101388873 223
20 3300039062 Ga0400483_108130 Ga0400483_108130_1872_2561 225
21 3300039062 Ga0400483_286606 Ga0400483_286606_839_1528 225
22 3300025728 Ga0207655_1005785 Ga0207655_10057853 226
23 3300048905 Ga0496102_0812186 Ga0496102_0812186_11_700 226
24 iso_pu_bacteria 2842711865 2842712150 226
25 iso_pu_bacteria 2515154123 2515690766 227
26 iso_pu_bacteria 2526164713 2527077033 227
27 iso_pu_bacteria 2547132103 2547372683 227
28 iso_pu_bacteria 2597489888 2597863278 227
29 iso_pu_bacteria 2597489889 2597869066 227
30 iso_pu_bacteria 2599185179 2599453769 227
31 iso_pu_bacteria 2599185189 2599510575 227
32 iso_pu_bacteria 2599185190 2599515873 227
33 iso_pu_bacteria 2599185288 2599883823 227
34 iso_pu_bacteria 2599185290 2599895251 227
35 iso_pu_bacteria 2599185303 2599951332 227
36 iso_pu_bacteria 2600255296 2601689088 227
37 iso_pu_bacteria 2619619299 2621300581 227
38 iso_pu_bacteria 2643221571 2643870324 227
39 iso_pu_bacteria 2643221592 2643968697 227
40 iso_pu_bacteria 2643221625 2644139488 227
41 iso_pu_bacteria 2643221638 2644216659 227
42 iso_pu_bacteria 2643221648 2644272302 227
43 iso_pu_bacteria 2643221713 2644622975 227
44 iso_pu_bacteria 2675903420 2677895941 227
45 iso_pu_bacteria 2721755607 2723248105 227
46 iso_pu_bacteria 2738541265 2738673245 227
47 iso_pu_bacteria 2738541282 2738751638 227
48 iso_pu_bacteria 2738541294 2738811814 227
49 iso_pu_bacteria 2738541303 2738860679 227
50 iso_pu_bacteria 2738541307 2738884603 227
51 iso_pu_bacteria 2738541309 2738899174 227
52 iso_pu_bacteria 2808606373 2808907294 227
53 iso_pu_bacteria 2808606385 2808978161 227
54 iso_pu_bacteria 2808606386 2808981947 227
55 iso_pu_bacteria 2808606388 2808993641 227
56 iso_pu_bacteria 2808606415 2809131570 227
57 iso_pu_bacteria 2808606419 2809151192 227
58 iso_pu_bacteria 2816332298 2817490161 227
59 iso_pu_bacteria 2818991446 2819600065 227
60 iso_pu_bacteria 2831265667 2831267630 227
61 iso_pu_bacteria 2831864461 2831866630 227
62 iso_pu_bacteria 2834028612 2834033940 227
63 iso_pu_bacteria 2838054893 2838056129 227
64 iso_pu_bacteria 2842826826 2842827813 227
65 iso_pu_bacteria 2842837860 2842839512 227
66 iso_pu_bacteria 2843690924 2843693678 227
67 iso_pu_bacteria 2852612431 2852618866 227
68 iso_pu_bacteria 2852618963 2852622526 227
69 iso_pu_bacteria 2852667396 2852673910 227
70 iso_pu_bacteria 2857547612 2857552689 227
71 iso_pu_bacteria 2857576091 2857577062 227
72 iso_pu_bacteria 2858688981 2858693709 227
73 iso_pu_bacteria 2860867994 2860869903 227
74 iso_pu_bacteria 2870068957 2870071471 227
75 iso_pu_bacteria 2904541872 2904546355 227
76 iso_pu_bacteria 2908446538 2908448898 227
77 iso_pu_bacteria 2917832318 2917836343 227
78 iso_pu_bacteria 2928037797 2928041616 227
79 iso_pu_bacteria 2928044640 2928049180 227
80 iso_pu_bacteria 2928051484 2928052212 227
81 iso_pu_bacteria 2928157003 2928160407 227
82 iso_pu_bacteria 2929189879 2929191880 227
83 iso_pu_bacteria 2931390751 2931393012 227
84 iso_pu_bacteria 2932422444 2932422613 227
85 iso_pu_bacteria 2945928738 2945934181 227
86 iso_pu_bacteria 2946006987 2946010825 227
87 iso_pu_bacteria 2946027586 2946030166 227
88 iso_pu_bacteria 2947233263 2947236755 227
89 iso_pu_bacteria 2981990288 2981996286 227
90 iso_pu_bacteria 3007872151 3007873054 227
91 iso_pu_bacteria 641736154 642420666 227
92 iso_pu_bacteria 8054285046 8054289069 227
93 iso_pu_bacteria 8054347763 8054351733 227
94 iso_pu_bacteria 8055817908 8055820130 227
95 iso_pu_bacteria 8056120720 8056122726 227
96 iso_pu_bacteria 8056137416 8056141059 227
97 iso_pu_bacteria 8056148874 8056153889 227
98 iso_pu_bacteria 8056161164 8056165300 227
99 3300005339 Ga0070660_100004985 Ga0070660_1000049857 229
100 3300025909 Ga0207705_10316721 Ga0207705_103167212 229
101 3300025919 Ga0207657_10015620 Ga0207657_100156207 229
102 3300039062 Ga0400483_277780 Ga0400483_277780_4313_5023 229
103 3300002705 JGI25156J39149_1002008 JGI25156J39149_10020085 230
104 3300002737 JGI25162J39368_1005774 JGI25162J39368_10057742 230
105 3300002738 JGI25154J39366_1000208 JGI25154J39366_100020810 230
106 3300005614 Ga0068856_100329245 Ga0068856_1003292452 230
107 3300009036 Ga0105244_10004629 Ga0105244_100046296 230
108 3300009093 Ga0105240_10005720 Ga0105240_1000572014 230
109 3300013308 Ga0157375_10000888 Ga0157375_1000088824 230
110 3300015261 Ga0182006_1008795 Ga0182006_10087952 230
111 3300025206 Ga0209435_100289 Ga0209435_10028910 230
112 3300025233 Ga0209437_100456 Ga0209437_1004566 230
113 3300025246 Ga0209646_1000052 Ga0209646_100005231 230
114 3300025256 Ga0209759_1000253 Ga0209759_100025360 230
115 3300025913 Ga0207695_10028726 Ga0207695_100287263 230
116 3300025949 Ga0207667_10010259 Ga0207667_100102596 230
117 3300025949 Ga0207667_10360637 Ga0207667_103606372 230
118 3300026078 Ga0207702_10259688 Ga0207702_102596882 230
119 3300046524 Ga0495648_0108770 Ga0495648_0108770_740_1435 230
120 3300046660 Ga0495625_0003510 Ga0495625_0003510_9499_10194 230
121 3300046692 Ga0495671_0012871 Ga0495671_0012871_2146_2841 230
122 3300046694 Ga0495649_0005820 Ga0495649_0005820_4848_5543 230
123 3300048924 Ga0496121_0011779 Ga0496121_0011779_5477_6178 230
124 3300048928 Ga0496125_0000256 Ga0496125_0000256_91432_92142 230
125 3300053118 Ga0500594_0003057 Ga0500594_0003057_364_1059 230
126 iso_pu_bacteria 2884811622 2884814513 230
127 iso_pu_bacteria 2884836552 2884839164 230
128 iso_pu_bacteria 2884852848 2884855455 230
129 iso_pu_bacteria 2896154374 2896159038 230
130 iso_pu_bacteria 2929160207 2929164165 230
131 2162886007 SwRhRL2b_contig_2416600 SwRhRL2b_0613.00005370 231
132 3300001915 JGI24741J21665_1008640 JGI24741J21665_10086402 231
133 3300001976 JGI24752J21851_1000730 JGI24752J21851_10007304 231
134 3300001990 JGI24737J22298_10050897 JGI24737J22298_100508973 231
135 3300002076 JGI24749J21850_1002277 JGI24749J21850_10022773 231
136 3300002704 JGI25155J39150_1002715 JGI25155J39150_10027151 231
137 3300002738 JGI25154J39366_1008483 JGI25154J39366_10084832 231
138 3300002773 JGI25152J39213_1004941 JGI25152J39213_10049412 231
139 3300003187 JGI25151J46595_10006396 JGI25151J46595_100063965 231
140 3300003187 JGI25151J46595_10021764 JGI25151J46595_100217643 231
141 3300003215 JGI25153J46596_10006450 JGI25153J46596_100064505 231
142 3300003215 JGI25153J46596_10018272 JGI25153J46596_100182722 231
143 3300003322 rootL2_10049679 rootL2_100496792 231
144 3300003354 JGI25160J50197_1010960 JGI25160J50197_10109602 231
145 3300003751 Ga0055538_1000386 Ga0055538_100038614 231
146 3300003752 Ga0055539_1000383 Ga0055539_100038314 231
147 3300003756 Ga0055533_1000378 Ga0055533_100037813 231
148 3300003756 Ga0055533_1000535 Ga0055533_10005355 231
149 3300003758 Ga0055532_1000473 Ga0055532_100047314 231
150 3300003759 Ga0055525_1000539 Ga0055525_100053914 231
151 3300003763 Ga0055529_1000080 Ga0055529_1000080139 231
152 3300003771 Ga0055526_1000198 Ga0055526_100019848 231
153 3300003771 Ga0055526_1000827 Ga0055526_100082713 231
154 3300003771 Ga0055526_1009948 Ga0055526_10099484 231
155 3300003771 Ga0055526_1013069 Ga0055526_10130694 231
156 3300003773 Ga0055537_1000035 Ga0055537_100003590 231
157 3300003773 Ga0055537_1000111 Ga0055537_10001116 231
158 3300003775 Ga0055524_1001079 Ga0055524_100107910 231
159 3300003775 Ga0055524_1010543 Ga0055524_10105435 231
160 3300003784 Ga0055534_1000268 Ga0055534_100026813 231
161 3300003790 Ga0055528_1000178 Ga0055528_100017846 231
162 3300003790 Ga0055528_1009461 Ga0055528_10094611 231
163 3300003791 Ga0055530_10000246 Ga0055530_1000024625 231
164 3300003792 Ga0055540_1006912 Ga0055540_10069121 231
165 3300003792 Ga0055540_1010127 Ga0055540_10101272 231
166 3300003794 Ga0055531_10007008 Ga0055531_100070084 231
167 3300003841 Ga0055541_1000272 Ga0055541_100027214 231
168 3300004625 Ga0055543_1005569 Ga0055543_10055694 231
169 3300005262 Ga0065165_1000281 Ga0065165_100028187 231
170 3300005262 Ga0065165_1001147 Ga0065165_100114720 231
171 3300005262 Ga0065165_1023503 Ga0065165_10235032 231
172 3300005288 Ga0065714_10066496 Ga0065714_100664963 231
173 3300005288 Ga0065714_10067661 Ga0065714_100676613 231
174 3300005289 Ga0065704_10025345 Ga0065704_100253451 231
175 3300005289 Ga0065704_10074885 Ga0065704_100748853 231
176 3300005290 Ga0065712_10077793 Ga0065712_100777933 231
177 3300005330 Ga0070690_100003271 Ga0070690_1000032714 231
178 3300005331 Ga0070670_100001979 Ga0070670_10000197913 231
179 3300005331 Ga0070670_100010285 Ga0070670_1000102856 231
180 3300005335 Ga0070666_10119256 Ga0070666_101192561 231
181 3300005338 Ga0068868_100123900 Ga0068868_1001239002 231
182 3300005339 Ga0070660_100000231 Ga0070660_10000023114 231
183 3300005340 Ga0070689_100050552 Ga0070689_1000505522 231
184 3300005343 Ga0070687_100129618 Ga0070687_1001296182 231
185 3300005344 Ga0070661_100808608 Ga0070661_1008086081 231
186 3300005353 Ga0070669_100002053 Ga0070669_1000020533 231
187 3300005366 Ga0070659_100000015 Ga0070659_10000001514 231
188 3300005434 Ga0070709_10000782 Ga0070709_1000078215 231
189 3300005435 Ga0070714_100029785 Ga0070714_1000297855 231
190 3300005436 Ga0070713_100059757 Ga0070713_1000597571 231
191 3300005437 Ga0070710_10000207 Ga0070710_1000020714 231
192 3300005438 Ga0070701_10001290 Ga0070701_100012904 231
193 3300005440 Ga0070705_100008425 Ga0070705_1000084254 231
194 3300005445 Ga0070708_100635414 Ga0070708_1006354141 231
195 3300005455 Ga0070663_100014052 Ga0070663_1000140523 231
196 3300005457 Ga0070662_100004404 Ga0070662_1000044044 231
197 3300005457 Ga0070662_100220864 Ga0070662_1002208642 231
198 3300005466 Ga0070685_10213857 Ga0070685_102138572 231
199 3300005539 Ga0068853_100011119 Ga0068853_1000111193 231
200 3300005544 Ga0070686_100005718 Ga0070686_1000057182 231
201 3300005545 Ga0070695_100038851 Ga0070695_1000388514 231
202 3300005547 Ga0070693_100094935 Ga0070693_1000949352 231
203 3300005548 Ga0070665_100086639 Ga0070665_1000866392 231
204 3300005563 Ga0068855_100338899 Ga0068855_1003388992 231
205 3300005564 Ga0070664_100413444 Ga0070664_1004134441 231
206 3300005614 Ga0068856_100219240 Ga0068856_1002192401 231
207 3300005615 Ga0070702_100064864 Ga0070702_1000648642 231
208 3300005617 Ga0068859_100011998 Ga0068859_1000119983 231
209 3300005617 Ga0068859_100066707 Ga0068859_1000667073 231
210 3300005617 Ga0068859_100191158 Ga0068859_1001911582 231
211 3300005617 Ga0068859_100337589 Ga0068859_1003375892 231
212 3300005618 Ga0068864_100004227 Ga0068864_1000042278 231
213 3300005618 Ga0068864_100077853 Ga0068864_1000778532 231
214 3300005618 Ga0068864_100722411 Ga0068864_1007224111 231
215 3300005719 Ga0068861_100023338 Ga0068861_1000233382 231
216 3300005834 Ga0068851_10000273 Ga0068851_1000027320 231
217 3300005834 Ga0068851_10130711 Ga0068851_101307112 231
218 3300005841 Ga0068863_100074738 Ga0068863_1000747382 231
219 3300005841 Ga0068863_100146645 Ga0068863_1001466452 231
220 3300005841 Ga0068863_100212496 Ga0068863_1002124962 231
221 3300005842 Ga0068858_100000285 Ga0068858_10000028539 231
222 3300005842 Ga0068858_100641629 Ga0068858_1006416292 231
223 3300005843 Ga0068860_100013959 Ga0068860_1000139595 231
224 3300005843 Ga0068860_100290602 Ga0068860_1002906022 231
225 3300005844 Ga0068862_100015829 Ga0068862_1000158292 231
226 3300006028 Ga0070717_10075228 Ga0070717_100752283 231
227 3300006173 Ga0070716_100030938 Ga0070716_1000309381 231
228 3300006175 Ga0070712_100078925 Ga0070712_1000789251 231
229 3300006195 Ga0075366_10216863 Ga0075366_102168631 231
230 3300006353 Ga0075370_10053546 Ga0075370_100535463 231
231 3300006846 Ga0075430_100716792 Ga0075430_1007167921 231
232 3300006881 Ga0068865_100430416 Ga0068865_1004304162 231
233 3300006931 Ga0097620_100011997 Ga0097620_1000119977 231
234 3300006931 Ga0097620_100066707 Ga0097620_1000667073 231
235 3300006931 Ga0097620_100191154 Ga0097620_1001911542 231
236 3300006931 Ga0097620_100337598 Ga0097620_1003375982 231
237 3300006946 Ga0079104_1001829 Ga0079104_10018293 231
238 3300009011 Ga0105251_10046423 Ga0105251_100464232 231
239 3300009011 Ga0105251_10083766 Ga0105251_100837662 231
240 3300009036 Ga0105244_10003158 Ga0105244_1000315810 231
241 3300009036 Ga0105244_10006440 Ga0105244_100064404 231
242 3300009092 Ga0105250_10000065 Ga0105250_100000655 231
243 3300009092 Ga0105250_10019596 Ga0105250_100195962 231
244 3300009092 Ga0105250_10048309 Ga0105250_100483092 231
245 3300009092 Ga0105250_10066784 Ga0105250_100667842 231
246 3300009093 Ga0105240_10203804 Ga0105240_102038042 231
247 3300009094 Ga0111539_10003810 Ga0111539_1000381020 231
248 3300009098 Ga0105245_10026508 Ga0105245_100265083 231
249 3300009101 Ga0105247_10000072 Ga0105247_1000007252 231
250 3300009148 Ga0105243_10054928 Ga0105243_100549282 231
251 3300009176 Ga0105242_10027447 Ga0105242_100274474 231
252 3300009177 Ga0105248_10006780 Ga0105248_100067806 231
253 3300009177 Ga0105248_10213409 Ga0105248_102134092 231
254 3300009177 Ga0105248_10217977 Ga0105248_102179773 231
255 3300009177 Ga0105248_10453804 Ga0105248_104538042 231
256 3300009177 Ga0105248_10753077 Ga0105248_107530772 231
257 3300009545 Ga0105237_10006481 Ga0105237_100064814 231
258 3300009551 Ga0105238_10009396 Ga0105238_100093965 231
259 3300009551 Ga0105238_10136319 Ga0105238_101363192 231
260 3300009553 Ga0105249_10010344 Ga0105249_100103443 231
261 3300010375 Ga0105239_10036491 Ga0105239_100364911 231
262 3300011119 Ga0105246_10008968 Ga0105246_100089683 231
263 3300011119 Ga0105246_10020533 Ga0105246_100205334 231
264 3300012502 Ga0157347_1000303 Ga0157347_10003033 231
265 3300013100 Ga0157373_10007991 Ga0157373_100079913 231
266 3300013100 Ga0157373_10011875 Ga0157373_100118753 231
267 3300013100 Ga0157373_10015556 Ga0157373_100155564 231
268 3300013100 Ga0157373_10178490 Ga0157373_101784901 231
269 3300013102 Ga0157371_10361141 Ga0157371_103611412 231
270 3300013104 Ga0157370_10220155 Ga0157370_102201552 231
271 3300013105 Ga0157369_10007939 Ga0157369_100079396 231
272 3300013105 Ga0157369_10010059 Ga0157369_100100599 231
273 3300013105 Ga0157369_10025471 Ga0157369_100254714 231
274 3300013105 Ga0157369_10296179 Ga0157369_102961793 231
275 3300013296 Ga0157374_10333844 Ga0157374_103338442 231
276 3300013306 Ga0163162_10009132 Ga0163162_100091323 231
277 3300013306 Ga0163162_10032279 Ga0163162_100322798 231
278 3300013306 Ga0163162_10067823 Ga0163162_100678236 231
279 3300013308 Ga0157375_10050889 Ga0157375_100508893 231
280 3300013308 Ga0157375_10319742 Ga0157375_103197422 231
281 3300014325 Ga0163163_10028581 Ga0163163_100285814 231
282 3300014497 Ga0182008_10001274 Ga0182008_1000127413 231
283 3300014497 Ga0182008_10001882 Ga0182008_1000188213 231
284 3300014497 Ga0182008_10050488 Ga0182008_100504882 231
285 3300015261 Ga0182006_1013376 Ga0182006_10133762 231
286 3300015262 Ga0182007_10001259 Ga0182007_100012593 231
287 3300017792 Ga0163161_10009764 Ga0163161_100097646 231
288 3300017792 Ga0163161_10011374 Ga0163161_100113743 231
289 3300017792 Ga0163161_10042828 Ga0163161_100428283 231
290 3300017792 Ga0163161_10056011 Ga0163161_100560113 231
291 3300021361 Ga0213872_10000323 Ga0213872_100003238 231
292 3300021361 Ga0213872_10003505 Ga0213872_100035052 231
293 3300021361 Ga0213872_10028707 Ga0213872_100287072 231
294 3300025206 Ga0209435_102782 Ga0209435_1027822 231
295 3300025208 Ga0209436_105020 Ga0209436_1050201 231
296 3300025224 Ga0209784_100116 Ga0209784_1001165 231
297 3300025225 Ga0209566_100141 Ga0209566_10014174 231
298 3300025226 Ga0209674_100110 Ga0209674_10011035 231
299 3300025226 Ga0209674_100162 Ga0209674_10016274 231
300 3300025229 Ga0209147_100170 Ga0209147_1001705 231
301 3300025230 Ga0209563_100138 Ga0209563_1001385 231
302 3300025233 Ga0209437_109956 Ga0209437_1099561 231
303 3300025242 Ga0209258_100287 Ga0209258_1002875 231
304 3300025245 Ga0207425_1000318 Ga0207425_100031815 231
305 3300025245 Ga0207425_1006488 Ga0207425_10064882 231
306 3300025246 Ga0209646_1000239 Ga0209646_100023948 231
307 3300025250 Ga0209026_1003815 Ga0209026_10038154 231
308 3300025253 Ga0209677_100111 Ga0209677_1001115 231
309 3300025256 Ga0209759_1000128 Ga0209759_100012835 231
310 3300025258 Ga0209129_1004938 Ga0209129_10049384 231
311 3300025261 Ga0209233_1002480 Ga0209233_10024806 231
312 3300025263 Ga0209565_1000009 Ga0209565_1000009593 231
313 3300025263 Ga0209565_1000461 Ga0209565_100046111 231
314 3300025263 Ga0209565_1000570 Ga0209565_100057011 231
315 3300025272 Ga0209455_1000037 Ga0209455_10000376 231
316 3300025273 Ga0209673_1000036 Ga0209673_100003689 231
317 3300025273 Ga0209673_1000260 Ga0209673_100026011 231
318 3300025273 Ga0209673_1006964 Ga0209673_10069644 231
319 3300025284 Ga0209130_1002311 Ga0209130_100231111 231
320 3300025291 Ga0209675_1000013 Ga0209675_100001389 231
321 3300025291 Ga0209675_1001088 Ga0209675_100108816 231
322 3300025292 Ga0209676_1000004 Ga0209676_1000004153 231
323 3300025292 Ga0209676_1047066 Ga0209676_10470662 231
324 3300025294 Ga0209025_1000096 Ga0209025_1000096209 231
325 3300025294 Ga0209025_1003816 Ga0209025_100381614 231
326 3300025294 Ga0209025_1004142 Ga0209025_10041423 231
327 3300025295 Ga0209564_1000003 Ga0209564_1000003925 231
328 3300025295 Ga0209564_1000009 Ga0209564_1000009476 231
329 3300025295 Ga0209564_1000122 Ga0209564_100012289 231
330 3300025295 Ga0209564_1000267 Ga0209564_100026743 231
331 3300025297 Ga0209758_1000675 Ga0209758_100067516 231
332 3300025297 Ga0209758_1005265 Ga0209758_100526511 231
333 3300025298 Ga0209050_1000002 Ga0209050_1000002663 231
334 3300025299 Ga0209256_1000106 Ga0209256_100010686 231
335 3300025299 Ga0209256_1000222 Ga0209256_100022215 231
336 3300025299 Ga0209256_1000398 Ga0209256_100039810 231
337 3300025299 Ga0209256_1020242 Ga0209256_10202422 231
338 3300025302 Ga0207426_1002483 Ga0207426_10024834 231
339 3300025303 Ga0209051_1000002 Ga0209051_1000002431 231
340 3300025303 Ga0209051_1008225 Ga0209051_10082252 231
341 3300025304 Ga0209257_1000002 Ga0209257_1000002572 231
342 3300025321 Ga0207656_10000028 Ga0207656_1000002819 231
343 3300025711 Ga0207696_1000081 Ga0207696_100008171 231
344 3300025711 Ga0207696_1001871 Ga0207696_10018715 231
345 3300025711 Ga0207696_1013317 Ga0207696_10133173 231
346 3300025711 Ga0207696_1022599 Ga0207696_10225992 231
347 3300025711 Ga0207696_1045450 Ga0207696_10454501 231
348 3300025728 Ga0207655_1021497 Ga0207655_10214973 231
349 3300025735 Ga0207713_1002126 Ga0207713_10021265 231
350 3300025735 Ga0207713_1008105 Ga0207713_10081052 231
351 3300025900 Ga0207710_10000303 Ga0207710_1000030320 231
352 3300025903 Ga0207680_10155200 Ga0207680_101552002 231
353 3300025906 Ga0207699_10000379 Ga0207699_1000037922 231
354 3300025913 Ga0207695_10032198 Ga0207695_100321983 231
355 3300025914 Ga0207671_10678940 Ga0207671_106789401 231
356 3300025915 Ga0207693_10013170 Ga0207693_100131708 231
357 3300025919 Ga0207657_10000014 Ga0207657_1000001413 231
358 3300025919 Ga0207657_10139180 Ga0207657_101391802 231
359 3300025920 Ga0207649_10409556 Ga0207649_104095562 231
360 3300025923 Ga0207681_10000892 Ga0207681_100008929 231
361 3300025924 Ga0207694_10038314 Ga0207694_100383143 231
362 3300025924 Ga0207694_10082776 Ga0207694_100827762 231
363 3300025924 Ga0207694_10171502 Ga0207694_101715022 231
364 3300025925 Ga0207650_10000086 Ga0207650_1000008658 231
365 3300025925 Ga0207650_10000732 Ga0207650_1000073222 231
366 3300025925 Ga0207650_10019476 Ga0207650_100194765 231
367 3300025925 Ga0207650_10081053 Ga0207650_100810532 231
368 3300025927 Ga0207687_10228928 Ga0207687_102289282 231
369 3300025928 Ga0207700_10029114 Ga0207700_100291143 231
370 3300025929 Ga0207664_10009594 Ga0207664_100095948 231
371 3300025931 Ga0207644_10013499 Ga0207644_100134995 231
372 3300025932 Ga0207690_10000023 Ga0207690_10000023140 231
373 3300025932 Ga0207690_10480885 Ga0207690_104808851 231
374 3300025933 Ga0207706_10000172 Ga0207706_1000017223 231
375 3300025936 Ga0207670_10006847 Ga0207670_100068475 231
376 3300025941 Ga0207711_10069809 Ga0207711_100698093 231
377 3300025941 Ga0207711_10083605 Ga0207711_100836052 231
378 3300025941 Ga0207711_10141823 Ga0207711_101418232 231
379 3300025961 Ga0207712_10016272 Ga0207712_100162728 231
380 3300025986 Ga0207658_10050361 Ga0207658_100503612 231
381 3300025986 Ga0207658_10050849 Ga0207658_100508493 231
382 3300025986 Ga0207658_10228913 Ga0207658_102289131 231
383 3300026023 Ga0207677_10021826 Ga0207677_100218262 231
384 3300026035 Ga0207703_10001441 Ga0207703_1000144115 231
385 3300026035 Ga0207703_10259991 Ga0207703_102599911 231
386 3300026041 Ga0207639_10026033 Ga0207639_100260334 231
387 3300026067 Ga0207678_10025545 Ga0207678_100255454 231
388 3300026075 Ga0207708_10274489 Ga0207708_102744891 231
389 3300026088 Ga0207641_10011245 Ga0207641_100112452 231
390 3300026088 Ga0207641_10012333 Ga0207641_100123335 231
391 3300026095 Ga0207676_10098533 Ga0207676_100985332 231
392 3300026095 Ga0207676_10131418 Ga0207676_101314183 231
393 3300026116 Ga0207674_10784179 Ga0207674_107841791 231
394 3300026118 Ga0207675_100009401 Ga0207675_1000094018 231
395 3300026142 Ga0207698_10153986 Ga0207698_101539861 231
396 3300027111 Ga0209281_1000008 Ga0209281_100000874 231
397 3300027907 Ga0207428_10034074 Ga0207428_100340741 231
398 3300028379 Ga0268266_10030215 Ga0268266_100302153 231
399 3300028380 Ga0268265_10014914 Ga0268265_100149146 231
400 3300028380 Ga0268265_10127672 Ga0268265_101276723 231
401 3300028381 Ga0268264_10158134 Ga0268264_101581342 231
402 3300028381 Ga0268264_10213008 Ga0268264_102130082 231
403 3300028786 Ga0307517_10083751 Ga0307517_100837512 231
404 3300028794 Ga0307515_10000049 Ga0307515_1000004984 231
405 3300028794 Ga0307515_10179926 Ga0307515_101799261 231
406 3300030521 Ga0307511_10044168 Ga0307511_100441683 231
407 3300031507 Ga0307509_10343109 Ga0307509_103431091 231
408 3300031548 Ga0307408_100002456 Ga0307408_10000245611 231
409 3300031711 Ga0265314_10122879 Ga0265314_101228793 231
410 3300031731 Ga0307405_10004623 Ga0307405_100046236 231
411 3300032002 Ga0307416_100236177 Ga0307416_1002361772 231
412 3300032002 Ga0307416_100293228 Ga0307416_1002932283 231
413 3300032126 Ga0307415_100148894 Ga0307415_1001488942 231
414 3300033180 Ga0307510_10000013 Ga0307510_1000001325 231
415 3300035121 Ga0373960_0000337 Ga0373960_0000337_7097_7804 231
416 3300035691 Ga0373931_0015579 Ga0373931_0015579_1359_2066 231
417 3300036401 Ga0373937_0201026 Ga0373937_0201026_389_1102 231
418 3300037471 Ga0395905_0002838 Ga0395905_0002838_4620_5324 231
419 3300039447 Ga0436361_0104721 Ga0436361_0104721_9944_10690 231
420 3300039447 Ga0436361_0470493 Ga0436361_0470493_738_1442 231
421 3300039447 Ga0436361_0488174 Ga0436361_0488174_19022_19726 231
422 3300039447 Ga0436361_0602168 Ga0436361_0602168_3333_4037 231
423 3300039447 Ga0436361_1047176 Ga0436361_1047176_1163_1909 231
424 3300039447 Ga0436361_1223139 Ga0436361_1223139_6565_7269 231
425 3300039450 Ga0436363_0918195 Ga0436363_0918195_201_902 231
426 3300041411 Ga0439466_0024026 Ga0439466_0024026_1252_1956 231
427 3300041997 Ga0439431_0038124 Ga0439431_0038124_408_1118 231
428 3300042006 Ga0439432_000008 Ga0439432_000008_23005_23703 231
429 3300042127 Ga0450890_007679 Ga0450890_007679_558_1268 231
430 3300042139 Ga0450904_000031 Ga0450904_000031_17729_18433 231
431 3300042142 Ga0450905_018750 Ga0450905_018750_122_826 231
432 3300042156 Ga0439446_0050007 Ga0439446_0050007_262_972 231
433 3300042438 Ga0439459_0000672 Ga0439459_0000672_2248_2958 231
434 3300044658 Ga0466972_0018830 Ga0466972_0018830_1145_1849 231
435 3300046453 Ga0495627_007626 Ga0495627_007626_1139_1843 231
436 3300046455 Ga0495603_0130388 Ga0495603_0130388_680_1378 231
437 3300046457 Ga0495590_0000008 Ga0495590_0000008_79631_80335 231
438 3300046458 Ga0495591_002224 Ga0495591_002224_5036_5734 231
439 3300046459 Ga0495629_0009959 Ga0495629_0009959_5286_5984 231
440 3300046459 Ga0495629_0090526 Ga0495629_0090526_682_1392 231
441 3300046460 Ga0495638_0002309 Ga0495638_0002309_3060_3764 231
442 3300046463 Ga0495653_0013580 Ga0495653_0013580_1783_2508 231
443 3300046463 Ga0495653_0042708 Ga0495653_0042708_369_1067 231
444 3300046471 Ga0495650_0000161 Ga0495650_0000161_73604_74308 231
445 3300046471 Ga0495650_0000239 Ga0495650_0000239_49176_49886 231
446 3300046471 Ga0495650_0017036 Ga0495650_0017036_2278_2982 231
447 3300046472 Ga0495580_0296961 Ga0495580_0296961_188_913 231
448 3300046472 Ga0495580_0428628 Ga0495580_0428628_169_867 231
449 3300046473 Ga0495582_0010242 Ga0495582_0010242_40_750 231
450 3300046473 Ga0495582_0033315 Ga0495582_0033315_902_1600 231
451 3300046474 Ga0495605_0000921 Ga0495605_0000921_18731_19435 231
452 3300046474 Ga0495605_0017045 Ga0495605_0017045_3104_3814 231
453 3300046475 Ga0495639_0070025 Ga0495639_0070025_786_1511 231
454 3300046491 Ga0495584_0022440 Ga0495584_0022440_756_1466 231
455 3300046491 Ga0495584_0227752 Ga0495584_0227752_113_814 231
456 3300046491 Ga0495584_0272300 Ga0495584_0272300_129_839 231
457 3300046492 Ga0495585_0010191 Ga0495585_0010191_952_1656 231
458 3300046492 Ga0495585_0063604 Ga0495585_0063604_664_1374 231
459 3300046499 Ga0495594_0080073 Ga0495594_0080073_988_1698 231
460 3300046499 Ga0495594_0109332 Ga0495594_0109332_403_1101 231
461 3300046499 Ga0495594_0122781 Ga0495594_0122781_428_1153 231
462 3300046500 Ga0495596_0003871 Ga0495596_0003871_241_951 231
463 3300046500 Ga0495596_0006209 Ga0495596_0006209_3116_3820 231
464 3300046501 Ga0495607_0000561 Ga0495607_0000561_24050_24763 231
465 3300046501 Ga0495607_0003529 Ga0495607_0003529_6642_7352 231
466 3300046501 Ga0495607_0030932 Ga0495607_0030932_2535_3233 231
467 3300046501 Ga0495607_0059146 Ga0495607_0059146_46_750 231
468 3300046506 Ga0495583_0000160 Ga0495583_0000160_62880_63590 231
469 3300046506 Ga0495583_0000544 Ga0495583_0000544_23408_24112 231
470 3300046506 Ga0495583_0002756 Ga0495583_0002756_9171_9932 231
471 3300046507 Ga0495606_0016874 Ga0495606_0016874_84_848 231
472 3300046507 Ga0495606_0022629 Ga0495606_0022629_2230_2934 231
473 3300046507 Ga0495606_0034545 Ga0495606_0034545_1386_2084 231
474 3300046512 Ga0495610_0003073 Ga0495610_0003073_8055_8819 231
475 3300046512 Ga0495610_0004990 Ga0495610_0004990_3823_4521 231
476 3300046512 Ga0495610_0016181 Ga0495610_0016181_1700_2398 231
477 3300046512 Ga0495610_0032603 Ga0495610_0032603_1356_2054 231
478 3300046512 Ga0495610_0088208 Ga0495610_0088208_61_822 231
479 3300046513 Ga0495616_0002763 Ga0495616_0002763_8776_9486 231
480 3300046513 Ga0495616_0019465 Ga0495616_0019465_2252_2962 231
481 3300046515 Ga0495620_0000442 Ga0495620_0000442_8262_8957 231
482 3300046515 Ga0495620_0007504 Ga0495620_0007504_2366_3064 231
483 3300046516 Ga0495628_0125633 Ga0495628_0125633_223_927 231
484 3300046518 Ga0495631_0002610 Ga0495631_0002610_1787_2497 231
485 3300046518 Ga0495631_0002645 Ga0495631_0002645_2357_3061 231
486 3300046518 Ga0495631_0051043 Ga0495631_0051043_614_1324 231
487 3300046518 Ga0495631_0129907 Ga0495631_0129907_86_787 231
488 3300046519 Ga0495632_0000621 Ga0495632_0000621_13170_13865 231
489 3300046519 Ga0495632_0001302 Ga0495632_0001302_5637_6347 231
490 3300046519 Ga0495632_0007221 Ga0495632_0007221_4919_5617 231
491 3300046522 Ga0495643_0000142 Ga0495643_0000142_75614_76378 231
492 3300046522 Ga0495643_0001231 Ga0495643_0001231_16429_17124 231
493 3300046522 Ga0495643_0041936 Ga0495643_0041936_1769_2473 231
494 3300046523 Ga0495644_0003117 Ga0495644_0003117_5492_6202 231
495 3300046523 Ga0495644_0050847 Ga0495644_0050847_270_971 231
496 3300046523 Ga0495644_0053999 Ga0495644_0053999_697_1401 231
497 3300046524 Ga0495648_0000188 Ga0495648_0000188_13571_14266 231
498 3300046524 Ga0495648_0121198 Ga0495648_0121198_130_894 231
499 3300046525 Ga0495663_0011932 Ga0495663_0011932_596_1297 231
500 3300046526 Ga0495666_0003824 Ga0495666_0003824_2655_3359 231
501 3300046526 Ga0495666_0012332 Ga0495666_0012332_1695_2393 231
502 3300046528 Ga0495642_0002438 Ga0495642_0002438_3424_4134 231
503 3300046528 Ga0495642_0003247 Ga0495642_0003247_2539_3243 231
504 3300046528 Ga0495642_0008182 Ga0495642_0008182_291_995 231
505 3300046528 Ga0495642_0013991 Ga0495642_0013991_396_1097 231
506 3300046528 Ga0495642_0016015 Ga0495642_0016015_1991_2701 231
507 3300046529 Ga0495652_0011549 Ga0495652_0011549_1137_1862 231
508 3300046530 Ga0495654_0000813 Ga0495654_0000813_10508_11206 231
509 3300046530 Ga0495654_0009048 Ga0495654_0009048_1323_2021 231
510 3300046530 Ga0495654_0105266 Ga0495654_0105266_571_1269 231
511 3300046531 Ga0495665_0001605 Ga0495665_0001605_4670_5368 231
512 3300046531 Ga0495665_0006890 Ga0495665_0006890_843_1568 231
513 3300046531 Ga0495665_0064220 Ga0495665_0064220_565_1263 231
514 3300046535 Ga0495586_0005366 Ga0495586_0005366_86_784 231
515 3300046535 Ga0495586_0014722 Ga0495586_0014722_188_913 231
516 3300046536 Ga0495587_0122881 Ga0495587_0122881_442_1140 231
517 3300046538 Ga0495609_0000269 Ga0495609_0000269_42367_43077 231
518 3300046538 Ga0495609_0008841 Ga0495609_0008841_747_1457 231
519 3300046542 Ga0495597_0000908 Ga0495597_0000908_952_1653 231
520 3300046542 Ga0495597_0001319 Ga0495597_0001319_15956_16720 231
521 3300046542 Ga0495597_0006885 Ga0495597_0006885_1719_2465 231
522 3300046542 Ga0495597_0015954 Ga0495597_0015954_1063_1764 231
523 3300046543 Ga0495645_0305518 Ga0495645_0305518_58_783 231
524 3300046557 Ga0495622_0002221 Ga0495622_0002221_2884_3582 231
525 3300046557 Ga0495622_0005278 Ga0495622_0005278_1081_1791 231
526 3300046557 Ga0495622_0164441 Ga0495622_0164441_234_959 231
527 3300046558 Ga0495633_0020687 Ga0495633_0020687_1882_2583 231
528 3300046558 Ga0495633_0047928 Ga0495633_0047928_821_1531 231
529 3300046558 Ga0495633_0107383 Ga0495633_0107383_131_841 231
530 3300046559 Ga0495667_0202782 Ga0495667_0202782_64_768 231
531 3300046615 Ga0495656_0003837 Ga0495656_0003837_1386_2087 231
532 3300046615 Ga0495656_0009410 Ga0495656_0009410_2076_2777 231
533 3300046615 Ga0495656_0170685 Ga0495656_0170685_132_842 231
534 3300046616 Ga0495668_0005378 Ga0495668_0005378_5870_6571 231
535 3300046616 Ga0495668_0022791 Ga0495668_0022791_1552_2271 231
536 3300046616 Ga0495668_0031556 Ga0495668_0031556_1625_2335 231
537 3300046642 Ga0495634_0011374 Ga0495634_0011374_4754_5479 231
538 3300046648 Ga0495611_0009405 Ga0495611_0009405_1460_2161 231
539 3300046648 Ga0495611_0020658 Ga0495611_0020658_118_828 231
540 3300046648 Ga0495611_0051781 Ga0495611_0051781_538_1239 231
541 3300046648 Ga0495611_0235299 Ga0495611_0235299_43_744 231
542 3300046660 Ga0495625_0001214 Ga0495625_0001214_20134_20838 231
543 3300046660 Ga0495625_0039690 Ga0495625_0039690_2312_3010 231
544 3300046660 Ga0495625_0266604 Ga0495625_0266604_177_878 231
545 3300046663 Ga0495635_0143014 Ga0495635_0143014_666_1364 231
546 3300046665 Ga0495661_0000817 Ga0495661_0000817_23173_23871 231
547 3300046665 Ga0495661_0006103 Ga0495661_0006103_5614_6312 231
548 3300046665 Ga0495661_0012970 Ga0495661_0012970_2041_2751 231
549 3300046665 Ga0495661_0132127 Ga0495661_0132127_291_1037 231
550 3300046665 Ga0495661_0214803 Ga0495661_0214803_164_865 231
551 3300046674 Ga0495588_0106086 Ga0495588_0106086_26_736 231
552 3300046674 Ga0495588_0179565 Ga0495588_0179565_105_803 231
553 3300046674 Ga0495588_0247380 Ga0495588_0247380_12_722 231
554 3300046679 Ga0495623_0031373 Ga0495623_0031373_843_1568 231
555 3300046679 Ga0495623_0110862 Ga0495623_0110862_571_1275 231
556 3300046679 Ga0495623_0122597 Ga0495623_0122597_422_1120 231
557 3300046684 Ga0495669_0008797 Ga0495669_0008797_3343_4053 231
558 3300046684 Ga0495669_0070195 Ga0495669_0070195_777_1481 231
559 3300046689 Ga0495613_0053494 Ga0495613_0053494_489_1187 231
560 3300046691 Ga0495670_0011246 Ga0495670_0011246_449_1153 231
561 3300046691 Ga0495670_0031347 Ga0495670_0031347_877_1578 231
562 3300046691 Ga0495670_0158476 Ga0495670_0158476_454_1164 231
563 3300046694 Ga0495649_0000028 Ga0495649_0000028_61469_62173 231
564 3300046694 Ga0495649_0003341 Ga0495649_0003341_6110_6874 231
565 3300046794 Ga0495589_0000657 Ga0495589_0000657_795_1499 231
566 3300046794 Ga0495589_0003182 Ga0495589_0003182_2883_3581 231
567 3300046794 Ga0495589_0008613 Ga0495589_0008613_14_715 231
568 3300046794 Ga0495589_0055905 Ga0495589_0055905_650_1360 231
569 3300046794 Ga0495589_0122299 Ga0495589_0122299_65_763 231
570 3300046810 Ga0495660_0005279 Ga0495660_0005279_6548_7258 231
571 3300046810 Ga0495660_0005568 Ga0495660_0005568_1351_2049 231
572 3300047315 Ga0495581_0004376 Ga0495581_0004376_4476_5186 231
573 3300047315 Ga0495581_0026792 Ga0495581_0026792_2245_2943 231
574 3300047317 Ga0495604_0017445 Ga0495604_0017445_2666_3391 231
575 3300047317 Ga0495604_0065370 Ga0495604_0065370_32_736 231
576 3300047319 Ga0495674_0006932 Ga0495674_0006932_8522_9220 231
577 3300047320 Ga0495672_0000189 Ga0495672_0000189_7763_8527 231
578 3300047320 Ga0495672_0001634 Ga0495672_0001634_6276_6986 231
579 3300047320 Ga0495672_0082896 Ga0495672_0082896_729_1448 231
580 3300047320 Ga0495672_0104572 Ga0495672_0104572_618_1328 231
581 3300047321 Ga0495676_0000017 Ga0495676_0000017_114089_114799 231
582 3300047321 Ga0495676_0071133 Ga0495676_0071133_1314_2012 231
583 3300047321 Ga0495676_0198705 Ga0495676_0198705_651_1349 231
584 3300047323 Ga0495683_0004154 Ga0495683_0004154_1451_2161 231
585 3300047323 Ga0495683_0179020 Ga0495683_0179020_131_841 231
586 3300047444 Ga0495675_0012620 Ga0495675_0012620_3967_4692 231
587 3300047445 Ga0495677_0006940 Ga0495677_0006940_763_1473 231
588 3300047445 Ga0495677_0010213 Ga0495677_0010213_2134_2835 231
589 3300047446 Ga0495679_000699 Ga0495679_000699_8197_8958 231
590 3300047446 Ga0495679_009218 Ga0495679_009218_1838_2593 231
591 3300047470 Ga0495681_0003295 Ga0495681_0003295_6809_7510 231
592 3300047470 Ga0495681_0004009 Ga0495681_0004009_3130_3828 231
593 3300047470 Ga0495681_0022031 Ga0495681_0022031_2031_2741 231
594 3300047472 Ga0495686_0000076 Ga0495686_0000076_170205_170909 231
595 3300047673 Ga0495593_0070071 Ga0495593_0070071_1028_1726 231
596 3300048088 Ga0495602_0108551 Ga0495602_0108551_1476_2174 231
597 3300048089 Ga0495614_0012640 Ga0495614_0012640_1798_2508 231
598 3300048089 Ga0495614_0036870 Ga0495614_0036870_1121_1819 231
599 3300048091 Ga0495626_0004982 Ga0495626_0004982_6611_7309 231
600 3300048091 Ga0495626_0026298 Ga0495626_0026298_663_1367 231
601 3300048905 Ga0496102_0009591 Ga0496102_0009591_5419_6123 231
602 3300048905 Ga0496102_0044162 Ga0496102_0044162_1759_2457 231
603 3300048905 Ga0496102_0425028 Ga0496102_0425028_287_991 231
604 3300048906 Ga0496103_0002329 Ga0496103_0002329_5882_6586 231
605 3300048907 Ga0496104_0224418 Ga0496104_0224418_771_1475 231
606 3300048910 Ga0496107_0110786 Ga0496107_0110786_481_1185 231
607 3300048915 Ga0496112_0170695 Ga0496112_0170695_291_995 231
608 3300048918 Ga0496115_0225156 Ga0496115_0225156_705_1403 231
609 3300048918 Ga0496115_0386130 Ga0496115_0386130_261_965 231
610 3300048919 Ga0496116_0011501 Ga0496116_0011501_5430_6125 231
611 3300048919 Ga0496116_0077358 Ga0496116_0077358_314_1018 231
612 3300048920 Ga0496117_0001169 Ga0496117_0001169_22884_23579 231
613 3300048920 Ga0496117_0001494 Ga0496117_0001494_7655_8353 231
614 3300048920 Ga0496117_0003096 Ga0496117_0003096_7048_7752 231
615 3300048920 Ga0496117_0008511 Ga0496117_0008511_5186_5881 231
616 3300048920 Ga0496117_0017465 Ga0496117_0017465_988_1686 231
617 3300048921 Ga0496118_0004011 Ga0496118_0004011_11537_12232 231
618 3300048921 Ga0496118_0064556 Ga0496118_0064556_675_1511 231
619 3300048921 Ga0496118_0162404 Ga0496118_0162404_157_855 231
620 3300048922 Ga0496119_0002476 Ga0496119_0002476_17933_18649 231
621 3300048923 Ga0496120_0000115 Ga0496120_0000115_122283_122999 231
622 3300048923 Ga0496120_0001738 Ga0496120_0001738_16886_17584 231
623 3300048923 Ga0496120_0034298 Ga0496120_0034298_493_1209 231
624 3300048924 Ga0496121_0000808 Ga0496121_0000808_11149_11853 231
625 3300048924 Ga0496121_0004158 Ga0496121_0004158_14809_15513 231
626 3300048924 Ga0496121_0051608 Ga0496121_0051608_31_735 231
627 3300048924 Ga0496121_0115813 Ga0496121_0115813_34_738 231
628 3300048924 Ga0496121_0119273 Ga0496121_0119273_111_827 231
629 3300048924 Ga0496121_0307926 Ga0496121_0307926_19_723 231
630 3300048925 Ga0496122_0029677 Ga0496122_0029677_1369_2190 231
631 3300048925 Ga0496122_0060371 Ga0496122_0060371_1282_2046 231
632 3300048925 Ga0496122_0131758 Ga0496122_0131758_510_1208 231
633 3300048926 Ga0496123_0027588 Ga0496123_0027588_1387_2208 231
634 3300048926 Ga0496123_0056828 Ga0496123_0056828_1050_1748 231
635 3300048927 Ga0496124_0016672 Ga0496124_0016672_1145_1840 231
636 3300048927 Ga0496124_0025805 Ga0496124_0025805_3931_4629 231
637 3300048927 Ga0496124_0050080 Ga0496124_0050080_1795_2493 231
638 3300048928 Ga0496125_0000126 Ga0496125_0000126_23686_24384 231
639 3300048928 Ga0496125_0000236 Ga0496125_0000236_11865_12560 231
640 3300048928 Ga0496125_0000775 Ga0496125_0000775_48017_48838 231
641 3300048928 Ga0496125_0004735 Ga0496125_0004735_4515_5219 231
642 3300048928 Ga0496125_0005065 Ga0496125_0005065_9656_10360 231
643 3300048928 Ga0496125_0020759 Ga0496125_0020759_1691_2452 231
644 3300048928 Ga0496125_0025048 Ga0496125_0025048_1355_2119 231
645 3300048928 Ga0496125_0027433 Ga0496125_0027433_4200_4955 231
646 3300048928 Ga0496125_0163576 Ga0496125_0163576_690_1388 231
647 3300048929 Ga0496126_0012108 Ga0496126_0012108_6454_7152 231
648 3300048929 Ga0496126_0043734 Ga0496126_0043734_2125_2823 231
649 3300049459 Ga0495678_000025 Ga0495678_000025_150280_150984 231
650 3300049459 Ga0495678_000402 Ga0495678_000402_4419_5183 231
651 3300049459 Ga0495678_005276 Ga0495678_005276_3171_3881 231
652 3300049568 Ga0501031_0074616 Ga0501031_0074616_234_938 231
653 3300049570 Ga0501033_0388674 Ga0501033_0388674_25_723 231
654 3300049574 Ga0501038_0060044 Ga0501038_0060044_22_726 231
655 3300049581 Ga0501047_0072612 Ga0501047_0072612_510_1208 231
656 3300049582 Ga0501048_0163807 Ga0501048_0163807_143_841 231
657 3300049586 Ga0501070_0000047 Ga0501070_0000047_90636_91340 231
658 3300049663 Ga0501223_000001 Ga0501223_000001_144261_144974 231
659 3300049664 Ga0501224_000003 Ga0501224_000003_176411_177124 231
660 3300049668 Ga0501233_000030 Ga0501233_000030_12848_13561 231
661 3300049669 Ga0501235_000182 Ga0501235_000182_4658_5371 231
662 3300049705 Ga0501225_0000001 Ga0501225_0000001_11922_12635 231
663 3300049707 Ga0501234_000234 Ga0501234_000234_3242_3955 231
664 3300049742 Ga0501080_0000366 Ga0501080_0000366_6450_7154 231
665 3300049822 Ga0501035_0018191 Ga0501035_0018191_4263_4967 231
666 3300049823 Ga0501044_0000086 Ga0501044_0000086_24828_25526 231
667 3300049823 Ga0501044_0001727 Ga0501044_0001727_22013_22717 231
668 3300049853 Ga0501226_000007 Ga0501226_000007_72260_72964 231
669 3300049853 Ga0501226_000013 Ga0501226_000013_162592_163305 231
670 3300050493 nmdc:mga0k408_290689_c1 nmdc:mga0k408_290689_c1_120_836 231
671 3300050511 nmdc:mga08y16_39763_c1 nmdc:mga08y16_39763_c1_4210_4920 231
672 3300053124 Ga0500617_177930 Ga0500617_177930_83_793 231
673 3300053130 Ga0500642_0208756 Ga0500642_0208756_77_787 231
674 3300053156 Ga0500622_0000970 Ga0500622_0000970_708_1421 231
675 3300053161 Ga0500634_0003030 Ga0500634_0003030_5347_6045 231
676 3300053161 Ga0500634_0106549 Ga0500634_0106549_453_1151 231
677 iso_pu_bacteria 2511231002 2511247203 231
678 iso_pu_bacteria 2582581305 2585262838 231
679 iso_pu_bacteria 2599185167 2599399588 231
680 iso_pu_bacteria 2599185191 2599519259 231
681 iso_pu_bacteria 8054503363 8054505487 231
682 iso_pu_bacteria 8056131705 8056133826 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

19

99

0.94

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

28

100

0.91

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

23

104

0.87

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

150

223

0.85

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

129

224

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nax-assembly1.cif.gz_B crystal structure of glutathione transferase pput_1760 from pseudomonas putida, target efi-507288, with one glutathione disulfide bound per one protein subunit 0.997 2 231
4ikh-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from pseudomonas fluorescens pf-5, target efi-900003, with two glutathione bound 0.9956 6 230
4nhz-assembly2.cif.gz_D crystal structure of glutathione transferase bbta-3750 from bradyrhizobium sp., target efi-507290, with one glutathione bound 0.9934 3 230
4nax-assembly1.cif.gz_B crystal structure of glutathione transferase pput_1760 from pseudomonas putida, target efi-507288, with one glutathione disulfide bound per one protein subunit 0.9927 2 231
4nhz-assembly4.cif.gz_H crystal structure of glutathione transferase bbta-3750 from bradyrhizobium sp., target efi-507290, with one glutathione bound 0.9889 1 230
ID Description Score Start End Superfamily
4ikhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 1 6 104 3.40.30.10
4naxB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9987 106 220 1.20.1050.10
4mf6A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9932 1 104 3.40.30.10
4naxB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9901 106 220 1.20.1050.10
4nhzB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.983 106 220 1.20.1050.10
ID Description Score Start End GO Terms
AF-J2VEM9-F1-model_v4 Glutathione S-transferase 1.006 8 87 GO:0016740
AF-A0A257LP08-F1-model_v4 Glutathione S-transferase 1.004 1 123 GO:0016740
AF-A0A136QFY1-F1-model_v4 deleted 1.002 22 231
AF-A0A7V7WIE5-F1-model_v4 Glutathione S-transferase 1.001 4 231 GO:0016740
AF-A0A3E1RDG9-F1-model_v4 Glutathione S-transferase 1 1 230 GO:0016740

Feature Viewer

pLDDT pTM Quality
96.39 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map