F474926
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 682 | 416 | 596 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300042156|Ga0439446_0050007|Ga0439446_0050007_262_972 |
| Length | 236 |
| Sequence | MPDLTRFAITRKWPAAHPDRLQLYSLPTPNGVKVSIALEELGLPYEAHRVAFDTNDQLSPEFLSLNPNNKIPAIIDPDGPGGQPLALFESGAILVYLAEKTGRLLPRAAAAAGRYETLQWVMWQMGGVGPMFGQVGFFHKFAGKDYEDKRPRDRYVEESKRLLRVLDGRLAGRSWIMGEDFTIADIATLPWVRNLIGFYGARELVGFDQFENVARVLNAFIDRPAVARGLTIPAAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 3 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 4 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 5 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 6 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 7 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 8 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 9 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 10 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 11 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 12 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 13 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 14 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 15 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 16 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 17 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 18 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 19 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 20 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 21 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 22 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 23 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 24 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 25 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 26 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 27 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 28 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 29 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 30 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 31 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 32 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 33 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 34 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 35 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 36 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 37 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 38 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 39 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 40 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 41 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 42 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 43 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 44 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 45 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 46 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 47 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 48 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 49 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 50 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 51 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 52 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 53 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 54 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 55 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 56 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 57 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 58 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 59 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 60 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 61 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 62 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 63 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 64 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 65 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 66 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 67 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 68 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 69 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 70 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 71 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 72 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 73 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 74 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 75 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 76 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 77 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 78 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 79 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 80 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 81 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 82 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 83 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 84 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 85 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 86 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 87 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 88 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 89 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 90 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 91 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 92 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 93 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 94 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 95 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 96 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 97 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 98 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 99 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 100 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 101 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 102 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 103 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 104 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 105 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 106 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 107 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 108 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 109 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 110 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 111 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 112 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 115 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 116 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 118 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 119 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 125 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 126 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 127 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 132 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 133 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 134 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 135 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 136 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 137 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 140 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 142 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 144 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 145 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 146 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 147 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 148 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 149 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 150 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 151 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 153 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 154 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 155 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 156 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 157 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 158 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 160 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 177 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 187 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 188 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 189 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 191 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 192 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 202 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 203 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 205 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 206 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 208 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 210 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 212 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 215 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 218 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 262 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 263 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 267 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 268 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 269 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 270 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 271 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 272 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 273 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 274 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 275 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 276 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 277 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 278 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 280 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 281 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 282 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 283 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 284 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 285 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 286 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 287 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 288 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 289 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 290 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 291 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 292 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 293 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 367 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 368 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 369 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 370 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 371 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 372 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 373 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 374 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 375 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 376 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 377 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 378 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 379 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 380 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 381 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 382 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 383 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 391 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 392 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 393 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 394 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 395 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 396 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 400 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 401 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 403 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 404 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 405 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 406 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 407 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 408 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 409 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 410 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 411 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 412 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 413 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 414 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 415 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 416 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.39 |
| Metatranscriptomes | 0 |
| Isolates | 12.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.9 |
| Nodule | 1.17 |
| Rhizoplane | 2.79 |
| Rhizosphere | 67.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2416600 | 2162886007 | Bacteria | 5529 |
| 2 | JGI24741J21665_1008640 | 3300001915 | Bacteria | 1913 |
| 3 | JGI24752J21851_1000730 | 3300001976 | Bacteria | 4392 |
| 4 | JGI24737J22298_10050897 | 3300001990 | Bacteria | 1258 |
| 5 | JGI24749J21850_1002277 | 3300002076 | Bacteria | 2701 |
| 6 | JGI25155J39150_1002715 | 3300002704 | Bacteria | 938 |
| 7 | JGI25156J39149_1002008 | 3300002705 | Bacteria | 7782 |
| 8 | JGI25162J39368_1005774 | 3300002737 | Bacteria | 2312 |
| 9 | JGI25154J39366_1000208 | 3300002738 | Bacteria | 41989 |
| 10 | JGI25154J39366_1008483 | 3300002738 | Bacteria | 1319 |
| 11 | JGI25152J39213_1004941 | 3300002773 | Bacteria | 4041 |
| 12 | JGI25151J46595_10006396 | 3300003187 | Bacteria | 5921 |
| 13 | JGI25151J46595_10021764 | 3300003187 | Bacteria | 2675 |
| 14 | JGI25153J46596_10006450 | 3300003215 | Bacteria | 5921 |
| 15 | JGI25153J46596_10018272 | 3300003215 | Bacteria | 2730 |
| 16 | rootL2_10049679 | 3300003322 | Bacteria | 3654 |
| 17 | JGI25160J50197_1010960 | 3300003354 | Bacteria | 3246 |
| 18 | Ga0055538_1000386 | 3300003751 | Bacteria | 18042 |
| 19 | Ga0055539_1000383 | 3300003752 | Bacteria | 18042 |
| 20 | Ga0055533_1000378 | 3300003756 | Bacteria | 18026 |
| 21 | Ga0055533_1000535 | 3300003756 | Bacteria | 13593 |
| 22 | Ga0055532_1000473 | 3300003758 | Bacteria | 18042 |
| 23 | Ga0055525_1000539 | 3300003759 | Bacteria | 18042 |
| 24 | Ga0055529_1000080 | 3300003763 | Bacteria | 148614 |
| 25 | Ga0055526_1000198 | 3300003771 | Bacteria | 51889 |
| 26 | Ga0055526_1000827 | 3300003771 | Bacteria | 23107 |
| 27 | Ga0055526_1009948 | 3300003771 | Bacteria | 4496 |
| 28 | Ga0055526_1013069 | 3300003771 | Bacteria | 3549 |
| 29 | Ga0055537_1000035 | 3300003773 | Bacteria | 96274 |
| 30 | Ga0055537_1000111 | 3300003773 | Bacteria | 61884 |
| 31 | Ga0055524_1001079 | 3300003775 | Bacteria | 16748 |
| 32 | Ga0055524_1010543 | 3300003775 | Bacteria | 3672 |
| 33 | Ga0055534_1000268 | 3300003784 | Bacteria | 35791 |
| 34 | Ga0055528_1000178 | 3300003790 | Bacteria | 53709 |
| 35 | Ga0055528_1009461 | 3300003790 | Bacteria | 4067 |
| 36 | Ga0055530_10000246 | 3300003791 | Bacteria | 48934 |
| 37 | Ga0055540_1006912 | 3300003792 | Bacteria | 4393 |
| 38 | Ga0055540_1010127 | 3300003792 | Bacteria | 3166 |
| 39 | Ga0055531_10007008 | 3300003794 | Bacteria | 6251 |
| 40 | Ga0055541_1000272 | 3300003841 | Bacteria | 18042 |
| 41 | Ga0055543_1005569 | 3300004625 | Bacteria | 3194 |
| 42 | Ga0065165_1000281 | 3300005262 | Bacteria | 86863 |
| 43 | Ga0065165_1001147 | 3300005262 | Bacteria | 30992 |
| 44 | Ga0065165_1023503 | 3300005262 | Bacteria | 2088 |
| 45 | Ga0065714_10066496 | 3300005288 | Bacteria | 6744 |
| 46 | Ga0065714_10067661 | 3300005288 | Bacteria | 5301 |
| 47 | Ga0065704_10025345 | 3300005289 | Bacteria | 926 |
| 48 | Ga0065704_10074885 | 3300005289 | Bacteria | 5940 |
| 49 | Ga0065712_10077793 | 3300005290 | Bacteria | 3439 |
| 50 | Ga0070690_100003271 | 3300005330 | Bacteria | 8849 |
| 51 | Ga0070670_100001979 | 3300005331 | Bacteria | 16757 |
| 52 | Ga0070670_100010285 | 3300005331 | Bacteria | 7986 |
| 53 | Ga0070666_10119256 | 3300005335 | Bacteria | 1828 |
| 54 | Ga0070682_100480985 | 3300005337 | Bacteria | 958 |
| 55 | Ga0068868_100123900 | 3300005338 | Bacteria | 2109 |
| 56 | Ga0070660_100000231 | 3300005339 | Bacteria | 37089 |
| 57 | Ga0070660_100004985 | 3300005339 | Bacteria | 9177 |
| 58 | Ga0070689_100050552 | 3300005340 | Bacteria | 3212 |
| 59 | Ga0070687_100129618 | 3300005343 | Bacteria | 1454 |
| 60 | Ga0070661_100116100 | 3300005344 | Bacteria | 2002 |
| 61 | Ga0070661_100808608 | 3300005344 | Bacteria | 770 |
| 62 | Ga0070669_100002053 | 3300005353 | Bacteria | 14576 |
| 63 | Ga0070659_100000015 | 3300005366 | Bacteria | 176475 |
| 64 | Ga0070709_10000782 | 3300005434 | Bacteria | 17817 |
| 65 | Ga0070714_100029785 | 3300005435 | Bacteria | 4540 |
| 66 | Ga0070713_100059757 | 3300005436 | Bacteria | 3185 |
| 67 | Ga0070710_10000207 | 3300005437 | Bacteria | 27705 |
| 68 | Ga0070701_10001290 | 3300005438 | Bacteria | 9205 |
| 69 | Ga0070705_100008425 | 3300005440 | Bacteria | 5107 |
| 70 | Ga0070708_100635414 | 3300005445 | Bacteria | 1006 |
| 71 | Ga0070663_100014052 | 3300005455 | Bacteria | 5129 |
| 72 | Ga0070662_100004404 | 3300005457 | Bacteria | 8902 |
| 73 | Ga0070662_100220864 | 3300005457 | Bacteria | 1512 |
| 74 | Ga0070681_10002559 | 3300005458 | Bacteria | 16698 |
| 75 | Ga0070685_10213857 | 3300005466 | Bacteria | 1260 |
| 76 | Ga0070679_100002918 | 3300005530 | Bacteria | 15548 |
| 77 | Ga0068853_100004517 | 3300005539 | Bacteria | 10796 |
| 78 | Ga0068853_100011119 | 3300005539 | Bacteria | 7302 |
| 79 | Ga0070686_100005718 | 3300005544 | Bacteria | 6890 |
| 80 | Ga0070695_100038851 | 3300005545 | Bacteria | 3006 |
| 81 | Ga0070693_100094935 | 3300005547 | Bacteria | 1805 |
| 82 | Ga0070665_100086639 | 3300005548 | Bacteria | 3137 |
| 83 | Ga0068855_100338899 | 3300005563 | Bacteria | 1658 |
| 84 | Ga0070664_100413444 | 3300005564 | Bacteria | 1234 |
| 85 | Ga0068856_100219240 | 3300005614 | Bacteria | 1918 |
| 86 | Ga0068856_100329245 | 3300005614 | Bacteria | 1545 |
| 87 | Ga0070702_100064864 | 3300005615 | Bacteria | 2137 |
| 88 | Ga0068859_100011998 | 3300005617 | Bacteria | 8703 |
| 89 | Ga0068859_100066707 | 3300005617 | Bacteria | 3634 |
| 90 | Ga0068859_100191158 | 3300005617 | Bacteria | 2131 |
| 91 | Ga0068859_100337589 | 3300005617 | Bacteria | 1601 |
| 92 | Ga0068864_100004227 | 3300005618 | Bacteria | 11819 |
| 93 | Ga0068864_100077853 | 3300005618 | Bacteria | 2901 |
| 94 | Ga0068864_100722411 | 3300005618 | Bacteria | 974 |
| 95 | Ga0068861_100023338 | 3300005719 | Bacteria | 4461 |
| 96 | Ga0068851_10000273 | 3300005834 | Bacteria | 23911 |
| 97 | Ga0068851_10130711 | 3300005834 | Bacteria | 1357 |
| 98 | Ga0068863_100074738 | 3300005841 | Bacteria | 3206 |
| 99 | Ga0068863_100146645 | 3300005841 | Bacteria | 2257 |
| 100 | Ga0068863_100212496 | 3300005841 | Bacteria | 1863 |
| 101 | Ga0068858_100000285 | 3300005842 | Bacteria | 54696 |
| 102 | Ga0068858_100641629 | 3300005842 | Bacteria | 1032 |
| 103 | Ga0068860_100013959 | 3300005843 | Bacteria | 7875 |
| 104 | Ga0068860_100290602 | 3300005843 | Bacteria | 1599 |
| 105 | Ga0068862_100015829 | 3300005844 | Bacteria | 6265 |
| 106 | Ga0070717_10075228 | 3300006028 | Bacteria | 2824 |
| 107 | Ga0070716_100030938 | 3300006173 | Bacteria | 2909 |
| 108 | Ga0070712_100078925 | 3300006175 | Bacteria | 2378 |
| 109 | Ga0075366_10216863 | 3300006195 | Bacteria | 1166 |
| 110 | Ga0075370_10053546 | 3300006353 | Bacteria | 2290 |
| 111 | Ga0075430_100716792 | 3300006846 | Bacteria | 825 |
| 112 | Ga0068865_100430416 | 3300006881 | Bacteria | 1087 |
| 113 | Ga0097620_100011997 | 3300006931 | Bacteria | 8703 |
| 114 | Ga0097620_100066707 | 3300006931 | Bacteria | 3634 |
| 115 | Ga0097620_100191154 | 3300006931 | Bacteria | 2131 |
| 116 | Ga0097620_100337598 | 3300006931 | Bacteria | 1601 |
| 117 | Ga0079104_1001829 | 3300006946 | Bacteria | 13058 |
| 118 | Ga0105251_10046423 | 3300009011 | Bacteria | 2090 |
| 119 | Ga0105251_10083766 | 3300009011 | Bacteria | 1472 |
| 120 | Ga0105244_10003158 | 3300009036 | Bacteria | 11966 |
| 121 | Ga0105244_10004629 | 3300009036 | Bacteria | 9410 |
| 122 | Ga0105244_10006440 | 3300009036 | Bacteria | 7599 |
| 123 | Ga0105250_10000065 | 3300009092 | Bacteria | 100401 |
| 124 | Ga0105250_10019596 | 3300009092 | Bacteria | 2735 |
| 125 | Ga0105250_10048309 | 3300009092 | Bacteria | 1707 |
| 126 | Ga0105250_10066784 | 3300009092 | Bacteria | 1451 |
| 127 | Ga0105240_10005720 | 3300009093 | Bacteria | 18444 |
| 128 | Ga0105240_10203804 | 3300009093 | Bacteria | 2317 |
| 129 | Ga0111539_10003810 | 3300009094 | Bacteria | 19845 |
| 130 | Ga0105245_10026508 | 3300009098 | Bacteria | 5102 |
| 131 | Ga0105247_10000072 | 3300009101 | Bacteria | 113959 |
| 132 | Ga0105243_10054928 | 3300009148 | Bacteria | 3163 |
| 133 | Ga0105241_10189101 | 3300009174 | Bacteria | 1713 |
| 134 | Ga0105242_10027447 | 3300009176 | Bacteria | 4520 |
| 135 | Ga0105248_10006780 | 3300009177 | Bacteria | 12559 |
| 136 | Ga0105248_10213409 | 3300009177 | Bacteria | 2174 |
| 137 | Ga0105248_10217977 | 3300009177 | Bacteria | 2149 |
| 138 | Ga0105248_10453804 | 3300009177 | Bacteria | 1444 |
| 139 | Ga0105248_10753077 | 3300009177 | Bacteria | 1099 |
| 140 | Ga0105237_10006481 | 3300009545 | Bacteria | 12973 |
| 141 | Ga0105238_10009396 | 3300009551 | Bacteria | 9788 |
| 142 | Ga0105238_10136319 | 3300009551 | Bacteria | 2432 |
| 143 | Ga0105249_10010344 | 3300009553 | Bacteria | 8200 |
| 144 | Ga0105239_10036491 | 3300010375 | Bacteria | 5397 |
| 145 | Ga0105246_10008968 | 3300011119 | Bacteria | 6158 |
| 146 | Ga0105246_10020533 | 3300011119 | Bacteria | 4238 |
| 147 | Ga0157347_1000303 | 3300012502 | Bacteria | 2979 |
| 148 | Ga0157373_10007991 | 3300013100 | Bacteria | 7866 |
| 149 | Ga0157373_10011875 | 3300013100 | Bacteria | 6399 |
| 150 | Ga0157373_10015556 | 3300013100 | Bacteria | 5561 |
| 151 | Ga0157373_10033171 | 3300013100 | Bacteria | 3716 |
| 152 | Ga0157373_10178490 | 3300013100 | Bacteria | 1495 |
| 153 | Ga0157371_10361141 | 3300013102 | Bacteria | 1058 |
| 154 | Ga0157370_10220155 | 3300013104 | Bacteria | 1758 |
| 155 | Ga0157369_10007939 | 3300013105 | Bacteria | 12204 |
| 156 | Ga0157369_10010059 | 3300013105 | Bacteria | 10800 |
| 157 | Ga0157369_10025471 | 3300013105 | Bacteria | 6568 |
| 158 | Ga0157369_10296179 | 3300013105 | Bacteria | 1683 |
| 159 | Ga0157374_10333844 | 3300013296 | Bacteria | 1504 |
| 160 | Ga0163162_10009132 | 3300013306 | Bacteria | 9642 |
| 161 | Ga0163162_10032279 | 3300013306 | Bacteria | 5200 |
| 162 | Ga0163162_10067823 | 3300013306 | Bacteria | 3618 |
| 163 | Ga0157372_10043193 | 3300013307 | Bacteria | 4990 |
| 164 | Ga0157375_10000888 | 3300013308 | Bacteria | 25930 |
| 165 | Ga0157375_10050889 | 3300013308 | Bacteria | 4065 |
| 166 | Ga0157375_10319742 | 3300013308 | Bacteria | 1716 |
| 167 | Ga0163163_10028581 | 3300014325 | Bacteria | 5357 |
| 168 | Ga0182008_10001274 | 3300014497 | Bacteria | 17277 |
| 169 | Ga0182008_10001882 | 3300014497 | Bacteria | 13645 |
| 170 | Ga0182008_10050488 | 3300014497 | Bacteria | 2065 |
| 171 | Ga0182006_1008795 | 3300015261 | Bacteria | 4565 |
| 172 | Ga0182006_1013376 | 3300015261 | Bacteria | 3563 |
| 173 | Ga0182007_10001259 | 3300015262 | Bacteria | 13769 |
| 174 | Ga0163161_10009764 | 3300017792 | Bacteria | 6651 |
| 175 | Ga0163161_10011374 | 3300017792 | Bacteria | 6171 |
| 176 | Ga0163161_10042828 | 3300017792 | Bacteria | 3258 |
| 177 | Ga0163161_10056011 | 3300017792 | Bacteria | 2863 |
| 178 | Ga0213872_10000323 | 3300021361 | Bacteria | 40600 |
| 179 | Ga0213872_10003505 | 3300021361 | Bacteria | 8674 |
| 180 | Ga0213872_10028707 | 3300021361 | Bacteria | 2551 |
| 181 | Ga0209435_100289 | 3300025206 | Bacteria | 12211 |
| 182 | Ga0209435_102782 | 3300025206 | Bacteria | 2025 |
| 183 | Ga0209436_105020 | 3300025208 | Bacteria | 3142 |
| 184 | Ga0209784_100116 | 3300025224 | Bacteria | 87164 |
| 185 | Ga0209566_100141 | 3300025225 | Bacteria | 87164 |
| 186 | Ga0209674_100110 | 3300025226 | Bacteria | 149245 |
| 187 | Ga0209674_100162 | 3300025226 | Bacteria | 87164 |
| 188 | Ga0209147_100170 | 3300025229 | Bacteria | 87164 |
| 189 | Ga0209563_100138 | 3300025230 | Bacteria | 87164 |
| 190 | Ga0209437_100456 | 3300025233 | Bacteria | 32812 |
| 191 | Ga0209437_109956 | 3300025233 | Bacteria | 1467 |
| 192 | Ga0209258_100287 | 3300025242 | Bacteria | 82980 |
| 193 | Ga0207425_1000318 | 3300025245 | Bacteria | 34531 |
| 194 | Ga0207425_1006488 | 3300025245 | Bacteria | 3196 |
| 195 | Ga0209646_1000052 | 3300025246 | Bacteria | 286370 |
| 196 | Ga0209646_1000239 | 3300025246 | Bacteria | 57211 |
| 197 | Ga0209026_1003815 | 3300025250 | Bacteria | 4758 |
| 198 | Ga0209677_100111 | 3300025253 | Bacteria | 87164 |
| 199 | Ga0209759_1000128 | 3300025256 | Bacteria | 132419 |
| 200 | Ga0209759_1000253 | 3300025256 | Bacteria | 79223 |
| 201 | Ga0209129_1004938 | 3300025258 | Bacteria | 4957 |
| 202 | Ga0209233_1002480 | 3300025261 | Bacteria | 6758 |
| 203 | Ga0209565_1000009 | 3300025263 | Bacteria | 751701 |
| 204 | Ga0209565_1000461 | 3300025263 | Bacteria | 31259 |
| 205 | Ga0209565_1000570 | 3300025263 | Bacteria | 25143 |
| 206 | Ga0209455_1000037 | 3300025272 | Bacteria | 464097 |
| 207 | Ga0209673_1000036 | 3300025273 | Bacteria | 323162 |
| 208 | Ga0209673_1000260 | 3300025273 | Bacteria | 99762 |
| 209 | Ga0209673_1006964 | 3300025273 | Bacteria | 5334 |
| 210 | Ga0209130_1002311 | 3300025284 | Bacteria | 9744 |
| 211 | Ga0209675_1000013 | 3300025291 | Bacteria | 448220 |
| 212 | Ga0209675_1001088 | 3300025291 | Bacteria | 16712 |
| 213 | Ga0209676_1000004 | 3300025292 | Bacteria | 1138360 |
| 214 | Ga0209676_1047066 | 3300025292 | Bacteria | 1162 |
| 215 | Ga0209025_1000096 | 3300025294 | Bacteria | 239153 |
| 216 | Ga0209025_1003816 | 3300025294 | Bacteria | 13763 |
| 217 | Ga0209025_1004142 | 3300025294 | Bacteria | 12875 |
| 218 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 219 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 220 | Ga0209564_1000122 | 3300025295 | Bacteria | 203709 |
| 221 | Ga0209564_1000267 | 3300025295 | Bacteria | 109962 |
| 222 | Ga0209758_1000675 | 3300025297 | Bacteria | 50917 |
| 223 | Ga0209758_1005265 | 3300025297 | Bacteria | 10117 |
| 224 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 225 | Ga0209256_1000106 | 3300025299 | Bacteria | 187258 |
| 226 | Ga0209256_1000222 | 3300025299 | Bacteria | 105596 |
| 227 | Ga0209256_1000398 | 3300025299 | Bacteria | 68796 |
| 228 | Ga0209256_1020242 | 3300025299 | Bacteria | 2084 |
| 229 | Ga0207426_1002483 | 3300025302 | Bacteria | 11731 |
| 230 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 231 | Ga0209051_1008225 | 3300025303 | Bacteria | 5556 |
| 232 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 233 | Ga0207656_10000028 | 3300025321 | Bacteria | 76155 |
| 234 | Ga0207696_1000081 | 3300025711 | Bacteria | 198887 |
| 235 | Ga0207696_1001871 | 3300025711 | Bacteria | 10785 |
| 236 | Ga0207696_1013317 | 3300025711 | Bacteria | 2872 |
| 237 | Ga0207696_1022599 | 3300025711 | Bacteria | 1995 |
| 238 | Ga0207696_1045450 | 3300025711 | Bacteria | 1270 |
| 239 | Ga0207655_1005785 | 3300025728 | Bacteria | 8329 |
| 240 | Ga0207655_1021497 | 3300025728 | Bacteria | 3273 |
| 241 | Ga0207713_1002126 | 3300025735 | Bacteria | 14767 |
| 242 | Ga0207713_1008105 | 3300025735 | Bacteria | 6094 |
| 243 | Ga0207710_10000303 | 3300025900 | Bacteria | 39280 |
| 244 | Ga0207680_10155200 | 3300025903 | Bacteria | 1530 |
| 245 | Ga0207699_10000379 | 3300025906 | Bacteria | 23393 |
| 246 | Ga0207705_10316721 | 3300025909 | Bacteria | 1198 |
| 247 | Ga0207707_10005932 | 3300025912 | Bacteria | 10689 |
| 248 | Ga0207695_10028726 | 3300025913 | Bacteria | 6157 |
| 249 | Ga0207695_10032198 | 3300025913 | Bacteria | 5741 |
| 250 | Ga0207671_10678940 | 3300025914 | Bacteria | 820 |
| 251 | Ga0207693_10013170 | 3300025915 | Bacteria | 6671 |
| 252 | Ga0207657_10000014 | 3300025919 | Bacteria | 175779 |
| 253 | Ga0207657_10015620 | 3300025919 | Bacteria | 7346 |
| 254 | Ga0207657_10139180 | 3300025919 | Bacteria | 1984 |
| 255 | Ga0207649_10409556 | 3300025920 | Bacteria | 1016 |
| 256 | Ga0207652_10005287 | 3300025921 | Bacteria | 10478 |
| 257 | Ga0207681_10000892 | 3300025923 | Bacteria | 19489 |
| 258 | Ga0207694_10038314 | 3300025924 | Bacteria | 3686 |
| 259 | Ga0207694_10082776 | 3300025924 | Bacteria | 2523 |
| 260 | Ga0207694_10171502 | 3300025924 | Bacteria | 1757 |
| 261 | Ga0207650_10000086 | 3300025925 | Bacteria | 123722 |
| 262 | Ga0207650_10000732 | 3300025925 | Bacteria | 25329 |
| 263 | Ga0207650_10019476 | 3300025925 | Bacteria | 4768 |
| 264 | Ga0207650_10081053 | 3300025925 | Bacteria | 2461 |
| 265 | Ga0207687_10228928 | 3300025927 | Bacteria | 1468 |
| 266 | Ga0207700_10029114 | 3300025928 | Bacteria | 3894 |
| 267 | Ga0207664_10009594 | 3300025929 | Bacteria | 6800 |
| 268 | Ga0207644_10013499 | 3300025931 | Bacteria | 5448 |
| 269 | Ga0207690_10000023 | 3300025932 | Bacteria | 196155 |
| 270 | Ga0207690_10480885 | 3300025932 | Bacteria | 1002 |
| 271 | Ga0207706_10000172 | 3300025933 | Bacteria | 72049 |
| 272 | Ga0207670_10006847 | 3300025936 | Bacteria | 6343 |
| 273 | Ga0207711_10069809 | 3300025941 | Bacteria | 3047 |
| 274 | Ga0207711_10083605 | 3300025941 | Bacteria | 2793 |
| 275 | Ga0207711_10141823 | 3300025941 | Bacteria | 2163 |
| 276 | Ga0207667_10010259 | 3300025949 | Bacteria | 10964 |
| 277 | Ga0207667_10360637 | 3300025949 | Bacteria | 1482 |
| 278 | Ga0207712_10016272 | 3300025961 | Bacteria | 4812 |
| 279 | Ga0207658_10050361 | 3300025986 | Bacteria | 3064 |
| 280 | Ga0207658_10050849 | 3300025986 | Bacteria | 3051 |
| 281 | Ga0207658_10228913 | 3300025986 | Bacteria | 1568 |
| 282 | Ga0207677_10021826 | 3300026023 | Bacteria | 3922 |
| 283 | Ga0207703_10001441 | 3300026035 | Bacteria | 21708 |
| 284 | Ga0207703_10259991 | 3300026035 | Bacteria | 1569 |
| 285 | Ga0207639_10017658 | 3300026041 | Bacteria | 5059 |
| 286 | Ga0207639_10026033 | 3300026041 | Bacteria | 4248 |
| 287 | Ga0207678_10025545 | 3300026067 | Bacteria | 5155 |
| 288 | Ga0207708_10274489 | 3300026075 | Bacteria | 1364 |
| 289 | Ga0207702_10259688 | 3300026078 | Bacteria | 1635 |
| 290 | Ga0207641_10011245 | 3300026088 | Bacteria | 7341 |
| 291 | Ga0207641_10012333 | 3300026088 | Bacteria | 7012 |
| 292 | Ga0207676_10098533 | 3300026095 | Bacteria | 2417 |
| 293 | Ga0207676_10131418 | 3300026095 | Bacteria | 2129 |
| 294 | Ga0207674_10138887 | 3300026116 | Bacteria | 2391 |
| 295 | Ga0207674_10784179 | 3300026116 | Bacteria | 920 |
| 296 | Ga0207675_100009401 | 3300026118 | Bacteria | 9160 |
| 297 | Ga0207698_10153986 | 3300026142 | Bacteria | 2000 |
| 298 | Ga0209281_1000008 | 3300027111 | Bacteria | 867470 |
| 299 | Ga0207428_10034074 | 3300027907 | Bacteria | 4176 |
| 300 | Ga0268266_10030215 | 3300028379 | Bacteria | 4604 |
| 301 | Ga0268265_10014914 | 3300028380 | Bacteria | 5305 |
| 302 | Ga0268265_10127672 | 3300028380 | Bacteria | 2108 |
| 303 | Ga0268264_10158134 | 3300028381 | Bacteria | 2038 |
| 304 | Ga0268264_10213008 | 3300028381 | Bacteria | 1774 |
| 305 | Ga0307517_10083751 | 3300028786 | Bacteria | 2692 |
| 306 | Ga0307515_10000049 | 3300028794 | Bacteria | 278611 |
| 307 | Ga0307515_10179926 | 3300028794 | Bacteria | 2069 |
| 308 | Ga0307511_10044168 | 3300030521 | Bacteria | 3707 |
| 309 | Ga0307509_10343109 | 3300031507 | Bacteria | 1220 |
| 310 | Ga0307408_100002456 | 3300031548 | Bacteria | 13003 |
| 311 | Ga0265314_10122879 | 3300031711 | Bacteria | 1631 |
| 312 | Ga0307405_10004623 | 3300031731 | Bacteria | 6532 |
| 313 | Ga0307416_100236177 | 3300032002 | Bacteria | 1767 |
| 314 | Ga0307416_100293228 | 3300032002 | Bacteria | 1612 |
| 315 | Ga0307415_100148894 | 3300032126 | Bacteria | 1799 |
| 316 | Ga0307510_10000013 | 3300033180 | Bacteria | 274569 |
| 317 | Ga0373960_0000337 | 3300035121 | Bacteria | 8991 |
| 318 | Ga0373931_0015579 | 3300035691 | Bacteria | 3731 |
| 319 | Ga0373937_0201026 | 3300036401 | Bacteria | 1873 |
| 320 | Ga0395905_0002838 | 3300037471 | Bacteria | 18978 |
| 321 | Ga0400483_108130 | 3300039062 | Bacteria | 3601 |
| 322 | Ga0400483_277780 | 3300039062 | Bacteria | 6006 |
| 323 | Ga0400483_286606 | 3300039062 | Bacteria | 2924 |
| 324 | Ga0436361_0104721 | 3300039447 | Bacteria | 28445 |
| 325 | Ga0436361_0470493 | 3300039447 | Bacteria | 2893 |
| 326 | Ga0436361_0488174 | 3300039447 | Bacteria | 24593 |
| 327 | Ga0436361_0602168 | 3300039447 | Bacteria | 35623 |
| 328 | Ga0436361_1047176 | 3300039447 | Bacteria | 7133 |
| 329 | Ga0436361_1223139 | 3300039447 | Bacteria | 18884 |
| 330 | Ga0436363_0918195 | 3300039450 | Bacteria | 1470 |
| 331 | Ga0439466_0024026 | 3300041411 | Bacteria | 2140 |
| 332 | Ga0439431_0038124 | 3300041997 | Bacteria | 1215 |
| 333 | Ga0439432_000008 | 3300042006 | Bacteria | 89915 |
| 334 | Ga0450911_000366 | 3300042115 | Bacteria | 15046 |
| 335 | Ga0450890_007679 | 3300042127 | Bacteria | 1379 |
| 336 | Ga0450904_000031 | 3300042139 | Bacteria | 31326 |
| 337 | Ga0450905_018750 | 3300042142 | Bacteria | 1010 |
| 338 | Ga0439446_0050007 | 3300042156 | Bacteria | 1247 |
| 339 | Ga0439459_0000672 | 3300042438 | Bacteria | 4661 |
| 340 | Ga0466972_0018830 | 3300044658 | Bacteria | 3451 |
| 341 | Ga0495627_007626 | 3300046453 | Bacteria | 4131 |
| 342 | Ga0495603_0130388 | 3300046455 | Bacteria | 1464 |
| 343 | Ga0495590_0000008 | 3300046457 | Bacteria | 330520 |
| 344 | Ga0495591_002224 | 3300046458 | Bacteria | 11066 |
| 345 | Ga0495629_0009959 | 3300046459 | Bacteria | 6938 |
| 346 | Ga0495629_0090526 | 3300046459 | Bacteria | 2134 |
| 347 | Ga0495638_0002309 | 3300046460 | Bacteria | 15708 |
| 348 | Ga0495653_0013580 | 3300046463 | Bacteria | 6637 |
| 349 | Ga0495653_0042708 | 3300046463 | Bacteria | 3528 |
| 350 | Ga0495650_0000161 | 3300046471 | Bacteria | 149996 |
| 351 | Ga0495650_0000239 | 3300046471 | Bacteria | 109891 |
| 352 | Ga0495650_0017036 | 3300046471 | Bacteria | 3655 |
| 353 | Ga0495580_0296961 | 3300046472 | Bacteria | 1100 |
| 354 | Ga0495580_0428628 | 3300046472 | Bacteria | 889 |
| 355 | Ga0495582_0010242 | 3300046473 | Bacteria | 5162 |
| 356 | Ga0495582_0033315 | 3300046473 | Bacteria | 2832 |
| 357 | Ga0495605_0000921 | 3300046474 | Bacteria | 20179 |
| 358 | Ga0495605_0017045 | 3300046474 | Bacteria | 3922 |
| 359 | Ga0495639_0070025 | 3300046475 | Bacteria | 1619 |
| 360 | Ga0495584_0022440 | 3300046491 | Bacteria | 3203 |
| 361 | Ga0495584_0227752 | 3300046491 | Bacteria | 947 |
| 362 | Ga0495584_0272300 | 3300046491 | Bacteria | 861 |
| 363 | Ga0495585_0010191 | 3300046492 | Bacteria | 5611 |
| 364 | Ga0495585_0063604 | 3300046492 | Bacteria | 2024 |
| 365 | Ga0495594_0080073 | 3300046499 | Bacteria | 1823 |
| 366 | Ga0495594_0109332 | 3300046499 | Bacteria | 1558 |
| 367 | Ga0495594_0122781 | 3300046499 | Bacteria | 1468 |
| 368 | Ga0495596_0003871 | 3300046500 | Bacteria | 7428 |
| 369 | Ga0495596_0006209 | 3300046500 | Bacteria | 5530 |
| 370 | Ga0495607_0000561 | 3300046501 | Bacteria | 36225 |
| 371 | Ga0495607_0003529 | 3300046501 | Bacteria | 11920 |
| 372 | Ga0495607_0030932 | 3300046501 | Bacteria | 3280 |
| 373 | Ga0495607_0059146 | 3300046501 | Bacteria | 2187 |
| 374 | Ga0495583_0000160 | 3300046506 | Bacteria | 113560 |
| 375 | Ga0495583_0000544 | 3300046506 | Bacteria | 53022 |
| 376 | Ga0495583_0002756 | 3300046506 | Bacteria | 14514 |
| 377 | Ga0495606_0016874 | 3300046507 | Bacteria | 5545 |
| 378 | Ga0495606_0022629 | 3300046507 | Bacteria | 4572 |
| 379 | Ga0495606_0034545 | 3300046507 | Bacteria | 3470 |
| 380 | Ga0495610_0003073 | 3300046512 | Bacteria | 13334 |
| 381 | Ga0495610_0004990 | 3300046512 | Bacteria | 9609 |
| 382 | Ga0495610_0016181 | 3300046512 | Bacteria | 4306 |
| 383 | Ga0495610_0032603 | 3300046512 | Bacteria | 2704 |
| 384 | Ga0495610_0088208 | 3300046512 | Bacteria | 1410 |
| 385 | Ga0495616_0002763 | 3300046513 | Bacteria | 11483 |
| 386 | Ga0495616_0019465 | 3300046513 | Bacteria | 3704 |
| 387 | Ga0495620_0000442 | 3300046515 | Bacteria | 27759 |
| 388 | Ga0495620_0007504 | 3300046515 | Bacteria | 5914 |
| 389 | Ga0495628_0125633 | 3300046516 | Bacteria | 1965 |
| 390 | Ga0495631_0002610 | 3300046518 | Bacteria | 10070 |
| 391 | Ga0495631_0002645 | 3300046518 | Bacteria | 9996 |
| 392 | Ga0495631_0051043 | 3300046518 | Bacteria | 1807 |
| 393 | Ga0495631_0129907 | 3300046518 | Bacteria | 1082 |
| 394 | Ga0495632_0000621 | 3300046519 | Bacteria | 32779 |
| 395 | Ga0495632_0001302 | 3300046519 | Bacteria | 21119 |
| 396 | Ga0495632_0007221 | 3300046519 | Bacteria | 7012 |
| 397 | Ga0495643_0000142 | 3300046522 | Bacteria | 115533 |
| 398 | Ga0495643_0001231 | 3300046522 | Bacteria | 24701 |
| 399 | Ga0495643_0041936 | 3300046522 | Bacteria | 2494 |
| 400 | Ga0495644_0003117 | 3300046523 | Bacteria | 6562 |
| 401 | Ga0495644_0050847 | 3300046523 | Bacteria | 1556 |
| 402 | Ga0495644_0053999 | 3300046523 | Bacteria | 1509 |
| 403 | Ga0495648_0000188 | 3300046524 | Bacteria | 71222 |
| 404 | Ga0495648_0108770 | 3300046524 | Bacteria | 1513 |
| 405 | Ga0495648_0121198 | 3300046524 | Bacteria | 1405 |
| 406 | Ga0495663_0011932 | 3300046525 | Bacteria | 2421 |
| 407 | Ga0495666_0003824 | 3300046526 | Bacteria | 7617 |
| 408 | Ga0495666_0012332 | 3300046526 | Bacteria | 4261 |
| 409 | Ga0495642_0002438 | 3300046528 | Bacteria | 7573 |
| 410 | Ga0495642_0003247 | 3300046528 | Bacteria | 6437 |
| 411 | Ga0495642_0008182 | 3300046528 | Bacteria | 3999 |
| 412 | Ga0495642_0013991 | 3300046528 | Bacteria | 3108 |
| 413 | Ga0495642_0016015 | 3300046528 | Bacteria | 2919 |
| 414 | Ga0495652_0011549 | 3300046529 | Bacteria | 7984 |
| 415 | Ga0495654_0000813 | 3300046530 | Bacteria | 23840 |
| 416 | Ga0495654_0009048 | 3300046530 | Bacteria | 5467 |
| 417 | Ga0495654_0105266 | 3300046530 | Bacteria | 1293 |
| 418 | Ga0495665_0001605 | 3300046531 | Bacteria | 12096 |
| 419 | Ga0495665_0006890 | 3300046531 | Bacteria | 6134 |
| 420 | Ga0495665_0064220 | 3300046531 | Bacteria | 1937 |
| 421 | Ga0495586_0005366 | 3300046535 | Bacteria | 6854 |
| 422 | Ga0495586_0014722 | 3300046535 | Bacteria | 4156 |
| 423 | Ga0495587_0122881 | 3300046536 | Bacteria | 1486 |
| 424 | Ga0495609_0000269 | 3300046538 | Bacteria | 48750 |
| 425 | Ga0495609_0008841 | 3300046538 | Bacteria | 4902 |
| 426 | Ga0495597_0000908 | 3300046542 | Bacteria | 22977 |
| 427 | Ga0495597_0001319 | 3300046542 | Bacteria | 18169 |
| 428 | Ga0495597_0006885 | 3300046542 | Bacteria | 5834 |
| 429 | Ga0495597_0015954 | 3300046542 | Bacteria | 3551 |
| 430 | Ga0495645_0305518 | 3300046543 | Bacteria | 1038 |
| 431 | Ga0495622_0002221 | 3300046557 | Bacteria | 9459 |
| 432 | Ga0495622_0005278 | 3300046557 | Bacteria | 5993 |
| 433 | Ga0495622_0164441 | 3300046557 | Bacteria | 1000 |
| 434 | Ga0495633_0020687 | 3300046558 | Bacteria | 3304 |
| 435 | Ga0495633_0047928 | 3300046558 | Bacteria | 2018 |
| 436 | Ga0495633_0107383 | 3300046558 | Bacteria | 1294 |
| 437 | Ga0495667_0202782 | 3300046559 | Bacteria | 1269 |
| 438 | Ga0495656_0003837 | 3300046615 | Bacteria | 5110 |
| 439 | Ga0495656_0009410 | 3300046615 | Bacteria | 3512 |
| 440 | Ga0495656_0170685 | 3300046615 | Bacteria | 1063 |
| 441 | Ga0495668_0005378 | 3300046616 | Bacteria | 8709 |
| 442 | Ga0495668_0022791 | 3300046616 | Bacteria | 3577 |
| 443 | Ga0495668_0031556 | 3300046616 | Bacteria | 2985 |
| 444 | Ga0495634_0011374 | 3300046642 | Bacteria | 6483 |
| 445 | Ga0495611_0009405 | 3300046648 | Bacteria | 4130 |
| 446 | Ga0495611_0020658 | 3300046648 | Bacteria | 2836 |
| 447 | Ga0495611_0051781 | 3300046648 | Bacteria | 1851 |
| 448 | Ga0495611_0235299 | 3300046648 | Bacteria | 850 |
| 449 | Ga0495625_0001214 | 3300046660 | Bacteria | 32679 |
| 450 | Ga0495625_0003510 | 3300046660 | Bacteria | 15538 |
| 451 | Ga0495625_0039690 | 3300046660 | Bacteria | 3436 |
| 452 | Ga0495625_0266604 | 3300046660 | Bacteria | 1107 |
| 453 | Ga0495635_0143014 | 3300046663 | Bacteria | 1629 |
| 454 | Ga0495661_0000817 | 3300046665 | Bacteria | 29232 |
| 455 | Ga0495661_0006103 | 3300046665 | Bacteria | 8490 |
| 456 | Ga0495661_0012970 | 3300046665 | Bacteria | 5613 |
| 457 | Ga0495661_0132127 | 3300046665 | Bacteria | 1367 |
| 458 | Ga0495661_0214803 | 3300046665 | Bacteria | 999 |
| 459 | Ga0495588_0106086 | 3300046674 | Bacteria | 1478 |
| 460 | Ga0495588_0179565 | 3300046674 | Bacteria | 1118 |
| 461 | Ga0495588_0247380 | 3300046674 | Bacteria | 940 |
| 462 | Ga0495623_0031373 | 3300046679 | Bacteria | 3416 |
| 463 | Ga0495623_0110862 | 3300046679 | Bacteria | 1663 |
| 464 | Ga0495623_0122597 | 3300046679 | Bacteria | 1563 |
| 465 | Ga0495669_0008797 | 3300046684 | Bacteria | 4253 |
| 466 | Ga0495669_0070195 | 3300046684 | Bacteria | 1595 |
| 467 | Ga0495613_0053494 | 3300046689 | Bacteria | 2971 |
| 468 | Ga0495670_0011246 | 3300046691 | Bacteria | 4400 |
| 469 | Ga0495670_0031347 | 3300046691 | Bacteria | 2641 |
| 470 | Ga0495670_0158476 | 3300046691 | Bacteria | 1188 |
| 471 | Ga0495671_0012871 | 3300046692 | Bacteria | 4554 |
| 472 | Ga0495649_0000028 | 3300046694 | Bacteria | 163229 |
| 473 | Ga0495649_0003341 | 3300046694 | Bacteria | 10885 |
| 474 | Ga0495649_0005820 | 3300046694 | Bacteria | 7761 |
| 475 | Ga0495589_0000657 | 3300046794 | Bacteria | 22640 |
| 476 | Ga0495589_0003182 | 3300046794 | Bacteria | 8968 |
| 477 | Ga0495589_0008613 | 3300046794 | Bacteria | 5319 |
| 478 | Ga0495589_0055905 | 3300046794 | Bacteria | 1943 |
| 479 | Ga0495589_0122299 | 3300046794 | Bacteria | 1253 |
| 480 | Ga0495660_0005279 | 3300046810 | Bacteria | 7745 |
| 481 | Ga0495660_0005568 | 3300046810 | Bacteria | 7537 |
| 482 | Ga0495581_0004376 | 3300047315 | Bacteria | 8161 |
| 483 | Ga0495581_0026792 | 3300047315 | Bacteria | 3341 |
| 484 | Ga0495604_0017445 | 3300047317 | Bacteria | 5746 |
| 485 | Ga0495604_0065370 | 3300047317 | Bacteria | 2769 |
| 486 | Ga0495674_0006932 | 3300047319 | Bacteria | 10836 |
| 487 | Ga0495672_0000189 | 3300047320 | Bacteria | 89175 |
| 488 | Ga0495672_0001634 | 3300047320 | Bacteria | 21817 |
| 489 | Ga0495672_0082896 | 3300047320 | Bacteria | 1782 |
| 490 | Ga0495672_0104572 | 3300047320 | Bacteria | 1529 |
| 491 | Ga0495676_0000017 | 3300047321 | Bacteria | 181815 |
| 492 | Ga0495676_0071133 | 3300047321 | Bacteria | 2675 |
| 493 | Ga0495676_0198705 | 3300047321 | Bacteria | 1394 |
| 494 | Ga0495683_0004154 | 3300047323 | Bacteria | 8285 |
| 495 | Ga0495683_0179020 | 3300047323 | Bacteria | 969 |
| 496 | Ga0495675_0012620 | 3300047444 | Bacteria | 5317 |
| 497 | Ga0495677_0006940 | 3300047445 | Bacteria | 4253 |
| 498 | Ga0495677_0010213 | 3300047445 | Bacteria | 3451 |
| 499 | Ga0495679_000699 | 3300047446 | Bacteria | 21818 |
| 500 | Ga0495679_009218 | 3300047446 | Bacteria | 3964 |
| 501 | Ga0495681_0003295 | 3300047470 | Bacteria | 11254 |
| 502 | Ga0495681_0004009 | 3300047470 | Bacteria | 10130 |
| 503 | Ga0495681_0022031 | 3300047470 | Bacteria | 3418 |
| 504 | Ga0495686_0000076 | 3300047472 | Bacteria | 206039 |
| 505 | Ga0495593_0070071 | 3300047673 | Bacteria | 1822 |
| 506 | Ga0495602_0108551 | 3300048088 | Bacteria | 2259 |
| 507 | Ga0495614_0012640 | 3300048089 | Bacteria | 3702 |
| 508 | Ga0495614_0036870 | 3300048089 | Bacteria | 2098 |
| 509 | Ga0495626_0004982 | 3300048091 | Bacteria | 7951 |
| 510 | Ga0495626_0026298 | 3300048091 | Bacteria | 2838 |
| 511 | Ga0496102_0009591 | 3300048905 | Bacteria | 8325 |
| 512 | Ga0496102_0044162 | 3300048905 | Bacteria | 4044 |
| 513 | Ga0496102_0425028 | 3300048905 | Bacteria | 1248 |
| 514 | Ga0496102_0812186 | 3300048905 | Bacteria | 857 |
| 515 | Ga0496103_0002329 | 3300048906 | Bacteria | 12004 |
| 516 | Ga0496104_0224418 | 3300048907 | Bacteria | 1791 |
| 517 | Ga0496107_0110786 | 3300048910 | Bacteria | 2017 |
| 518 | Ga0496112_0170695 | 3300048915 | Bacteria | 2140 |
| 519 | Ga0496115_0225156 | 3300048918 | Bacteria | 1547 |
| 520 | Ga0496115_0386130 | 3300048918 | Bacteria | 1138 |
| 521 | Ga0496116_0011501 | 3300048919 | Bacteria | 7316 |
| 522 | Ga0496116_0077358 | 3300048919 | Bacteria | 2079 |
| 523 | Ga0496117_0001169 | 3300048920 | Bacteria | 39465 |
| 524 | Ga0496117_0001494 | 3300048920 | Bacteria | 33517 |
| 525 | Ga0496117_0003096 | 3300048920 | Bacteria | 19916 |
| 526 | Ga0496117_0008511 | 3300048920 | Bacteria | 9730 |
| 527 | Ga0496117_0017465 | 3300048920 | Bacteria | 5990 |
| 528 | Ga0496118_0004011 | 3300048921 | Bacteria | 17911 |
| 529 | Ga0496118_0064556 | 3300048921 | Bacteria | 2685 |
| 530 | Ga0496118_0162404 | 3300048921 | Bacteria | 1379 |
| 531 | Ga0496119_0002476 | 3300048922 | Bacteria | 20252 |
| 532 | Ga0496120_0000115 | 3300048923 | Bacteria | 136364 |
| 533 | Ga0496120_0001738 | 3300048923 | Bacteria | 24768 |
| 534 | Ga0496120_0034298 | 3300048923 | Bacteria | 3041 |
| 535 | Ga0496121_0000808 | 3300048924 | Bacteria | 57011 |
| 536 | Ga0496121_0004158 | 3300048924 | Bacteria | 19793 |
| 537 | Ga0496121_0011779 | 3300048924 | Bacteria | 9645 |
| 538 | Ga0496121_0018162 | 3300048924 | Bacteria | 7110 |
| 539 | Ga0496121_0051608 | 3300048924 | Bacteria | 3462 |
| 540 | Ga0496121_0115813 | 3300048924 | Bacteria | 2034 |
| 541 | Ga0496121_0119273 | 3300048924 | Bacteria | 1995 |
| 542 | Ga0496121_0307926 | 3300048924 | Bacteria | 1072 |
| 543 | Ga0496122_0029677 | 3300048925 | Bacteria | 4604 |
| 544 | Ga0496122_0060371 | 3300048925 | Bacteria | 2793 |
| 545 | Ga0496122_0131758 | 3300048925 | Bacteria | 1586 |
| 546 | Ga0496123_0027588 | 3300048926 | Bacteria | 4225 |
| 547 | Ga0496123_0056828 | 3300048926 | Bacteria | 2553 |
| 548 | Ga0496124_0016672 | 3300048927 | Bacteria | 6970 |
| 549 | Ga0496124_0020425 | 3300048927 | Bacteria | 6119 |
| 550 | Ga0496124_0025805 | 3300048927 | Bacteria | 5312 |
| 551 | Ga0496124_0050080 | 3300048927 | Bacteria | 3560 |
| 552 | Ga0496125_0000126 | 3300048928 | Bacteria | 166246 |
| 553 | Ga0496125_0000236 | 3300048928 | Bacteria | 113354 |
| 554 | Ga0496125_0000256 | 3300048928 | Bacteria | 109696 |
| 555 | Ga0496125_0000775 | 3300048928 | Bacteria | 52219 |
| 556 | Ga0496125_0004735 | 3300048928 | Bacteria | 15510 |
| 557 | Ga0496125_0005065 | 3300048928 | Bacteria | 14855 |
| 558 | Ga0496125_0007863 | 3300048928 | Bacteria | 11268 |
| 559 | Ga0496125_0012759 | 3300048928 | Bacteria | 8308 |
| 560 | Ga0496125_0020759 | 3300048928 | Bacteria | 6156 |
| 561 | Ga0496125_0025048 | 3300048928 | Bacteria | 5474 |
| 562 | Ga0496125_0027433 | 3300048928 | Bacteria | 5160 |
| 563 | Ga0496125_0061939 | 3300048928 | Bacteria | 2996 |
| 564 | Ga0496125_0163576 | 3300048928 | Bacteria | 1507 |
| 565 | Ga0496126_0012108 | 3300048929 | Bacteria | 8855 |
| 566 | Ga0496126_0043734 | 3300048929 | Bacteria | 4129 |
| 567 | Ga0496126_0045038 | 3300048929 | Bacteria | 4058 |
| 568 | Ga0495678_000025 | 3300049459 | Bacteria | 227891 |
| 569 | Ga0495678_000402 | 3300049459 | Bacteria | 43680 |
| 570 | Ga0495678_005276 | 3300049459 | Bacteria | 7179 |
| 571 | Ga0501031_0074616 | 3300049568 | Bacteria | 2209 |
| 572 | Ga0501033_0388674 | 3300049570 | Bacteria | 974 |
| 573 | Ga0501038_0060044 | 3300049574 | Bacteria | 3255 |
| 574 | Ga0501047_0072612 | 3300049581 | Bacteria | 3312 |
| 575 | Ga0501048_0163807 | 3300049582 | Bacteria | 1574 |
| 576 | Ga0501070_0000047 | 3300049586 | Bacteria | 107704 |
| 577 | Ga0501223_000001 | 3300049663 | Bacteria | 156895 |
| 578 | Ga0501224_000003 | 3300049664 | Bacteria | 189031 |
| 579 | Ga0501233_000030 | 3300049668 | Bacteria | 18329 |
| 580 | Ga0501235_000182 | 3300049669 | Bacteria | 10992 |
| 581 | Ga0501225_0000001 | 3300049705 | Bacteria | 185804 |
| 582 | Ga0501234_000234 | 3300049707 | Bacteria | 8036 |
| 583 | Ga0501080_0000366 | 3300049742 | Bacteria | 34958 |
| 584 | Ga0501035_0018191 | 3300049822 | Bacteria | 6471 |
| 585 | Ga0501044_0000086 | 3300049823 | Bacteria | 114287 |
| 586 | Ga0501044_0001727 | 3300049823 | Bacteria | 25577 |
| 587 | Ga0501226_000007 | 3300049853 | Bacteria | 227827 |
| 588 | Ga0501226_000013 | 3300049853 | Bacteria | 175177 |
| 589 | nmdc:mga0k408_290689_c1 | 3300050493 | Bacteria | 975 |
| 590 | nmdc:mga08y16_39763_c1 | 3300050511 | Bacteria | 4933 |
| 591 | Ga0500594_0003057 | 3300053118 | Bacteria | 3663 |
| 592 | Ga0500617_177930 | 3300053124 | Bacteria | 808 |
| 593 | Ga0500642_0208756 | 3300053130 | Bacteria | 907 |
| 594 | Ga0500622_0000970 | 3300053156 | Bacteria | 24316 |
| 595 | Ga0500634_0003030 | 3300053161 | Bacteria | 7341 |
| 596 | Ga0500634_0106549 | 3300053161 | Bacteria | 1392 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048927 | Ga0496124_0020425 | Ga0496124_0020425_3479_4153 | 184 |
| 2 | 3300048928 | Ga0496125_0061939 | Ga0496125_0061939_613_1287 | 184 |
| 3 | 3300048929 | Ga0496126_0045038 | Ga0496126_0045038_1107_1781 | 184 |
| 4 | 3300042115 | Ga0450911_000366 | Ga0450911_000366_10226_10951 | 201 |
| 5 | 3300048924 | Ga0496121_0018162 | Ga0496121_0018162_2708_3433 | 201 |
| 6 | 3300048928 | Ga0496125_0007863 | Ga0496125_0007863_5614_6339 | 201 |
| 7 | 3300048928 | Ga0496125_0012759 | Ga0496125_0012759_6375_7106 | 202 |
| 8 | 3300005337 | Ga0070682_100480985 | Ga0070682_1004809851 | 223 |
| 9 | 3300005344 | Ga0070661_100116100 | Ga0070661_1001161003 | 223 |
| 10 | 3300005458 | Ga0070681_10002559 | Ga0070681_100025596 | 223 |
| 11 | 3300005530 | Ga0070679_100002918 | Ga0070679_1000029188 | 223 |
| 12 | 3300005539 | Ga0068853_100004517 | Ga0068853_1000045176 | 223 |
| 13 | 3300009174 | Ga0105241_10189101 | Ga0105241_101891013 | 223 |
| 14 | 3300013100 | Ga0157373_10033171 | Ga0157373_100331714 | 223 |
| 15 | 3300013307 | Ga0157372_10043193 | Ga0157372_100431933 | 223 |
| 16 | 3300025912 | Ga0207707_10005932 | Ga0207707_100059323 | 223 |
| 17 | 3300025921 | Ga0207652_10005287 | Ga0207652_100052876 | 223 |
| 18 | 3300026041 | Ga0207639_10017658 | Ga0207639_100176582 | 223 |
| 19 | 3300026116 | Ga0207674_10138887 | Ga0207674_101388873 | 223 |
| 20 | 3300039062 | Ga0400483_108130 | Ga0400483_108130_1872_2561 | 225 |
| 21 | 3300039062 | Ga0400483_286606 | Ga0400483_286606_839_1528 | 225 |
| 22 | 3300025728 | Ga0207655_1005785 | Ga0207655_10057853 | 226 |
| 23 | 3300048905 | Ga0496102_0812186 | Ga0496102_0812186_11_700 | 226 |
| 24 | iso_pu_bacteria | 2842711865 | 2842712150 | 226 |
| 25 | iso_pu_bacteria | 2515154123 | 2515690766 | 227 |
| 26 | iso_pu_bacteria | 2526164713 | 2527077033 | 227 |
| 27 | iso_pu_bacteria | 2547132103 | 2547372683 | 227 |
| 28 | iso_pu_bacteria | 2597489888 | 2597863278 | 227 |
| 29 | iso_pu_bacteria | 2597489889 | 2597869066 | 227 |
| 30 | iso_pu_bacteria | 2599185179 | 2599453769 | 227 |
| 31 | iso_pu_bacteria | 2599185189 | 2599510575 | 227 |
| 32 | iso_pu_bacteria | 2599185190 | 2599515873 | 227 |
| 33 | iso_pu_bacteria | 2599185288 | 2599883823 | 227 |
| 34 | iso_pu_bacteria | 2599185290 | 2599895251 | 227 |
| 35 | iso_pu_bacteria | 2599185303 | 2599951332 | 227 |
| 36 | iso_pu_bacteria | 2600255296 | 2601689088 | 227 |
| 37 | iso_pu_bacteria | 2619619299 | 2621300581 | 227 |
| 38 | iso_pu_bacteria | 2643221571 | 2643870324 | 227 |
| 39 | iso_pu_bacteria | 2643221592 | 2643968697 | 227 |
| 40 | iso_pu_bacteria | 2643221625 | 2644139488 | 227 |
| 41 | iso_pu_bacteria | 2643221638 | 2644216659 | 227 |
| 42 | iso_pu_bacteria | 2643221648 | 2644272302 | 227 |
| 43 | iso_pu_bacteria | 2643221713 | 2644622975 | 227 |
| 44 | iso_pu_bacteria | 2675903420 | 2677895941 | 227 |
| 45 | iso_pu_bacteria | 2721755607 | 2723248105 | 227 |
| 46 | iso_pu_bacteria | 2738541265 | 2738673245 | 227 |
| 47 | iso_pu_bacteria | 2738541282 | 2738751638 | 227 |
| 48 | iso_pu_bacteria | 2738541294 | 2738811814 | 227 |
| 49 | iso_pu_bacteria | 2738541303 | 2738860679 | 227 |
| 50 | iso_pu_bacteria | 2738541307 | 2738884603 | 227 |
| 51 | iso_pu_bacteria | 2738541309 | 2738899174 | 227 |
| 52 | iso_pu_bacteria | 2808606373 | 2808907294 | 227 |
| 53 | iso_pu_bacteria | 2808606385 | 2808978161 | 227 |
| 54 | iso_pu_bacteria | 2808606386 | 2808981947 | 227 |
| 55 | iso_pu_bacteria | 2808606388 | 2808993641 | 227 |
| 56 | iso_pu_bacteria | 2808606415 | 2809131570 | 227 |
| 57 | iso_pu_bacteria | 2808606419 | 2809151192 | 227 |
| 58 | iso_pu_bacteria | 2816332298 | 2817490161 | 227 |
| 59 | iso_pu_bacteria | 2818991446 | 2819600065 | 227 |
| 60 | iso_pu_bacteria | 2831265667 | 2831267630 | 227 |
| 61 | iso_pu_bacteria | 2831864461 | 2831866630 | 227 |
| 62 | iso_pu_bacteria | 2834028612 | 2834033940 | 227 |
| 63 | iso_pu_bacteria | 2838054893 | 2838056129 | 227 |
| 64 | iso_pu_bacteria | 2842826826 | 2842827813 | 227 |
| 65 | iso_pu_bacteria | 2842837860 | 2842839512 | 227 |
| 66 | iso_pu_bacteria | 2843690924 | 2843693678 | 227 |
| 67 | iso_pu_bacteria | 2852612431 | 2852618866 | 227 |
| 68 | iso_pu_bacteria | 2852618963 | 2852622526 | 227 |
| 69 | iso_pu_bacteria | 2852667396 | 2852673910 | 227 |
| 70 | iso_pu_bacteria | 2857547612 | 2857552689 | 227 |
| 71 | iso_pu_bacteria | 2857576091 | 2857577062 | 227 |
| 72 | iso_pu_bacteria | 2858688981 | 2858693709 | 227 |
| 73 | iso_pu_bacteria | 2860867994 | 2860869903 | 227 |
| 74 | iso_pu_bacteria | 2870068957 | 2870071471 | 227 |
| 75 | iso_pu_bacteria | 2904541872 | 2904546355 | 227 |
| 76 | iso_pu_bacteria | 2908446538 | 2908448898 | 227 |
| 77 | iso_pu_bacteria | 2917832318 | 2917836343 | 227 |
| 78 | iso_pu_bacteria | 2928037797 | 2928041616 | 227 |
| 79 | iso_pu_bacteria | 2928044640 | 2928049180 | 227 |
| 80 | iso_pu_bacteria | 2928051484 | 2928052212 | 227 |
| 81 | iso_pu_bacteria | 2928157003 | 2928160407 | 227 |
| 82 | iso_pu_bacteria | 2929189879 | 2929191880 | 227 |
| 83 | iso_pu_bacteria | 2931390751 | 2931393012 | 227 |
| 84 | iso_pu_bacteria | 2932422444 | 2932422613 | 227 |
| 85 | iso_pu_bacteria | 2945928738 | 2945934181 | 227 |
| 86 | iso_pu_bacteria | 2946006987 | 2946010825 | 227 |
| 87 | iso_pu_bacteria | 2946027586 | 2946030166 | 227 |
| 88 | iso_pu_bacteria | 2947233263 | 2947236755 | 227 |
| 89 | iso_pu_bacteria | 2981990288 | 2981996286 | 227 |
| 90 | iso_pu_bacteria | 3007872151 | 3007873054 | 227 |
| 91 | iso_pu_bacteria | 641736154 | 642420666 | 227 |
| 92 | iso_pu_bacteria | 8054285046 | 8054289069 | 227 |
| 93 | iso_pu_bacteria | 8054347763 | 8054351733 | 227 |
| 94 | iso_pu_bacteria | 8055817908 | 8055820130 | 227 |
| 95 | iso_pu_bacteria | 8056120720 | 8056122726 | 227 |
| 96 | iso_pu_bacteria | 8056137416 | 8056141059 | 227 |
| 97 | iso_pu_bacteria | 8056148874 | 8056153889 | 227 |
| 98 | iso_pu_bacteria | 8056161164 | 8056165300 | 227 |
| 99 | 3300005339 | Ga0070660_100004985 | Ga0070660_1000049857 | 229 |
| 100 | 3300025909 | Ga0207705_10316721 | Ga0207705_103167212 | 229 |
| 101 | 3300025919 | Ga0207657_10015620 | Ga0207657_100156207 | 229 |
| 102 | 3300039062 | Ga0400483_277780 | Ga0400483_277780_4313_5023 | 229 |
| 103 | 3300002705 | JGI25156J39149_1002008 | JGI25156J39149_10020085 | 230 |
| 104 | 3300002737 | JGI25162J39368_1005774 | JGI25162J39368_10057742 | 230 |
| 105 | 3300002738 | JGI25154J39366_1000208 | JGI25154J39366_100020810 | 230 |
| 106 | 3300005614 | Ga0068856_100329245 | Ga0068856_1003292452 | 230 |
| 107 | 3300009036 | Ga0105244_10004629 | Ga0105244_100046296 | 230 |
| 108 | 3300009093 | Ga0105240_10005720 | Ga0105240_1000572014 | 230 |
| 109 | 3300013308 | Ga0157375_10000888 | Ga0157375_1000088824 | 230 |
| 110 | 3300015261 | Ga0182006_1008795 | Ga0182006_10087952 | 230 |
| 111 | 3300025206 | Ga0209435_100289 | Ga0209435_10028910 | 230 |
| 112 | 3300025233 | Ga0209437_100456 | Ga0209437_1004566 | 230 |
| 113 | 3300025246 | Ga0209646_1000052 | Ga0209646_100005231 | 230 |
| 114 | 3300025256 | Ga0209759_1000253 | Ga0209759_100025360 | 230 |
| 115 | 3300025913 | Ga0207695_10028726 | Ga0207695_100287263 | 230 |
| 116 | 3300025949 | Ga0207667_10010259 | Ga0207667_100102596 | 230 |
| 117 | 3300025949 | Ga0207667_10360637 | Ga0207667_103606372 | 230 |
| 118 | 3300026078 | Ga0207702_10259688 | Ga0207702_102596882 | 230 |
| 119 | 3300046524 | Ga0495648_0108770 | Ga0495648_0108770_740_1435 | 230 |
| 120 | 3300046660 | Ga0495625_0003510 | Ga0495625_0003510_9499_10194 | 230 |
| 121 | 3300046692 | Ga0495671_0012871 | Ga0495671_0012871_2146_2841 | 230 |
| 122 | 3300046694 | Ga0495649_0005820 | Ga0495649_0005820_4848_5543 | 230 |
| 123 | 3300048924 | Ga0496121_0011779 | Ga0496121_0011779_5477_6178 | 230 |
| 124 | 3300048928 | Ga0496125_0000256 | Ga0496125_0000256_91432_92142 | 230 |
| 125 | 3300053118 | Ga0500594_0003057 | Ga0500594_0003057_364_1059 | 230 |
| 126 | iso_pu_bacteria | 2884811622 | 2884814513 | 230 |
| 127 | iso_pu_bacteria | 2884836552 | 2884839164 | 230 |
| 128 | iso_pu_bacteria | 2884852848 | 2884855455 | 230 |
| 129 | iso_pu_bacteria | 2896154374 | 2896159038 | 230 |
| 130 | iso_pu_bacteria | 2929160207 | 2929164165 | 230 |
| 131 | 2162886007 | SwRhRL2b_contig_2416600 | SwRhRL2b_0613.00005370 | 231 |
| 132 | 3300001915 | JGI24741J21665_1008640 | JGI24741J21665_10086402 | 231 |
| 133 | 3300001976 | JGI24752J21851_1000730 | JGI24752J21851_10007304 | 231 |
| 134 | 3300001990 | JGI24737J22298_10050897 | JGI24737J22298_100508973 | 231 |
| 135 | 3300002076 | JGI24749J21850_1002277 | JGI24749J21850_10022773 | 231 |
| 136 | 3300002704 | JGI25155J39150_1002715 | JGI25155J39150_10027151 | 231 |
| 137 | 3300002738 | JGI25154J39366_1008483 | JGI25154J39366_10084832 | 231 |
| 138 | 3300002773 | JGI25152J39213_1004941 | JGI25152J39213_10049412 | 231 |
| 139 | 3300003187 | JGI25151J46595_10006396 | JGI25151J46595_100063965 | 231 |
| 140 | 3300003187 | JGI25151J46595_10021764 | JGI25151J46595_100217643 | 231 |
| 141 | 3300003215 | JGI25153J46596_10006450 | JGI25153J46596_100064505 | 231 |
| 142 | 3300003215 | JGI25153J46596_10018272 | JGI25153J46596_100182722 | 231 |
| 143 | 3300003322 | rootL2_10049679 | rootL2_100496792 | 231 |
| 144 | 3300003354 | JGI25160J50197_1010960 | JGI25160J50197_10109602 | 231 |
| 145 | 3300003751 | Ga0055538_1000386 | Ga0055538_100038614 | 231 |
| 146 | 3300003752 | Ga0055539_1000383 | Ga0055539_100038314 | 231 |
| 147 | 3300003756 | Ga0055533_1000378 | Ga0055533_100037813 | 231 |
| 148 | 3300003756 | Ga0055533_1000535 | Ga0055533_10005355 | 231 |
| 149 | 3300003758 | Ga0055532_1000473 | Ga0055532_100047314 | 231 |
| 150 | 3300003759 | Ga0055525_1000539 | Ga0055525_100053914 | 231 |
| 151 | 3300003763 | Ga0055529_1000080 | Ga0055529_1000080139 | 231 |
| 152 | 3300003771 | Ga0055526_1000198 | Ga0055526_100019848 | 231 |
| 153 | 3300003771 | Ga0055526_1000827 | Ga0055526_100082713 | 231 |
| 154 | 3300003771 | Ga0055526_1009948 | Ga0055526_10099484 | 231 |
| 155 | 3300003771 | Ga0055526_1013069 | Ga0055526_10130694 | 231 |
| 156 | 3300003773 | Ga0055537_1000035 | Ga0055537_100003590 | 231 |
| 157 | 3300003773 | Ga0055537_1000111 | Ga0055537_10001116 | 231 |
| 158 | 3300003775 | Ga0055524_1001079 | Ga0055524_100107910 | 231 |
| 159 | 3300003775 | Ga0055524_1010543 | Ga0055524_10105435 | 231 |
| 160 | 3300003784 | Ga0055534_1000268 | Ga0055534_100026813 | 231 |
| 161 | 3300003790 | Ga0055528_1000178 | Ga0055528_100017846 | 231 |
| 162 | 3300003790 | Ga0055528_1009461 | Ga0055528_10094611 | 231 |
| 163 | 3300003791 | Ga0055530_10000246 | Ga0055530_1000024625 | 231 |
| 164 | 3300003792 | Ga0055540_1006912 | Ga0055540_10069121 | 231 |
| 165 | 3300003792 | Ga0055540_1010127 | Ga0055540_10101272 | 231 |
| 166 | 3300003794 | Ga0055531_10007008 | Ga0055531_100070084 | 231 |
| 167 | 3300003841 | Ga0055541_1000272 | Ga0055541_100027214 | 231 |
| 168 | 3300004625 | Ga0055543_1005569 | Ga0055543_10055694 | 231 |
| 169 | 3300005262 | Ga0065165_1000281 | Ga0065165_100028187 | 231 |
| 170 | 3300005262 | Ga0065165_1001147 | Ga0065165_100114720 | 231 |
| 171 | 3300005262 | Ga0065165_1023503 | Ga0065165_10235032 | 231 |
| 172 | 3300005288 | Ga0065714_10066496 | Ga0065714_100664963 | 231 |
| 173 | 3300005288 | Ga0065714_10067661 | Ga0065714_100676613 | 231 |
| 174 | 3300005289 | Ga0065704_10025345 | Ga0065704_100253451 | 231 |
| 175 | 3300005289 | Ga0065704_10074885 | Ga0065704_100748853 | 231 |
| 176 | 3300005290 | Ga0065712_10077793 | Ga0065712_100777933 | 231 |
| 177 | 3300005330 | Ga0070690_100003271 | Ga0070690_1000032714 | 231 |
| 178 | 3300005331 | Ga0070670_100001979 | Ga0070670_10000197913 | 231 |
| 179 | 3300005331 | Ga0070670_100010285 | Ga0070670_1000102856 | 231 |
| 180 | 3300005335 | Ga0070666_10119256 | Ga0070666_101192561 | 231 |
| 181 | 3300005338 | Ga0068868_100123900 | Ga0068868_1001239002 | 231 |
| 182 | 3300005339 | Ga0070660_100000231 | Ga0070660_10000023114 | 231 |
| 183 | 3300005340 | Ga0070689_100050552 | Ga0070689_1000505522 | 231 |
| 184 | 3300005343 | Ga0070687_100129618 | Ga0070687_1001296182 | 231 |
| 185 | 3300005344 | Ga0070661_100808608 | Ga0070661_1008086081 | 231 |
| 186 | 3300005353 | Ga0070669_100002053 | Ga0070669_1000020533 | 231 |
| 187 | 3300005366 | Ga0070659_100000015 | Ga0070659_10000001514 | 231 |
| 188 | 3300005434 | Ga0070709_10000782 | Ga0070709_1000078215 | 231 |
| 189 | 3300005435 | Ga0070714_100029785 | Ga0070714_1000297855 | 231 |
| 190 | 3300005436 | Ga0070713_100059757 | Ga0070713_1000597571 | 231 |
| 191 | 3300005437 | Ga0070710_10000207 | Ga0070710_1000020714 | 231 |
| 192 | 3300005438 | Ga0070701_10001290 | Ga0070701_100012904 | 231 |
| 193 | 3300005440 | Ga0070705_100008425 | Ga0070705_1000084254 | 231 |
| 194 | 3300005445 | Ga0070708_100635414 | Ga0070708_1006354141 | 231 |
| 195 | 3300005455 | Ga0070663_100014052 | Ga0070663_1000140523 | 231 |
| 196 | 3300005457 | Ga0070662_100004404 | Ga0070662_1000044044 | 231 |
| 197 | 3300005457 | Ga0070662_100220864 | Ga0070662_1002208642 | 231 |
| 198 | 3300005466 | Ga0070685_10213857 | Ga0070685_102138572 | 231 |
| 199 | 3300005539 | Ga0068853_100011119 | Ga0068853_1000111193 | 231 |
| 200 | 3300005544 | Ga0070686_100005718 | Ga0070686_1000057182 | 231 |
| 201 | 3300005545 | Ga0070695_100038851 | Ga0070695_1000388514 | 231 |
| 202 | 3300005547 | Ga0070693_100094935 | Ga0070693_1000949352 | 231 |
| 203 | 3300005548 | Ga0070665_100086639 | Ga0070665_1000866392 | 231 |
| 204 | 3300005563 | Ga0068855_100338899 | Ga0068855_1003388992 | 231 |
| 205 | 3300005564 | Ga0070664_100413444 | Ga0070664_1004134441 | 231 |
| 206 | 3300005614 | Ga0068856_100219240 | Ga0068856_1002192401 | 231 |
| 207 | 3300005615 | Ga0070702_100064864 | Ga0070702_1000648642 | 231 |
| 208 | 3300005617 | Ga0068859_100011998 | Ga0068859_1000119983 | 231 |
| 209 | 3300005617 | Ga0068859_100066707 | Ga0068859_1000667073 | 231 |
| 210 | 3300005617 | Ga0068859_100191158 | Ga0068859_1001911582 | 231 |
| 211 | 3300005617 | Ga0068859_100337589 | Ga0068859_1003375892 | 231 |
| 212 | 3300005618 | Ga0068864_100004227 | Ga0068864_1000042278 | 231 |
| 213 | 3300005618 | Ga0068864_100077853 | Ga0068864_1000778532 | 231 |
| 214 | 3300005618 | Ga0068864_100722411 | Ga0068864_1007224111 | 231 |
| 215 | 3300005719 | Ga0068861_100023338 | Ga0068861_1000233382 | 231 |
| 216 | 3300005834 | Ga0068851_10000273 | Ga0068851_1000027320 | 231 |
| 217 | 3300005834 | Ga0068851_10130711 | Ga0068851_101307112 | 231 |
| 218 | 3300005841 | Ga0068863_100074738 | Ga0068863_1000747382 | 231 |
| 219 | 3300005841 | Ga0068863_100146645 | Ga0068863_1001466452 | 231 |
| 220 | 3300005841 | Ga0068863_100212496 | Ga0068863_1002124962 | 231 |
| 221 | 3300005842 | Ga0068858_100000285 | Ga0068858_10000028539 | 231 |
| 222 | 3300005842 | Ga0068858_100641629 | Ga0068858_1006416292 | 231 |
| 223 | 3300005843 | Ga0068860_100013959 | Ga0068860_1000139595 | 231 |
| 224 | 3300005843 | Ga0068860_100290602 | Ga0068860_1002906022 | 231 |
| 225 | 3300005844 | Ga0068862_100015829 | Ga0068862_1000158292 | 231 |
| 226 | 3300006028 | Ga0070717_10075228 | Ga0070717_100752283 | 231 |
| 227 | 3300006173 | Ga0070716_100030938 | Ga0070716_1000309381 | 231 |
| 228 | 3300006175 | Ga0070712_100078925 | Ga0070712_1000789251 | 231 |
| 229 | 3300006195 | Ga0075366_10216863 | Ga0075366_102168631 | 231 |
| 230 | 3300006353 | Ga0075370_10053546 | Ga0075370_100535463 | 231 |
| 231 | 3300006846 | Ga0075430_100716792 | Ga0075430_1007167921 | 231 |
| 232 | 3300006881 | Ga0068865_100430416 | Ga0068865_1004304162 | 231 |
| 233 | 3300006931 | Ga0097620_100011997 | Ga0097620_1000119977 | 231 |
| 234 | 3300006931 | Ga0097620_100066707 | Ga0097620_1000667073 | 231 |
| 235 | 3300006931 | Ga0097620_100191154 | Ga0097620_1001911542 | 231 |
| 236 | 3300006931 | Ga0097620_100337598 | Ga0097620_1003375982 | 231 |
| 237 | 3300006946 | Ga0079104_1001829 | Ga0079104_10018293 | 231 |
| 238 | 3300009011 | Ga0105251_10046423 | Ga0105251_100464232 | 231 |
| 239 | 3300009011 | Ga0105251_10083766 | Ga0105251_100837662 | 231 |
| 240 | 3300009036 | Ga0105244_10003158 | Ga0105244_1000315810 | 231 |
| 241 | 3300009036 | Ga0105244_10006440 | Ga0105244_100064404 | 231 |
| 242 | 3300009092 | Ga0105250_10000065 | Ga0105250_100000655 | 231 |
| 243 | 3300009092 | Ga0105250_10019596 | Ga0105250_100195962 | 231 |
| 244 | 3300009092 | Ga0105250_10048309 | Ga0105250_100483092 | 231 |
| 245 | 3300009092 | Ga0105250_10066784 | Ga0105250_100667842 | 231 |
| 246 | 3300009093 | Ga0105240_10203804 | Ga0105240_102038042 | 231 |
| 247 | 3300009094 | Ga0111539_10003810 | Ga0111539_1000381020 | 231 |
| 248 | 3300009098 | Ga0105245_10026508 | Ga0105245_100265083 | 231 |
| 249 | 3300009101 | Ga0105247_10000072 | Ga0105247_1000007252 | 231 |
| 250 | 3300009148 | Ga0105243_10054928 | Ga0105243_100549282 | 231 |
| 251 | 3300009176 | Ga0105242_10027447 | Ga0105242_100274474 | 231 |
| 252 | 3300009177 | Ga0105248_10006780 | Ga0105248_100067806 | 231 |
| 253 | 3300009177 | Ga0105248_10213409 | Ga0105248_102134092 | 231 |
| 254 | 3300009177 | Ga0105248_10217977 | Ga0105248_102179773 | 231 |
| 255 | 3300009177 | Ga0105248_10453804 | Ga0105248_104538042 | 231 |
| 256 | 3300009177 | Ga0105248_10753077 | Ga0105248_107530772 | 231 |
| 257 | 3300009545 | Ga0105237_10006481 | Ga0105237_100064814 | 231 |
| 258 | 3300009551 | Ga0105238_10009396 | Ga0105238_100093965 | 231 |
| 259 | 3300009551 | Ga0105238_10136319 | Ga0105238_101363192 | 231 |
| 260 | 3300009553 | Ga0105249_10010344 | Ga0105249_100103443 | 231 |
| 261 | 3300010375 | Ga0105239_10036491 | Ga0105239_100364911 | 231 |
| 262 | 3300011119 | Ga0105246_10008968 | Ga0105246_100089683 | 231 |
| 263 | 3300011119 | Ga0105246_10020533 | Ga0105246_100205334 | 231 |
| 264 | 3300012502 | Ga0157347_1000303 | Ga0157347_10003033 | 231 |
| 265 | 3300013100 | Ga0157373_10007991 | Ga0157373_100079913 | 231 |
| 266 | 3300013100 | Ga0157373_10011875 | Ga0157373_100118753 | 231 |
| 267 | 3300013100 | Ga0157373_10015556 | Ga0157373_100155564 | 231 |
| 268 | 3300013100 | Ga0157373_10178490 | Ga0157373_101784901 | 231 |
| 269 | 3300013102 | Ga0157371_10361141 | Ga0157371_103611412 | 231 |
| 270 | 3300013104 | Ga0157370_10220155 | Ga0157370_102201552 | 231 |
| 271 | 3300013105 | Ga0157369_10007939 | Ga0157369_100079396 | 231 |
| 272 | 3300013105 | Ga0157369_10010059 | Ga0157369_100100599 | 231 |
| 273 | 3300013105 | Ga0157369_10025471 | Ga0157369_100254714 | 231 |
| 274 | 3300013105 | Ga0157369_10296179 | Ga0157369_102961793 | 231 |
| 275 | 3300013296 | Ga0157374_10333844 | Ga0157374_103338442 | 231 |
| 276 | 3300013306 | Ga0163162_10009132 | Ga0163162_100091323 | 231 |
| 277 | 3300013306 | Ga0163162_10032279 | Ga0163162_100322798 | 231 |
| 278 | 3300013306 | Ga0163162_10067823 | Ga0163162_100678236 | 231 |
| 279 | 3300013308 | Ga0157375_10050889 | Ga0157375_100508893 | 231 |
| 280 | 3300013308 | Ga0157375_10319742 | Ga0157375_103197422 | 231 |
| 281 | 3300014325 | Ga0163163_10028581 | Ga0163163_100285814 | 231 |
| 282 | 3300014497 | Ga0182008_10001274 | Ga0182008_1000127413 | 231 |
| 283 | 3300014497 | Ga0182008_10001882 | Ga0182008_1000188213 | 231 |
| 284 | 3300014497 | Ga0182008_10050488 | Ga0182008_100504882 | 231 |
| 285 | 3300015261 | Ga0182006_1013376 | Ga0182006_10133762 | 231 |
| 286 | 3300015262 | Ga0182007_10001259 | Ga0182007_100012593 | 231 |
| 287 | 3300017792 | Ga0163161_10009764 | Ga0163161_100097646 | 231 |
| 288 | 3300017792 | Ga0163161_10011374 | Ga0163161_100113743 | 231 |
| 289 | 3300017792 | Ga0163161_10042828 | Ga0163161_100428283 | 231 |
| 290 | 3300017792 | Ga0163161_10056011 | Ga0163161_100560113 | 231 |
| 291 | 3300021361 | Ga0213872_10000323 | Ga0213872_100003238 | 231 |
| 292 | 3300021361 | Ga0213872_10003505 | Ga0213872_100035052 | 231 |
| 293 | 3300021361 | Ga0213872_10028707 | Ga0213872_100287072 | 231 |
| 294 | 3300025206 | Ga0209435_102782 | Ga0209435_1027822 | 231 |
| 295 | 3300025208 | Ga0209436_105020 | Ga0209436_1050201 | 231 |
| 296 | 3300025224 | Ga0209784_100116 | Ga0209784_1001165 | 231 |
| 297 | 3300025225 | Ga0209566_100141 | Ga0209566_10014174 | 231 |
| 298 | 3300025226 | Ga0209674_100110 | Ga0209674_10011035 | 231 |
| 299 | 3300025226 | Ga0209674_100162 | Ga0209674_10016274 | 231 |
| 300 | 3300025229 | Ga0209147_100170 | Ga0209147_1001705 | 231 |
| 301 | 3300025230 | Ga0209563_100138 | Ga0209563_1001385 | 231 |
| 302 | 3300025233 | Ga0209437_109956 | Ga0209437_1099561 | 231 |
| 303 | 3300025242 | Ga0209258_100287 | Ga0209258_1002875 | 231 |
| 304 | 3300025245 | Ga0207425_1000318 | Ga0207425_100031815 | 231 |
| 305 | 3300025245 | Ga0207425_1006488 | Ga0207425_10064882 | 231 |
| 306 | 3300025246 | Ga0209646_1000239 | Ga0209646_100023948 | 231 |
| 307 | 3300025250 | Ga0209026_1003815 | Ga0209026_10038154 | 231 |
| 308 | 3300025253 | Ga0209677_100111 | Ga0209677_1001115 | 231 |
| 309 | 3300025256 | Ga0209759_1000128 | Ga0209759_100012835 | 231 |
| 310 | 3300025258 | Ga0209129_1004938 | Ga0209129_10049384 | 231 |
| 311 | 3300025261 | Ga0209233_1002480 | Ga0209233_10024806 | 231 |
| 312 | 3300025263 | Ga0209565_1000009 | Ga0209565_1000009593 | 231 |
| 313 | 3300025263 | Ga0209565_1000461 | Ga0209565_100046111 | 231 |
| 314 | 3300025263 | Ga0209565_1000570 | Ga0209565_100057011 | 231 |
| 315 | 3300025272 | Ga0209455_1000037 | Ga0209455_10000376 | 231 |
| 316 | 3300025273 | Ga0209673_1000036 | Ga0209673_100003689 | 231 |
| 317 | 3300025273 | Ga0209673_1000260 | Ga0209673_100026011 | 231 |
| 318 | 3300025273 | Ga0209673_1006964 | Ga0209673_10069644 | 231 |
| 319 | 3300025284 | Ga0209130_1002311 | Ga0209130_100231111 | 231 |
| 320 | 3300025291 | Ga0209675_1000013 | Ga0209675_100001389 | 231 |
| 321 | 3300025291 | Ga0209675_1001088 | Ga0209675_100108816 | 231 |
| 322 | 3300025292 | Ga0209676_1000004 | Ga0209676_1000004153 | 231 |
| 323 | 3300025292 | Ga0209676_1047066 | Ga0209676_10470662 | 231 |
| 324 | 3300025294 | Ga0209025_1000096 | Ga0209025_1000096209 | 231 |
| 325 | 3300025294 | Ga0209025_1003816 | Ga0209025_100381614 | 231 |
| 326 | 3300025294 | Ga0209025_1004142 | Ga0209025_10041423 | 231 |
| 327 | 3300025295 | Ga0209564_1000003 | Ga0209564_1000003925 | 231 |
| 328 | 3300025295 | Ga0209564_1000009 | Ga0209564_1000009476 | 231 |
| 329 | 3300025295 | Ga0209564_1000122 | Ga0209564_100012289 | 231 |
| 330 | 3300025295 | Ga0209564_1000267 | Ga0209564_100026743 | 231 |
| 331 | 3300025297 | Ga0209758_1000675 | Ga0209758_100067516 | 231 |
| 332 | 3300025297 | Ga0209758_1005265 | Ga0209758_100526511 | 231 |
| 333 | 3300025298 | Ga0209050_1000002 | Ga0209050_1000002663 | 231 |
| 334 | 3300025299 | Ga0209256_1000106 | Ga0209256_100010686 | 231 |
| 335 | 3300025299 | Ga0209256_1000222 | Ga0209256_100022215 | 231 |
| 336 | 3300025299 | Ga0209256_1000398 | Ga0209256_100039810 | 231 |
| 337 | 3300025299 | Ga0209256_1020242 | Ga0209256_10202422 | 231 |
| 338 | 3300025302 | Ga0207426_1002483 | Ga0207426_10024834 | 231 |
| 339 | 3300025303 | Ga0209051_1000002 | Ga0209051_1000002431 | 231 |
| 340 | 3300025303 | Ga0209051_1008225 | Ga0209051_10082252 | 231 |
| 341 | 3300025304 | Ga0209257_1000002 | Ga0209257_1000002572 | 231 |
| 342 | 3300025321 | Ga0207656_10000028 | Ga0207656_1000002819 | 231 |
| 343 | 3300025711 | Ga0207696_1000081 | Ga0207696_100008171 | 231 |
| 344 | 3300025711 | Ga0207696_1001871 | Ga0207696_10018715 | 231 |
| 345 | 3300025711 | Ga0207696_1013317 | Ga0207696_10133173 | 231 |
| 346 | 3300025711 | Ga0207696_1022599 | Ga0207696_10225992 | 231 |
| 347 | 3300025711 | Ga0207696_1045450 | Ga0207696_10454501 | 231 |
| 348 | 3300025728 | Ga0207655_1021497 | Ga0207655_10214973 | 231 |
| 349 | 3300025735 | Ga0207713_1002126 | Ga0207713_10021265 | 231 |
| 350 | 3300025735 | Ga0207713_1008105 | Ga0207713_10081052 | 231 |
| 351 | 3300025900 | Ga0207710_10000303 | Ga0207710_1000030320 | 231 |
| 352 | 3300025903 | Ga0207680_10155200 | Ga0207680_101552002 | 231 |
| 353 | 3300025906 | Ga0207699_10000379 | Ga0207699_1000037922 | 231 |
| 354 | 3300025913 | Ga0207695_10032198 | Ga0207695_100321983 | 231 |
| 355 | 3300025914 | Ga0207671_10678940 | Ga0207671_106789401 | 231 |
| 356 | 3300025915 | Ga0207693_10013170 | Ga0207693_100131708 | 231 |
| 357 | 3300025919 | Ga0207657_10000014 | Ga0207657_1000001413 | 231 |
| 358 | 3300025919 | Ga0207657_10139180 | Ga0207657_101391802 | 231 |
| 359 | 3300025920 | Ga0207649_10409556 | Ga0207649_104095562 | 231 |
| 360 | 3300025923 | Ga0207681_10000892 | Ga0207681_100008929 | 231 |
| 361 | 3300025924 | Ga0207694_10038314 | Ga0207694_100383143 | 231 |
| 362 | 3300025924 | Ga0207694_10082776 | Ga0207694_100827762 | 231 |
| 363 | 3300025924 | Ga0207694_10171502 | Ga0207694_101715022 | 231 |
| 364 | 3300025925 | Ga0207650_10000086 | Ga0207650_1000008658 | 231 |
| 365 | 3300025925 | Ga0207650_10000732 | Ga0207650_1000073222 | 231 |
| 366 | 3300025925 | Ga0207650_10019476 | Ga0207650_100194765 | 231 |
| 367 | 3300025925 | Ga0207650_10081053 | Ga0207650_100810532 | 231 |
| 368 | 3300025927 | Ga0207687_10228928 | Ga0207687_102289282 | 231 |
| 369 | 3300025928 | Ga0207700_10029114 | Ga0207700_100291143 | 231 |
| 370 | 3300025929 | Ga0207664_10009594 | Ga0207664_100095948 | 231 |
| 371 | 3300025931 | Ga0207644_10013499 | Ga0207644_100134995 | 231 |
| 372 | 3300025932 | Ga0207690_10000023 | Ga0207690_10000023140 | 231 |
| 373 | 3300025932 | Ga0207690_10480885 | Ga0207690_104808851 | 231 |
| 374 | 3300025933 | Ga0207706_10000172 | Ga0207706_1000017223 | 231 |
| 375 | 3300025936 | Ga0207670_10006847 | Ga0207670_100068475 | 231 |
| 376 | 3300025941 | Ga0207711_10069809 | Ga0207711_100698093 | 231 |
| 377 | 3300025941 | Ga0207711_10083605 | Ga0207711_100836052 | 231 |
| 378 | 3300025941 | Ga0207711_10141823 | Ga0207711_101418232 | 231 |
| 379 | 3300025961 | Ga0207712_10016272 | Ga0207712_100162728 | 231 |
| 380 | 3300025986 | Ga0207658_10050361 | Ga0207658_100503612 | 231 |
| 381 | 3300025986 | Ga0207658_10050849 | Ga0207658_100508493 | 231 |
| 382 | 3300025986 | Ga0207658_10228913 | Ga0207658_102289131 | 231 |
| 383 | 3300026023 | Ga0207677_10021826 | Ga0207677_100218262 | 231 |
| 384 | 3300026035 | Ga0207703_10001441 | Ga0207703_1000144115 | 231 |
| 385 | 3300026035 | Ga0207703_10259991 | Ga0207703_102599911 | 231 |
| 386 | 3300026041 | Ga0207639_10026033 | Ga0207639_100260334 | 231 |
| 387 | 3300026067 | Ga0207678_10025545 | Ga0207678_100255454 | 231 |
| 388 | 3300026075 | Ga0207708_10274489 | Ga0207708_102744891 | 231 |
| 389 | 3300026088 | Ga0207641_10011245 | Ga0207641_100112452 | 231 |
| 390 | 3300026088 | Ga0207641_10012333 | Ga0207641_100123335 | 231 |
| 391 | 3300026095 | Ga0207676_10098533 | Ga0207676_100985332 | 231 |
| 392 | 3300026095 | Ga0207676_10131418 | Ga0207676_101314183 | 231 |
| 393 | 3300026116 | Ga0207674_10784179 | Ga0207674_107841791 | 231 |
| 394 | 3300026118 | Ga0207675_100009401 | Ga0207675_1000094018 | 231 |
| 395 | 3300026142 | Ga0207698_10153986 | Ga0207698_101539861 | 231 |
| 396 | 3300027111 | Ga0209281_1000008 | Ga0209281_100000874 | 231 |
| 397 | 3300027907 | Ga0207428_10034074 | Ga0207428_100340741 | 231 |
| 398 | 3300028379 | Ga0268266_10030215 | Ga0268266_100302153 | 231 |
| 399 | 3300028380 | Ga0268265_10014914 | Ga0268265_100149146 | 231 |
| 400 | 3300028380 | Ga0268265_10127672 | Ga0268265_101276723 | 231 |
| 401 | 3300028381 | Ga0268264_10158134 | Ga0268264_101581342 | 231 |
| 402 | 3300028381 | Ga0268264_10213008 | Ga0268264_102130082 | 231 |
| 403 | 3300028786 | Ga0307517_10083751 | Ga0307517_100837512 | 231 |
| 404 | 3300028794 | Ga0307515_10000049 | Ga0307515_1000004984 | 231 |
| 405 | 3300028794 | Ga0307515_10179926 | Ga0307515_101799261 | 231 |
| 406 | 3300030521 | Ga0307511_10044168 | Ga0307511_100441683 | 231 |
| 407 | 3300031507 | Ga0307509_10343109 | Ga0307509_103431091 | 231 |
| 408 | 3300031548 | Ga0307408_100002456 | Ga0307408_10000245611 | 231 |
| 409 | 3300031711 | Ga0265314_10122879 | Ga0265314_101228793 | 231 |
| 410 | 3300031731 | Ga0307405_10004623 | Ga0307405_100046236 | 231 |
| 411 | 3300032002 | Ga0307416_100236177 | Ga0307416_1002361772 | 231 |
| 412 | 3300032002 | Ga0307416_100293228 | Ga0307416_1002932283 | 231 |
| 413 | 3300032126 | Ga0307415_100148894 | Ga0307415_1001488942 | 231 |
| 414 | 3300033180 | Ga0307510_10000013 | Ga0307510_1000001325 | 231 |
| 415 | 3300035121 | Ga0373960_0000337 | Ga0373960_0000337_7097_7804 | 231 |
| 416 | 3300035691 | Ga0373931_0015579 | Ga0373931_0015579_1359_2066 | 231 |
| 417 | 3300036401 | Ga0373937_0201026 | Ga0373937_0201026_389_1102 | 231 |
| 418 | 3300037471 | Ga0395905_0002838 | Ga0395905_0002838_4620_5324 | 231 |
| 419 | 3300039447 | Ga0436361_0104721 | Ga0436361_0104721_9944_10690 | 231 |
| 420 | 3300039447 | Ga0436361_0470493 | Ga0436361_0470493_738_1442 | 231 |
| 421 | 3300039447 | Ga0436361_0488174 | Ga0436361_0488174_19022_19726 | 231 |
| 422 | 3300039447 | Ga0436361_0602168 | Ga0436361_0602168_3333_4037 | 231 |
| 423 | 3300039447 | Ga0436361_1047176 | Ga0436361_1047176_1163_1909 | 231 |
| 424 | 3300039447 | Ga0436361_1223139 | Ga0436361_1223139_6565_7269 | 231 |
| 425 | 3300039450 | Ga0436363_0918195 | Ga0436363_0918195_201_902 | 231 |
| 426 | 3300041411 | Ga0439466_0024026 | Ga0439466_0024026_1252_1956 | 231 |
| 427 | 3300041997 | Ga0439431_0038124 | Ga0439431_0038124_408_1118 | 231 |
| 428 | 3300042006 | Ga0439432_000008 | Ga0439432_000008_23005_23703 | 231 |
| 429 | 3300042127 | Ga0450890_007679 | Ga0450890_007679_558_1268 | 231 |
| 430 | 3300042139 | Ga0450904_000031 | Ga0450904_000031_17729_18433 | 231 |
| 431 | 3300042142 | Ga0450905_018750 | Ga0450905_018750_122_826 | 231 |
| 432 | 3300042156 | Ga0439446_0050007 | Ga0439446_0050007_262_972 | 231 |
| 433 | 3300042438 | Ga0439459_0000672 | Ga0439459_0000672_2248_2958 | 231 |
| 434 | 3300044658 | Ga0466972_0018830 | Ga0466972_0018830_1145_1849 | 231 |
| 435 | 3300046453 | Ga0495627_007626 | Ga0495627_007626_1139_1843 | 231 |
| 436 | 3300046455 | Ga0495603_0130388 | Ga0495603_0130388_680_1378 | 231 |
| 437 | 3300046457 | Ga0495590_0000008 | Ga0495590_0000008_79631_80335 | 231 |
| 438 | 3300046458 | Ga0495591_002224 | Ga0495591_002224_5036_5734 | 231 |
| 439 | 3300046459 | Ga0495629_0009959 | Ga0495629_0009959_5286_5984 | 231 |
| 440 | 3300046459 | Ga0495629_0090526 | Ga0495629_0090526_682_1392 | 231 |
| 441 | 3300046460 | Ga0495638_0002309 | Ga0495638_0002309_3060_3764 | 231 |
| 442 | 3300046463 | Ga0495653_0013580 | Ga0495653_0013580_1783_2508 | 231 |
| 443 | 3300046463 | Ga0495653_0042708 | Ga0495653_0042708_369_1067 | 231 |
| 444 | 3300046471 | Ga0495650_0000161 | Ga0495650_0000161_73604_74308 | 231 |
| 445 | 3300046471 | Ga0495650_0000239 | Ga0495650_0000239_49176_49886 | 231 |
| 446 | 3300046471 | Ga0495650_0017036 | Ga0495650_0017036_2278_2982 | 231 |
| 447 | 3300046472 | Ga0495580_0296961 | Ga0495580_0296961_188_913 | 231 |
| 448 | 3300046472 | Ga0495580_0428628 | Ga0495580_0428628_169_867 | 231 |
| 449 | 3300046473 | Ga0495582_0010242 | Ga0495582_0010242_40_750 | 231 |
| 450 | 3300046473 | Ga0495582_0033315 | Ga0495582_0033315_902_1600 | 231 |
| 451 | 3300046474 | Ga0495605_0000921 | Ga0495605_0000921_18731_19435 | 231 |
| 452 | 3300046474 | Ga0495605_0017045 | Ga0495605_0017045_3104_3814 | 231 |
| 453 | 3300046475 | Ga0495639_0070025 | Ga0495639_0070025_786_1511 | 231 |
| 454 | 3300046491 | Ga0495584_0022440 | Ga0495584_0022440_756_1466 | 231 |
| 455 | 3300046491 | Ga0495584_0227752 | Ga0495584_0227752_113_814 | 231 |
| 456 | 3300046491 | Ga0495584_0272300 | Ga0495584_0272300_129_839 | 231 |
| 457 | 3300046492 | Ga0495585_0010191 | Ga0495585_0010191_952_1656 | 231 |
| 458 | 3300046492 | Ga0495585_0063604 | Ga0495585_0063604_664_1374 | 231 |
| 459 | 3300046499 | Ga0495594_0080073 | Ga0495594_0080073_988_1698 | 231 |
| 460 | 3300046499 | Ga0495594_0109332 | Ga0495594_0109332_403_1101 | 231 |
| 461 | 3300046499 | Ga0495594_0122781 | Ga0495594_0122781_428_1153 | 231 |
| 462 | 3300046500 | Ga0495596_0003871 | Ga0495596_0003871_241_951 | 231 |
| 463 | 3300046500 | Ga0495596_0006209 | Ga0495596_0006209_3116_3820 | 231 |
| 464 | 3300046501 | Ga0495607_0000561 | Ga0495607_0000561_24050_24763 | 231 |
| 465 | 3300046501 | Ga0495607_0003529 | Ga0495607_0003529_6642_7352 | 231 |
| 466 | 3300046501 | Ga0495607_0030932 | Ga0495607_0030932_2535_3233 | 231 |
| 467 | 3300046501 | Ga0495607_0059146 | Ga0495607_0059146_46_750 | 231 |
| 468 | 3300046506 | Ga0495583_0000160 | Ga0495583_0000160_62880_63590 | 231 |
| 469 | 3300046506 | Ga0495583_0000544 | Ga0495583_0000544_23408_24112 | 231 |
| 470 | 3300046506 | Ga0495583_0002756 | Ga0495583_0002756_9171_9932 | 231 |
| 471 | 3300046507 | Ga0495606_0016874 | Ga0495606_0016874_84_848 | 231 |
| 472 | 3300046507 | Ga0495606_0022629 | Ga0495606_0022629_2230_2934 | 231 |
| 473 | 3300046507 | Ga0495606_0034545 | Ga0495606_0034545_1386_2084 | 231 |
| 474 | 3300046512 | Ga0495610_0003073 | Ga0495610_0003073_8055_8819 | 231 |
| 475 | 3300046512 | Ga0495610_0004990 | Ga0495610_0004990_3823_4521 | 231 |
| 476 | 3300046512 | Ga0495610_0016181 | Ga0495610_0016181_1700_2398 | 231 |
| 477 | 3300046512 | Ga0495610_0032603 | Ga0495610_0032603_1356_2054 | 231 |
| 478 | 3300046512 | Ga0495610_0088208 | Ga0495610_0088208_61_822 | 231 |
| 479 | 3300046513 | Ga0495616_0002763 | Ga0495616_0002763_8776_9486 | 231 |
| 480 | 3300046513 | Ga0495616_0019465 | Ga0495616_0019465_2252_2962 | 231 |
| 481 | 3300046515 | Ga0495620_0000442 | Ga0495620_0000442_8262_8957 | 231 |
| 482 | 3300046515 | Ga0495620_0007504 | Ga0495620_0007504_2366_3064 | 231 |
| 483 | 3300046516 | Ga0495628_0125633 | Ga0495628_0125633_223_927 | 231 |
| 484 | 3300046518 | Ga0495631_0002610 | Ga0495631_0002610_1787_2497 | 231 |
| 485 | 3300046518 | Ga0495631_0002645 | Ga0495631_0002645_2357_3061 | 231 |
| 486 | 3300046518 | Ga0495631_0051043 | Ga0495631_0051043_614_1324 | 231 |
| 487 | 3300046518 | Ga0495631_0129907 | Ga0495631_0129907_86_787 | 231 |
| 488 | 3300046519 | Ga0495632_0000621 | Ga0495632_0000621_13170_13865 | 231 |
| 489 | 3300046519 | Ga0495632_0001302 | Ga0495632_0001302_5637_6347 | 231 |
| 490 | 3300046519 | Ga0495632_0007221 | Ga0495632_0007221_4919_5617 | 231 |
| 491 | 3300046522 | Ga0495643_0000142 | Ga0495643_0000142_75614_76378 | 231 |
| 492 | 3300046522 | Ga0495643_0001231 | Ga0495643_0001231_16429_17124 | 231 |
| 493 | 3300046522 | Ga0495643_0041936 | Ga0495643_0041936_1769_2473 | 231 |
| 494 | 3300046523 | Ga0495644_0003117 | Ga0495644_0003117_5492_6202 | 231 |
| 495 | 3300046523 | Ga0495644_0050847 | Ga0495644_0050847_270_971 | 231 |
| 496 | 3300046523 | Ga0495644_0053999 | Ga0495644_0053999_697_1401 | 231 |
| 497 | 3300046524 | Ga0495648_0000188 | Ga0495648_0000188_13571_14266 | 231 |
| 498 | 3300046524 | Ga0495648_0121198 | Ga0495648_0121198_130_894 | 231 |
| 499 | 3300046525 | Ga0495663_0011932 | Ga0495663_0011932_596_1297 | 231 |
| 500 | 3300046526 | Ga0495666_0003824 | Ga0495666_0003824_2655_3359 | 231 |
| 501 | 3300046526 | Ga0495666_0012332 | Ga0495666_0012332_1695_2393 | 231 |
| 502 | 3300046528 | Ga0495642_0002438 | Ga0495642_0002438_3424_4134 | 231 |
| 503 | 3300046528 | Ga0495642_0003247 | Ga0495642_0003247_2539_3243 | 231 |
| 504 | 3300046528 | Ga0495642_0008182 | Ga0495642_0008182_291_995 | 231 |
| 505 | 3300046528 | Ga0495642_0013991 | Ga0495642_0013991_396_1097 | 231 |
| 506 | 3300046528 | Ga0495642_0016015 | Ga0495642_0016015_1991_2701 | 231 |
| 507 | 3300046529 | Ga0495652_0011549 | Ga0495652_0011549_1137_1862 | 231 |
| 508 | 3300046530 | Ga0495654_0000813 | Ga0495654_0000813_10508_11206 | 231 |
| 509 | 3300046530 | Ga0495654_0009048 | Ga0495654_0009048_1323_2021 | 231 |
| 510 | 3300046530 | Ga0495654_0105266 | Ga0495654_0105266_571_1269 | 231 |
| 511 | 3300046531 | Ga0495665_0001605 | Ga0495665_0001605_4670_5368 | 231 |
| 512 | 3300046531 | Ga0495665_0006890 | Ga0495665_0006890_843_1568 | 231 |
| 513 | 3300046531 | Ga0495665_0064220 | Ga0495665_0064220_565_1263 | 231 |
| 514 | 3300046535 | Ga0495586_0005366 | Ga0495586_0005366_86_784 | 231 |
| 515 | 3300046535 | Ga0495586_0014722 | Ga0495586_0014722_188_913 | 231 |
| 516 | 3300046536 | Ga0495587_0122881 | Ga0495587_0122881_442_1140 | 231 |
| 517 | 3300046538 | Ga0495609_0000269 | Ga0495609_0000269_42367_43077 | 231 |
| 518 | 3300046538 | Ga0495609_0008841 | Ga0495609_0008841_747_1457 | 231 |
| 519 | 3300046542 | Ga0495597_0000908 | Ga0495597_0000908_952_1653 | 231 |
| 520 | 3300046542 | Ga0495597_0001319 | Ga0495597_0001319_15956_16720 | 231 |
| 521 | 3300046542 | Ga0495597_0006885 | Ga0495597_0006885_1719_2465 | 231 |
| 522 | 3300046542 | Ga0495597_0015954 | Ga0495597_0015954_1063_1764 | 231 |
| 523 | 3300046543 | Ga0495645_0305518 | Ga0495645_0305518_58_783 | 231 |
| 524 | 3300046557 | Ga0495622_0002221 | Ga0495622_0002221_2884_3582 | 231 |
| 525 | 3300046557 | Ga0495622_0005278 | Ga0495622_0005278_1081_1791 | 231 |
| 526 | 3300046557 | Ga0495622_0164441 | Ga0495622_0164441_234_959 | 231 |
| 527 | 3300046558 | Ga0495633_0020687 | Ga0495633_0020687_1882_2583 | 231 |
| 528 | 3300046558 | Ga0495633_0047928 | Ga0495633_0047928_821_1531 | 231 |
| 529 | 3300046558 | Ga0495633_0107383 | Ga0495633_0107383_131_841 | 231 |
| 530 | 3300046559 | Ga0495667_0202782 | Ga0495667_0202782_64_768 | 231 |
| 531 | 3300046615 | Ga0495656_0003837 | Ga0495656_0003837_1386_2087 | 231 |
| 532 | 3300046615 | Ga0495656_0009410 | Ga0495656_0009410_2076_2777 | 231 |
| 533 | 3300046615 | Ga0495656_0170685 | Ga0495656_0170685_132_842 | 231 |
| 534 | 3300046616 | Ga0495668_0005378 | Ga0495668_0005378_5870_6571 | 231 |
| 535 | 3300046616 | Ga0495668_0022791 | Ga0495668_0022791_1552_2271 | 231 |
| 536 | 3300046616 | Ga0495668_0031556 | Ga0495668_0031556_1625_2335 | 231 |
| 537 | 3300046642 | Ga0495634_0011374 | Ga0495634_0011374_4754_5479 | 231 |
| 538 | 3300046648 | Ga0495611_0009405 | Ga0495611_0009405_1460_2161 | 231 |
| 539 | 3300046648 | Ga0495611_0020658 | Ga0495611_0020658_118_828 | 231 |
| 540 | 3300046648 | Ga0495611_0051781 | Ga0495611_0051781_538_1239 | 231 |
| 541 | 3300046648 | Ga0495611_0235299 | Ga0495611_0235299_43_744 | 231 |
| 542 | 3300046660 | Ga0495625_0001214 | Ga0495625_0001214_20134_20838 | 231 |
| 543 | 3300046660 | Ga0495625_0039690 | Ga0495625_0039690_2312_3010 | 231 |
| 544 | 3300046660 | Ga0495625_0266604 | Ga0495625_0266604_177_878 | 231 |
| 545 | 3300046663 | Ga0495635_0143014 | Ga0495635_0143014_666_1364 | 231 |
| 546 | 3300046665 | Ga0495661_0000817 | Ga0495661_0000817_23173_23871 | 231 |
| 547 | 3300046665 | Ga0495661_0006103 | Ga0495661_0006103_5614_6312 | 231 |
| 548 | 3300046665 | Ga0495661_0012970 | Ga0495661_0012970_2041_2751 | 231 |
| 549 | 3300046665 | Ga0495661_0132127 | Ga0495661_0132127_291_1037 | 231 |
| 550 | 3300046665 | Ga0495661_0214803 | Ga0495661_0214803_164_865 | 231 |
| 551 | 3300046674 | Ga0495588_0106086 | Ga0495588_0106086_26_736 | 231 |
| 552 | 3300046674 | Ga0495588_0179565 | Ga0495588_0179565_105_803 | 231 |
| 553 | 3300046674 | Ga0495588_0247380 | Ga0495588_0247380_12_722 | 231 |
| 554 | 3300046679 | Ga0495623_0031373 | Ga0495623_0031373_843_1568 | 231 |
| 555 | 3300046679 | Ga0495623_0110862 | Ga0495623_0110862_571_1275 | 231 |
| 556 | 3300046679 | Ga0495623_0122597 | Ga0495623_0122597_422_1120 | 231 |
| 557 | 3300046684 | Ga0495669_0008797 | Ga0495669_0008797_3343_4053 | 231 |
| 558 | 3300046684 | Ga0495669_0070195 | Ga0495669_0070195_777_1481 | 231 |
| 559 | 3300046689 | Ga0495613_0053494 | Ga0495613_0053494_489_1187 | 231 |
| 560 | 3300046691 | Ga0495670_0011246 | Ga0495670_0011246_449_1153 | 231 |
| 561 | 3300046691 | Ga0495670_0031347 | Ga0495670_0031347_877_1578 | 231 |
| 562 | 3300046691 | Ga0495670_0158476 | Ga0495670_0158476_454_1164 | 231 |
| 563 | 3300046694 | Ga0495649_0000028 | Ga0495649_0000028_61469_62173 | 231 |
| 564 | 3300046694 | Ga0495649_0003341 | Ga0495649_0003341_6110_6874 | 231 |
| 565 | 3300046794 | Ga0495589_0000657 | Ga0495589_0000657_795_1499 | 231 |
| 566 | 3300046794 | Ga0495589_0003182 | Ga0495589_0003182_2883_3581 | 231 |
| 567 | 3300046794 | Ga0495589_0008613 | Ga0495589_0008613_14_715 | 231 |
| 568 | 3300046794 | Ga0495589_0055905 | Ga0495589_0055905_650_1360 | 231 |
| 569 | 3300046794 | Ga0495589_0122299 | Ga0495589_0122299_65_763 | 231 |
| 570 | 3300046810 | Ga0495660_0005279 | Ga0495660_0005279_6548_7258 | 231 |
| 571 | 3300046810 | Ga0495660_0005568 | Ga0495660_0005568_1351_2049 | 231 |
| 572 | 3300047315 | Ga0495581_0004376 | Ga0495581_0004376_4476_5186 | 231 |
| 573 | 3300047315 | Ga0495581_0026792 | Ga0495581_0026792_2245_2943 | 231 |
| 574 | 3300047317 | Ga0495604_0017445 | Ga0495604_0017445_2666_3391 | 231 |
| 575 | 3300047317 | Ga0495604_0065370 | Ga0495604_0065370_32_736 | 231 |
| 576 | 3300047319 | Ga0495674_0006932 | Ga0495674_0006932_8522_9220 | 231 |
| 577 | 3300047320 | Ga0495672_0000189 | Ga0495672_0000189_7763_8527 | 231 |
| 578 | 3300047320 | Ga0495672_0001634 | Ga0495672_0001634_6276_6986 | 231 |
| 579 | 3300047320 | Ga0495672_0082896 | Ga0495672_0082896_729_1448 | 231 |
| 580 | 3300047320 | Ga0495672_0104572 | Ga0495672_0104572_618_1328 | 231 |
| 581 | 3300047321 | Ga0495676_0000017 | Ga0495676_0000017_114089_114799 | 231 |
| 582 | 3300047321 | Ga0495676_0071133 | Ga0495676_0071133_1314_2012 | 231 |
| 583 | 3300047321 | Ga0495676_0198705 | Ga0495676_0198705_651_1349 | 231 |
| 584 | 3300047323 | Ga0495683_0004154 | Ga0495683_0004154_1451_2161 | 231 |
| 585 | 3300047323 | Ga0495683_0179020 | Ga0495683_0179020_131_841 | 231 |
| 586 | 3300047444 | Ga0495675_0012620 | Ga0495675_0012620_3967_4692 | 231 |
| 587 | 3300047445 | Ga0495677_0006940 | Ga0495677_0006940_763_1473 | 231 |
| 588 | 3300047445 | Ga0495677_0010213 | Ga0495677_0010213_2134_2835 | 231 |
| 589 | 3300047446 | Ga0495679_000699 | Ga0495679_000699_8197_8958 | 231 |
| 590 | 3300047446 | Ga0495679_009218 | Ga0495679_009218_1838_2593 | 231 |
| 591 | 3300047470 | Ga0495681_0003295 | Ga0495681_0003295_6809_7510 | 231 |
| 592 | 3300047470 | Ga0495681_0004009 | Ga0495681_0004009_3130_3828 | 231 |
| 593 | 3300047470 | Ga0495681_0022031 | Ga0495681_0022031_2031_2741 | 231 |
| 594 | 3300047472 | Ga0495686_0000076 | Ga0495686_0000076_170205_170909 | 231 |
| 595 | 3300047673 | Ga0495593_0070071 | Ga0495593_0070071_1028_1726 | 231 |
| 596 | 3300048088 | Ga0495602_0108551 | Ga0495602_0108551_1476_2174 | 231 |
| 597 | 3300048089 | Ga0495614_0012640 | Ga0495614_0012640_1798_2508 | 231 |
| 598 | 3300048089 | Ga0495614_0036870 | Ga0495614_0036870_1121_1819 | 231 |
| 599 | 3300048091 | Ga0495626_0004982 | Ga0495626_0004982_6611_7309 | 231 |
| 600 | 3300048091 | Ga0495626_0026298 | Ga0495626_0026298_663_1367 | 231 |
| 601 | 3300048905 | Ga0496102_0009591 | Ga0496102_0009591_5419_6123 | 231 |
| 602 | 3300048905 | Ga0496102_0044162 | Ga0496102_0044162_1759_2457 | 231 |
| 603 | 3300048905 | Ga0496102_0425028 | Ga0496102_0425028_287_991 | 231 |
| 604 | 3300048906 | Ga0496103_0002329 | Ga0496103_0002329_5882_6586 | 231 |
| 605 | 3300048907 | Ga0496104_0224418 | Ga0496104_0224418_771_1475 | 231 |
| 606 | 3300048910 | Ga0496107_0110786 | Ga0496107_0110786_481_1185 | 231 |
| 607 | 3300048915 | Ga0496112_0170695 | Ga0496112_0170695_291_995 | 231 |
| 608 | 3300048918 | Ga0496115_0225156 | Ga0496115_0225156_705_1403 | 231 |
| 609 | 3300048918 | Ga0496115_0386130 | Ga0496115_0386130_261_965 | 231 |
| 610 | 3300048919 | Ga0496116_0011501 | Ga0496116_0011501_5430_6125 | 231 |
| 611 | 3300048919 | Ga0496116_0077358 | Ga0496116_0077358_314_1018 | 231 |
| 612 | 3300048920 | Ga0496117_0001169 | Ga0496117_0001169_22884_23579 | 231 |
| 613 | 3300048920 | Ga0496117_0001494 | Ga0496117_0001494_7655_8353 | 231 |
| 614 | 3300048920 | Ga0496117_0003096 | Ga0496117_0003096_7048_7752 | 231 |
| 615 | 3300048920 | Ga0496117_0008511 | Ga0496117_0008511_5186_5881 | 231 |
| 616 | 3300048920 | Ga0496117_0017465 | Ga0496117_0017465_988_1686 | 231 |
| 617 | 3300048921 | Ga0496118_0004011 | Ga0496118_0004011_11537_12232 | 231 |
| 618 | 3300048921 | Ga0496118_0064556 | Ga0496118_0064556_675_1511 | 231 |
| 619 | 3300048921 | Ga0496118_0162404 | Ga0496118_0162404_157_855 | 231 |
| 620 | 3300048922 | Ga0496119_0002476 | Ga0496119_0002476_17933_18649 | 231 |
| 621 | 3300048923 | Ga0496120_0000115 | Ga0496120_0000115_122283_122999 | 231 |
| 622 | 3300048923 | Ga0496120_0001738 | Ga0496120_0001738_16886_17584 | 231 |
| 623 | 3300048923 | Ga0496120_0034298 | Ga0496120_0034298_493_1209 | 231 |
| 624 | 3300048924 | Ga0496121_0000808 | Ga0496121_0000808_11149_11853 | 231 |
| 625 | 3300048924 | Ga0496121_0004158 | Ga0496121_0004158_14809_15513 | 231 |
| 626 | 3300048924 | Ga0496121_0051608 | Ga0496121_0051608_31_735 | 231 |
| 627 | 3300048924 | Ga0496121_0115813 | Ga0496121_0115813_34_738 | 231 |
| 628 | 3300048924 | Ga0496121_0119273 | Ga0496121_0119273_111_827 | 231 |
| 629 | 3300048924 | Ga0496121_0307926 | Ga0496121_0307926_19_723 | 231 |
| 630 | 3300048925 | Ga0496122_0029677 | Ga0496122_0029677_1369_2190 | 231 |
| 631 | 3300048925 | Ga0496122_0060371 | Ga0496122_0060371_1282_2046 | 231 |
| 632 | 3300048925 | Ga0496122_0131758 | Ga0496122_0131758_510_1208 | 231 |
| 633 | 3300048926 | Ga0496123_0027588 | Ga0496123_0027588_1387_2208 | 231 |
| 634 | 3300048926 | Ga0496123_0056828 | Ga0496123_0056828_1050_1748 | 231 |
| 635 | 3300048927 | Ga0496124_0016672 | Ga0496124_0016672_1145_1840 | 231 |
| 636 | 3300048927 | Ga0496124_0025805 | Ga0496124_0025805_3931_4629 | 231 |
| 637 | 3300048927 | Ga0496124_0050080 | Ga0496124_0050080_1795_2493 | 231 |
| 638 | 3300048928 | Ga0496125_0000126 | Ga0496125_0000126_23686_24384 | 231 |
| 639 | 3300048928 | Ga0496125_0000236 | Ga0496125_0000236_11865_12560 | 231 |
| 640 | 3300048928 | Ga0496125_0000775 | Ga0496125_0000775_48017_48838 | 231 |
| 641 | 3300048928 | Ga0496125_0004735 | Ga0496125_0004735_4515_5219 | 231 |
| 642 | 3300048928 | Ga0496125_0005065 | Ga0496125_0005065_9656_10360 | 231 |
| 643 | 3300048928 | Ga0496125_0020759 | Ga0496125_0020759_1691_2452 | 231 |
| 644 | 3300048928 | Ga0496125_0025048 | Ga0496125_0025048_1355_2119 | 231 |
| 645 | 3300048928 | Ga0496125_0027433 | Ga0496125_0027433_4200_4955 | 231 |
| 646 | 3300048928 | Ga0496125_0163576 | Ga0496125_0163576_690_1388 | 231 |
| 647 | 3300048929 | Ga0496126_0012108 | Ga0496126_0012108_6454_7152 | 231 |
| 648 | 3300048929 | Ga0496126_0043734 | Ga0496126_0043734_2125_2823 | 231 |
| 649 | 3300049459 | Ga0495678_000025 | Ga0495678_000025_150280_150984 | 231 |
| 650 | 3300049459 | Ga0495678_000402 | Ga0495678_000402_4419_5183 | 231 |
| 651 | 3300049459 | Ga0495678_005276 | Ga0495678_005276_3171_3881 | 231 |
| 652 | 3300049568 | Ga0501031_0074616 | Ga0501031_0074616_234_938 | 231 |
| 653 | 3300049570 | Ga0501033_0388674 | Ga0501033_0388674_25_723 | 231 |
| 654 | 3300049574 | Ga0501038_0060044 | Ga0501038_0060044_22_726 | 231 |
| 655 | 3300049581 | Ga0501047_0072612 | Ga0501047_0072612_510_1208 | 231 |
| 656 | 3300049582 | Ga0501048_0163807 | Ga0501048_0163807_143_841 | 231 |
| 657 | 3300049586 | Ga0501070_0000047 | Ga0501070_0000047_90636_91340 | 231 |
| 658 | 3300049663 | Ga0501223_000001 | Ga0501223_000001_144261_144974 | 231 |
| 659 | 3300049664 | Ga0501224_000003 | Ga0501224_000003_176411_177124 | 231 |
| 660 | 3300049668 | Ga0501233_000030 | Ga0501233_000030_12848_13561 | 231 |
| 661 | 3300049669 | Ga0501235_000182 | Ga0501235_000182_4658_5371 | 231 |
| 662 | 3300049705 | Ga0501225_0000001 | Ga0501225_0000001_11922_12635 | 231 |
| 663 | 3300049707 | Ga0501234_000234 | Ga0501234_000234_3242_3955 | 231 |
| 664 | 3300049742 | Ga0501080_0000366 | Ga0501080_0000366_6450_7154 | 231 |
| 665 | 3300049822 | Ga0501035_0018191 | Ga0501035_0018191_4263_4967 | 231 |
| 666 | 3300049823 | Ga0501044_0000086 | Ga0501044_0000086_24828_25526 | 231 |
| 667 | 3300049823 | Ga0501044_0001727 | Ga0501044_0001727_22013_22717 | 231 |
| 668 | 3300049853 | Ga0501226_000007 | Ga0501226_000007_72260_72964 | 231 |
| 669 | 3300049853 | Ga0501226_000013 | Ga0501226_000013_162592_163305 | 231 |
| 670 | 3300050493 | nmdc:mga0k408_290689_c1 | nmdc:mga0k408_290689_c1_120_836 | 231 |
| 671 | 3300050511 | nmdc:mga08y16_39763_c1 | nmdc:mga08y16_39763_c1_4210_4920 | 231 |
| 672 | 3300053124 | Ga0500617_177930 | Ga0500617_177930_83_793 | 231 |
| 673 | 3300053130 | Ga0500642_0208756 | Ga0500642_0208756_77_787 | 231 |
| 674 | 3300053156 | Ga0500622_0000970 | Ga0500622_0000970_708_1421 | 231 |
| 675 | 3300053161 | Ga0500634_0003030 | Ga0500634_0003030_5347_6045 | 231 |
| 676 | 3300053161 | Ga0500634_0106549 | Ga0500634_0106549_453_1151 | 231 |
| 677 | iso_pu_bacteria | 2511231002 | 2511247203 | 231 |
| 678 | iso_pu_bacteria | 2582581305 | 2585262838 | 231 |
| 679 | iso_pu_bacteria | 2599185167 | 2599399588 | 231 |
| 680 | iso_pu_bacteria | 2599185191 | 2599519259 | 231 |
| 681 | iso_pu_bacteria | 8054503363 | 8054505487 | 231 |
| 682 | iso_pu_bacteria | 8056131705 | 8056133826 | 231 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4nax-assembly1.cif.gz_B | crystal structure of glutathione transferase pput_1760 from pseudomonas putida, target efi-507288, with one glutathione disulfide bound per one protein subunit | 0.997 | 2 | 231 |
| 4ikh-assembly1.cif.gz_A-2 | crystal structure of a glutathione transferase family member from pseudomonas fluorescens pf-5, target efi-900003, with two glutathione bound | 0.9956 | 6 | 230 |
| 4nhz-assembly2.cif.gz_D | crystal structure of glutathione transferase bbta-3750 from bradyrhizobium sp., target efi-507290, with one glutathione bound | 0.9934 | 3 | 230 |
| 4nax-assembly1.cif.gz_B | crystal structure of glutathione transferase pput_1760 from pseudomonas putida, target efi-507288, with one glutathione disulfide bound per one protein subunit | 0.9927 | 2 | 231 |
| 4nhz-assembly4.cif.gz_H | crystal structure of glutathione transferase bbta-3750 from bradyrhizobium sp., target efi-507290, with one glutathione bound | 0.9889 | 1 | 230 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ikhA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 1 | 6 | 104 | 3.40.30.10 |
| 4naxB02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9987 | 106 | 220 | 1.20.1050.10 |
| 4mf6A01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9932 | 1 | 104 | 3.40.30.10 |
| 4naxB02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9901 | 106 | 220 | 1.20.1050.10 |
| 4nhzB02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.983 | 106 | 220 | 1.20.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J2VEM9-F1-model_v4 | Glutathione S-transferase | 1.006 | 8 | 87 |
GO:0016740
|
| AF-A0A257LP08-F1-model_v4 | Glutathione S-transferase | 1.004 | 1 | 123 |
GO:0016740
|
| AF-A0A136QFY1-F1-model_v4 | deleted | 1.002 | 22 | 231 |
|
| AF-A0A7V7WIE5-F1-model_v4 | Glutathione S-transferase | 1.001 | 4 | 231 |
GO:0016740
|
| AF-A0A3E1RDG9-F1-model_v4 | Glutathione S-transferase | 1 | 1 | 230 |
GO:0016740
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar