F474879
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 682 | 279 | 1364 | 79 |
Family's Representative Sequence
| Representative Sequence | 3300003320|rootH2_10209206|rootH2_102092062 |
| Length | 84 |
| Sequence | VATDVPPSATDWISLEEAAGILSASNVRFRPATIGGWARAGKVQSIKLGGRRFVRRGEIRALVAAPRRVRASDLQPGLFEELRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 61 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 62 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 77 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 131 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 134 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 135 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 136 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 137 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 138 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 139 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 143 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 144 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 145 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 146 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 153 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 154 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 155 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 159 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 160 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 162 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 163 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 169 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 171 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 175 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 180 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 181 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 182 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 183 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 184 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 185 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 186 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 187 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 188 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 189 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 190 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 191 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 192 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 193 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 194 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 222 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 223 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 224 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 225 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 226 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 227 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 230 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 231 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 232 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 233 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 234 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 235 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 9.68 |
| Rhizosphere | 87.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 31.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10209206 | 3300003320 | Bacteria | 1115 |
| 2 | Ga0070683_100665028 | 3300005329 | Bacteria | 997 |
| 3 | Ga0068869_100930643 | 3300005334 | Bacteria | 754 |
| 4 | Ga0068869_101116947 | 3300005334 | Bacteria | 690 |
| 5 | Ga0070666_11342380 | 3300005335 | Bacteria | 534 |
| 6 | Ga0070680_100000004 | 3300005336 | Bacteria | 129387 |
| 7 | Ga0070680_100229985 | 3300005336 | Bacteria | 1566 |
| 8 | Ga0070680_100343925 | 3300005336 | Unclassified | 1268 |
| 9 | Ga0070680_100796814 | 3300005336 | Unclassified | 814 |
| 10 | Ga0068868_100095923 | 3300005338 | Bacteria | 2395 |
| 11 | Ga0068868_100609529 | 3300005338 | Bacteria | 968 |
| 12 | Ga0068868_100652827 | 3300005338 | Bacteria | 937 |
| 13 | Ga0070689_100959289 | 3300005340 | Unclassified | 759 |
| 14 | Ga0070691_10364628 | 3300005341 | Bacteria | 806 |
| 15 | Ga0070691_10933278 | 3300005341 | Bacteria | 537 |
| 16 | Ga0070687_100197990 | 3300005343 | Bacteria | 1215 |
| 17 | Ga0070687_100363578 | 3300005343 | Bacteria | 937 |
| 18 | Ga0070661_101343502 | 3300005344 | Bacteria | 600 |
| 19 | Ga0070692_11053028 | 3300005345 | Bacteria | 572 |
| 20 | Ga0070668_100136976 | 3300005347 | Bacteria | 1970 |
| 21 | Ga0070668_100221430 | 3300005347 | Bacteria | 1561 |
| 22 | Ga0070668_100468791 | 3300005347 | Unclassified | 1086 |
| 23 | Ga0070675_100764551 | 3300005354 | Unclassified | 882 |
| 24 | Ga0070671_100798047 | 3300005355 | Bacteria | 822 |
| 25 | Ga0070673_100879484 | 3300005364 | Bacteria | 830 |
| 26 | Ga0070673_101806876 | 3300005364 | Bacteria | 579 |
| 27 | Ga0070688_101717942 | 3300005365 | Bacteria | 514 |
| 28 | Ga0070659_100196590 | 3300005366 | Unclassified | 1659 |
| 29 | Ga0070703_10043736 | 3300005406 | Unclassified | 1406 |
| 30 | Ga0070703_10135998 | 3300005406 | Bacteria | 908 |
| 31 | Ga0070701_10502220 | 3300005438 | Bacteria | 788 |
| 32 | Ga0070705_100008081 | 3300005440 | Bacteria | 5203 |
| 33 | Ga0070705_100075304 | 3300005440 | Bacteria | 2055 |
| 34 | Ga0070705_100075614 | 3300005440 | Bacteria | 2051 |
| 35 | Ga0070705_100137080 | 3300005440 | Unclassified | 1605 |
| 36 | Ga0070705_100468609 | 3300005440 | Unclassified | 949 |
| 37 | Ga0070705_100776472 | 3300005440 | Unclassified | 760 |
| 38 | Ga0070705_101142278 | 3300005440 | Bacteria | 639 |
| 39 | Ga0070700_100350218 | 3300005441 | Bacteria | 1095 |
| 40 | Ga0070700_100445335 | 3300005441 | Bacteria | 984 |
| 41 | Ga0070700_100878888 | 3300005441 | Unclassified | 728 |
| 42 | Ga0070694_100023551 | 3300005444 | Bacteria | 3962 |
| 43 | Ga0070694_100132721 | 3300005444 | Bacteria | 1801 |
| 44 | Ga0070694_100134104 | 3300005444 | Unclassified | 1792 |
| 45 | Ga0070694_100162948 | 3300005444 | Bacteria | 1638 |
| 46 | Ga0070694_100184053 | 3300005444 | Bacteria | 1547 |
| 47 | Ga0070694_100199827 | 3300005444 | Unclassified | 1489 |
| 48 | Ga0070694_100207770 | 3300005444 | Unclassified | 1463 |
| 49 | Ga0070694_100248677 | 3300005444 | Unclassified | 1344 |
| 50 | Ga0070694_101507724 | 3300005444 | Bacteria | 569 |
| 51 | Ga0070694_101537238 | 3300005444 | Bacteria | 564 |
| 52 | Ga0070708_100002686 | 3300005445 | Bacteria | 13785 |
| 53 | Ga0070708_100005943 | 3300005445 | Bacteria | 9704 |
| 54 | Ga0070708_100016932 | 3300005445 | Bacteria | 6063 |
| 55 | Ga0070708_100067648 | 3300005445 | Bacteria | 3209 |
| 56 | Ga0070708_100302666 | 3300005445 | Bacteria | 1505 |
| 57 | Ga0070708_100338216 | 3300005445 | Unclassified | 1418 |
| 58 | Ga0070708_101384831 | 3300005445 | Bacteria | 656 |
| 59 | Ga0070663_101464429 | 3300005455 | Unclassified | 606 |
| 60 | Ga0070678_100254543 | 3300005456 | Bacteria | 1474 |
| 61 | Ga0070662_100067198 | 3300005457 | Unclassified | 2632 |
| 62 | Ga0070662_100133481 | 3300005457 | Unclassified | 1917 |
| 63 | Ga0070662_100555108 | 3300005457 | Bacteria | 963 |
| 64 | Ga0070662_100803606 | 3300005457 | Bacteria | 800 |
| 65 | Ga0070681_11225014 | 3300005458 | Bacteria | 673 |
| 66 | Ga0070685_11244421 | 3300005466 | Unclassified | 567 |
| 67 | Ga0070706_100000076 | 3300005467 | Bacteria | 114519 |
| 68 | Ga0070706_100026464 | 3300005467 | Bacteria | 5336 |
| 69 | Ga0070706_100031017 | 3300005467 | Bacteria | 4929 |
| 70 | Ga0070706_100059967 | 3300005467 | Unclassified | 3512 |
| 71 | Ga0070706_100132439 | 3300005467 | Unclassified | 2327 |
| 72 | Ga0070706_100135512 | 3300005467 | Unclassified | 2299 |
| 73 | Ga0070706_100181952 | 3300005467 | Bacteria | 1963 |
| 74 | Ga0070707_100001005 | 3300005468 | Bacteria | 27919 |
| 75 | Ga0070707_100002140 | 3300005468 | Bacteria | 18919 |
| 76 | Ga0070707_100016836 | 3300005468 | Bacteria | 6864 |
| 77 | Ga0070707_100079203 | 3300005468 | Bacteria | 3171 |
| 78 | Ga0070707_100097481 | 3300005468 | Archaea | 2848 |
| 79 | Ga0070707_100141484 | 3300005468 | Bacteria | 2342 |
| 80 | Ga0070707_100393511 | 3300005468 | Bacteria | 1346 |
| 81 | Ga0070707_100597140 | 3300005468 | Unclassified | 1066 |
| 82 | Ga0070698_100004268 | 3300005471 | Bacteria | 15715 |
| 83 | Ga0070698_100012889 | 3300005471 | Bacteria | 8852 |
| 84 | Ga0070698_100060838 | 3300005471 | Bacteria | 3810 |
| 85 | Ga0070698_100356822 | 3300005471 | Bacteria | 1394 |
| 86 | Ga0070698_100572198 | 3300005471 | Bacteria | 1069 |
| 87 | Ga0070698_100668551 | 3300005471 | Bacteria | 980 |
| 88 | Ga0070698_100750366 | 3300005471 | Bacteria | 919 |
| 89 | Ga0070698_101187637 | 3300005471 | Unclassified | 712 |
| 90 | Ga0070698_101789015 | 3300005471 | Unclassified | 567 |
| 91 | Ga0070699_100009857 | 3300005518 | Bacteria | 8273 |
| 92 | Ga0070699_100015555 | 3300005518 | Bacteria | 6539 |
| 93 | Ga0070699_100044947 | 3300005518 | Bacteria | 3823 |
| 94 | Ga0070699_100048538 | 3300005518 | Bacteria | 3674 |
| 95 | Ga0070699_100158662 | 3300005518 | Bacteria | 2001 |
| 96 | Ga0070699_100299456 | 3300005518 | Unclassified | 1443 |
| 97 | Ga0070699_100882857 | 3300005518 | Unclassified | 819 |
| 98 | Ga0070699_102000641 | 3300005518 | Bacteria | 530 |
| 99 | Ga0070679_100853614 | 3300005530 | Bacteria | 854 |
| 100 | Ga0070684_101634629 | 3300005535 | Bacteria | 608 |
| 101 | Ga0070697_100002053 | 3300005536 | Bacteria | 15432 |
| 102 | Ga0070697_100017350 | 3300005536 | Bacteria | 5663 |
| 103 | Ga0070697_100023024 | 3300005536 | Bacteria | 4954 |
| 104 | Ga0070697_100027704 | 3300005536 | Bacteria | 4534 |
| 105 | Ga0070697_100054473 | 3300005536 | Bacteria | 3251 |
| 106 | Ga0070697_100158485 | 3300005536 | Bacteria | 1912 |
| 107 | Ga0070697_100246606 | 3300005536 | Bacteria | 1526 |
| 108 | Ga0070697_100497407 | 3300005536 | Unclassified | 1066 |
| 109 | Ga0068853_100616461 | 3300005539 | Unclassified | 1031 |
| 110 | Ga0070686_100058424 | 3300005544 | Bacteria | 2481 |
| 111 | Ga0070695_100008396 | 3300005545 | Bacteria | 6131 |
| 112 | Ga0070695_100062964 | 3300005545 | Unclassified | 2410 |
| 113 | Ga0070695_100077054 | 3300005545 | Unclassified | 2196 |
| 114 | Ga0070695_100151092 | 3300005545 | Bacteria | 1621 |
| 115 | Ga0070695_100234006 | 3300005545 | Bacteria | 1329 |
| 116 | Ga0070695_100306460 | 3300005545 | Unclassified | 1176 |
| 117 | Ga0070695_100489270 | 3300005545 | Bacteria | 949 |
| 118 | Ga0070695_101806485 | 3300005545 | Bacteria | 513 |
| 119 | Ga0070696_100000947 | 3300005546 | Bacteria | 18832 |
| 120 | Ga0070696_100032403 | 3300005546 | Bacteria | 3585 |
| 121 | Ga0070696_100037249 | 3300005546 | Bacteria | 3355 |
| 122 | Ga0070696_100045833 | 3300005546 | Bacteria | 3030 |
| 123 | Ga0070696_100061369 | 3300005546 | Bacteria | 2630 |
| 124 | Ga0070696_100144302 | 3300005546 | Bacteria | 1742 |
| 125 | Ga0070696_100234834 | 3300005546 | Bacteria | 1381 |
| 126 | Ga0070696_100274918 | 3300005546 | Unclassified | 1282 |
| 127 | Ga0070696_100491469 | 3300005546 | Bacteria | 975 |
| 128 | Ga0070693_100181685 | 3300005547 | Bacteria | 1354 |
| 129 | Ga0070693_100576432 | 3300005547 | Bacteria | 809 |
| 130 | Ga0070693_100861683 | 3300005547 | Bacteria | 676 |
| 131 | Ga0070704_100012305 | 3300005549 | Bacteria | 5284 |
| 132 | Ga0070704_100105568 | 3300005549 | Bacteria | 2133 |
| 133 | Ga0070704_100129919 | 3300005549 | Unclassified | 1950 |
| 134 | Ga0070704_100195090 | 3300005549 | Unclassified | 1630 |
| 135 | Ga0070704_100217054 | 3300005549 | Unclassified | 1553 |
| 136 | Ga0070704_101514708 | 3300005549 | Bacteria | 617 |
| 137 | Ga0068855_100295850 | 3300005563 | Bacteria | 1794 |
| 138 | Ga0068855_100618933 | 3300005563 | Unclassified | 1166 |
| 139 | Ga0068857_100234709 | 3300005577 | Unclassified | 1678 |
| 140 | Ga0068857_100332390 | 3300005577 | Unclassified | 1405 |
| 141 | Ga0068854_100251193 | 3300005578 | Unclassified | 1412 |
| 142 | Ga0068854_101052296 | 3300005578 | Bacteria | 723 |
| 143 | Ga0070702_100053284 | 3300005615 | Bacteria | 2323 |
| 144 | Ga0070702_100099728 | 3300005615 | Unclassified | 1779 |
| 145 | Ga0070702_101092942 | 3300005615 | Bacteria | 637 |
| 146 | Ga0068852_101665646 | 3300005616 | Unclassified | 660 |
| 147 | Ga0068861_100072048 | 3300005719 | Unclassified | 2680 |
| 148 | Ga0068861_100711658 | 3300005719 | Unclassified | 934 |
| 149 | Ga0068860_100062870 | 3300005843 | Bacteria | 3527 |
| 150 | Ga0068860_100096622 | 3300005843 | Bacteria | 2816 |
| 151 | Ga0068860_101228514 | 3300005843 | Bacteria | 770 |
| 152 | Ga0068860_101255533 | 3300005843 | Bacteria | 761 |
| 153 | Ga0068862_100300118 | 3300005844 | Bacteria | 1477 |
| 154 | Ga0068862_100516720 | 3300005844 | Bacteria | 1136 |
| 155 | Ga0068862_101478099 | 3300005844 | Bacteria | 684 |
| 156 | Ga0081538_10121345 | 3300005981 | Bacteria | 1255 |
| 157 | Ga0081539_10008188 | 3300005985 | Bacteria | 9210 |
| 158 | Ga0081539_10342818 | 3300005985 | Bacteria | 630 |
| 159 | Ga0070716_100255216 | 3300006173 | Unclassified | 1197 |
| 160 | Ga0070716_100935899 | 3300006173 | Bacteria | 681 |
| 161 | Ga0070716_101428139 | 3300006173 | Unclassified | 563 |
| 162 | Ga0070712_100815698 | 3300006175 | Bacteria | 801 |
| 163 | Ga0097621_100636291 | 3300006237 | Unclassified | 978 |
| 164 | Ga0075428_100000219 | 3300006844 | Bacteria | 55414 |
| 165 | Ga0075428_100335561 | 3300006844 | Unclassified | 1624 |
| 166 | Ga0075428_102253636 | 3300006844 | Archaea | 561 |
| 167 | Ga0075431_100224370 | 3300006847 | Bacteria | 1916 |
| 168 | Ga0075433_10034667 | 3300006852 | Bacteria | 4336 |
| 169 | Ga0075433_10052542 | 3300006852 | Bacteria | 3551 |
| 170 | Ga0075433_10072483 | 3300006852 | Bacteria | 3029 |
| 171 | Ga0075433_10958574 | 3300006852 | Bacteria | 746 |
| 172 | Ga0075433_11766992 | 3300006852 | Archaea | 532 |
| 173 | Ga0075434_100044017 | 3300006871 | Bacteria | 4428 |
| 174 | Ga0075434_100548274 | 3300006871 | Bacteria | 1176 |
| 175 | Ga0075434_100640903 | 3300006871 | Bacteria | 1081 |
| 176 | Ga0068865_100058228 | 3300006881 | Bacteria | 2698 |
| 177 | Ga0068865_100495145 | 3300006881 | Unclassified | 1018 |
| 178 | Ga0068865_100631805 | 3300006881 | Bacteria | 908 |
| 179 | Ga0075436_100096293 | 3300006914 | Bacteria | 2059 |
| 180 | Ga0075436_100191080 | 3300006914 | Bacteria | 1449 |
| 181 | Ga0075436_100262837 | 3300006914 | Bacteria | 1231 |
| 182 | Ga0075436_100706125 | 3300006914 | Unclassified | 747 |
| 183 | Ga0075435_100065290 | 3300007076 | Bacteria | 2958 |
| 184 | Ga0075435_100081902 | 3300007076 | Bacteria | 2652 |
| 185 | Ga0075435_100387371 | 3300007076 | Bacteria | 1201 |
| 186 | Ga0075435_100452686 | 3300007076 | Bacteria | 1107 |
| 187 | Ga0105250_10355726 | 3300009092 | Unclassified | 642 |
| 188 | Ga0105240_11215893 | 3300009093 | Unclassified | 797 |
| 189 | Ga0111539_10021644 | 3300009094 | Bacteria | 7909 |
| 190 | Ga0111539_10118777 | 3300009094 | Bacteria | 3099 |
| 191 | Ga0111539_13420602 | 3300009094 | Bacteria | 510 |
| 192 | Ga0105245_10063615 | 3300009098 | Bacteria | 3332 |
| 193 | Ga0105245_10069042 | 3300009098 | Bacteria | 3204 |
| 194 | Ga0105245_10259076 | 3300009098 | Unclassified | 1692 |
| 195 | Ga0105245_10469663 | 3300009098 | Bacteria | 1269 |
| 196 | Ga0105245_10505655 | 3300009098 | Bacteria | 1225 |
| 197 | Ga0105245_11217491 | 3300009098 | Unclassified | 801 |
| 198 | Ga0105245_12987731 | 3300009098 | Bacteria | 524 |
| 199 | Ga0114129_10000738 | 3300009147 | Bacteria | 41604 |
| 200 | Ga0114129_10056093 | 3300009147 | Bacteria | 5520 |
| 201 | Ga0105243_10111020 | 3300009148 | Bacteria | 2294 |
| 202 | Ga0105243_10410100 | 3300009148 | Bacteria | 1261 |
| 203 | Ga0105243_10571740 | 3300009148 | Bacteria | 1083 |
| 204 | Ga0105243_10735843 | 3300009148 | Unclassified | 965 |
| 205 | Ga0105243_10742428 | 3300009148 | Bacteria | 961 |
| 206 | Ga0105243_10913863 | 3300009148 | Bacteria | 874 |
| 207 | Ga0105243_13034043 | 3300009148 | Bacteria | 509 |
| 208 | Ga0105241_10522649 | 3300009174 | Unclassified | 1061 |
| 209 | Ga0105242_10248341 | 3300009176 | Unclassified | 1602 |
| 210 | Ga0105242_10907711 | 3300009176 | Unclassified | 881 |
| 211 | Ga0105242_10928301 | 3300009176 | Bacteria | 873 |
| 212 | Ga0105242_11702386 | 3300009176 | Unclassified | 667 |
| 213 | Ga0105242_11764176 | 3300009176 | Unclassified | 656 |
| 214 | Ga0105242_12109006 | 3300009176 | Bacteria | 608 |
| 215 | Ga0105242_12220897 | 3300009176 | Unclassified | 594 |
| 216 | Ga0105248_10643200 | 3300009177 | Bacteria | 1197 |
| 217 | Ga0105248_10884111 | 3300009177 | Bacteria | 1009 |
| 218 | Ga0105238_10334328 | 3300009551 | Bacteria | 1502 |
| 219 | Ga0105249_10094980 | 3300009553 | Bacteria | 2795 |
| 220 | Ga0105249_10232905 | 3300009553 | Bacteria | 1817 |
| 221 | Ga0105249_10290173 | 3300009553 | Unclassified | 1637 |
| 222 | Ga0105249_10376990 | 3300009553 | Bacteria | 1444 |
| 223 | Ga0105249_11264916 | 3300009553 | Bacteria | 809 |
| 224 | Ga0099796_10515263 | 3300010159 | Unclassified | 536 |
| 225 | Ga0105239_10204150 | 3300010375 | Bacteria | 2214 |
| 226 | Ga0105239_10299849 | 3300010375 | Unclassified | 1810 |
| 227 | Ga0105239_11261497 | 3300010375 | Bacteria | 852 |
| 228 | Ga0105246_10150045 | 3300011119 | Bacteria | 1763 |
| 229 | Ga0105246_12260175 | 3300011119 | Unclassified | 530 |
| 230 | Ga0157325_1034347 | 3300012485 | Unclassified | 524 |
| 231 | Ga0157323_1022135 | 3300012495 | Unclassified | 614 |
| 232 | Ga0157373_11328178 | 3300013100 | Bacteria | 545 |
| 233 | Ga0157374_10882785 | 3300013296 | Bacteria | 911 |
| 234 | Ga0157374_10931697 | 3300013296 | Bacteria | 887 |
| 235 | Ga0157374_11732533 | 3300013296 | Bacteria | 650 |
| 236 | Ga0157378_10153498 | 3300013297 | Bacteria | 2147 |
| 237 | Ga0157378_10201917 | 3300013297 | Bacteria | 1881 |
| 238 | Ga0157378_10354378 | 3300013297 | Bacteria | 1434 |
| 239 | Ga0157378_11372181 | 3300013297 | Bacteria | 749 |
| 240 | Ga0157378_11377876 | 3300013297 | Bacteria | 748 |
| 241 | Ga0163162_10596719 | 3300013306 | Unclassified | 1231 |
| 242 | Ga0163162_11260240 | 3300013306 | Bacteria | 840 |
| 243 | Ga0157372_10415662 | 3300013307 | Bacteria | 1567 |
| 244 | Ga0157372_10570311 | 3300013307 | Unclassified | 1319 |
| 245 | Ga0157372_11331912 | 3300013307 | Bacteria | 828 |
| 246 | Ga0157375_10369870 | 3300013308 | Unclassified | 1600 |
| 247 | Ga0157375_12272268 | 3300013308 | Archaea | 646 |
| 248 | Ga0163163_10027493 | 3300014325 | Bacteria | 5450 |
| 249 | Ga0163163_11712723 | 3300014325 | Bacteria | 689 |
| 250 | Ga0163163_12241633 | 3300014325 | Unclassified | 605 |
| 251 | Ga0157380_10692890 | 3300014326 | Unclassified | 1023 |
| 252 | Ga0182008_10033608 | 3300014497 | Unclassified | 2573 |
| 253 | Ga0182008_10362119 | 3300014497 | Bacteria | 771 |
| 254 | Ga0157377_10162272 | 3300014745 | Unclassified | 1391 |
| 255 | Ga0157377_10226952 | 3300014745 | Unclassified | 1199 |
| 256 | Ga0157377_11484304 | 3300014745 | Unclassified | 538 |
| 257 | Ga0157379_10380949 | 3300014968 | Bacteria | 1294 |
| 258 | Ga0157379_12608548 | 3300014968 | Unclassified | 506 |
| 259 | Ga0157376_10324454 | 3300014969 | Bacteria | 1465 |
| 260 | Ga0157376_10540001 | 3300014969 | Bacteria | 1152 |
| 261 | Ga0157376_11568149 | 3300014969 | Bacteria | 692 |
| 262 | Ga0207653_10020526 | 3300025885 | Unclassified | 2091 |
| 263 | Ga0207653_10084252 | 3300025885 | Bacteria | 1105 |
| 264 | Ga0207653_10184681 | 3300025885 | Bacteria | 781 |
| 265 | Ga0207688_10113309 | 3300025901 | Bacteria | 1576 |
| 266 | Ga0207688_10147585 | 3300025901 | Unclassified | 1387 |
| 267 | Ga0207647_10796297 | 3300025904 | Unclassified | 509 |
| 268 | Ga0207645_10296942 | 3300025907 | Bacteria | 1075 |
| 269 | Ga0207645_10405880 | 3300025907 | Bacteria | 917 |
| 270 | Ga0207684_10012109 | 3300025910 | Bacteria | 7510 |
| 271 | Ga0207684_10012499 | 3300025910 | Bacteria | 7380 |
| 272 | Ga0207684_10020370 | 3300025910 | Bacteria | 5666 |
| 273 | Ga0207684_10052627 | 3300025910 | Bacteria | 3456 |
| 274 | Ga0207684_10160841 | 3300025910 | Unclassified | 1934 |
| 275 | Ga0207684_10257344 | 3300025910 | Unclassified | 1506 |
| 276 | Ga0207684_10536349 | 3300025910 | Bacteria | 1002 |
| 277 | Ga0207684_11298265 | 3300025910 | Unclassified | 599 |
| 278 | Ga0207660_10000001 | 3300025917 | Bacteria | 1034169 |
| 279 | Ga0207660_10544880 | 3300025917 | Unclassified | 943 |
| 280 | Ga0207662_10131707 | 3300025918 | Bacteria | 1577 |
| 281 | Ga0207662_10289050 | 3300025918 | Bacteria | 1087 |
| 282 | Ga0207662_10386911 | 3300025918 | Unclassified | 946 |
| 283 | Ga0207657_10743748 | 3300025919 | Bacteria | 760 |
| 284 | Ga0207652_10448312 | 3300025921 | Unclassified | 1163 |
| 285 | Ga0207646_10001570 | 3300025922 | Bacteria | 27969 |
| 286 | Ga0207646_10028092 | 3300025922 | Bacteria | 5124 |
| 287 | Ga0207646_10047024 | 3300025922 | Bacteria | 3871 |
| 288 | Ga0207646_10170937 | 3300025922 | Bacteria | 1962 |
| 289 | Ga0207646_10172138 | 3300025922 | Bacteria | 1955 |
| 290 | Ga0207646_10540642 | 3300025922 | Bacteria | 1048 |
| 291 | Ga0207646_10736371 | 3300025922 | Unclassified | 880 |
| 292 | Ga0207646_10786817 | 3300025922 | Bacteria | 848 |
| 293 | Ga0207646_10831763 | 3300025922 | Bacteria | 821 |
| 294 | Ga0207694_10446743 | 3300025924 | Bacteria | 1079 |
| 295 | Ga0207659_10413507 | 3300025926 | Unclassified | 1130 |
| 296 | Ga0207659_10617811 | 3300025926 | Unclassified | 925 |
| 297 | Ga0207687_10110006 | 3300025927 | Unclassified | 2043 |
| 298 | Ga0207687_10110441 | 3300025927 | Bacteria | 2039 |
| 299 | Ga0207687_10274790 | 3300025927 | Bacteria | 1348 |
| 300 | Ga0207687_10706308 | 3300025927 | Bacteria | 856 |
| 301 | Ga0207687_11272636 | 3300025927 | Bacteria | 632 |
| 302 | Ga0207706_10018442 | 3300025933 | Bacteria | 6280 |
| 303 | Ga0207706_10246626 | 3300025933 | Unclassified | 1561 |
| 304 | Ga0207686_10226712 | 3300025934 | Bacteria | 1352 |
| 305 | Ga0207686_10347580 | 3300025934 | Bacteria | 1115 |
| 306 | Ga0207686_10732082 | 3300025934 | Bacteria | 788 |
| 307 | Ga0207686_10872815 | 3300025934 | Unclassified | 725 |
| 308 | Ga0207709_10061950 | 3300025935 | Bacteria | 2339 |
| 309 | Ga0207709_10431589 | 3300025935 | Bacteria | 1014 |
| 310 | Ga0207709_10559598 | 3300025935 | Unclassified | 900 |
| 311 | Ga0207669_10183489 | 3300025937 | Bacteria | 1503 |
| 312 | Ga0207669_11407554 | 3300025937 | Bacteria | 594 |
| 313 | Ga0207704_10150165 | 3300025938 | Unclassified | 1643 |
| 314 | Ga0207691_11534888 | 3300025940 | Bacteria | 543 |
| 315 | Ga0207711_10646325 | 3300025941 | Bacteria | 987 |
| 316 | Ga0207689_10129617 | 3300025942 | Bacteria | 2076 |
| 317 | Ga0207689_10177869 | 3300025942 | Bacteria | 1754 |
| 318 | Ga0207661_10192512 | 3300025944 | Unclassified | 1789 |
| 319 | Ga0207679_10089454 | 3300025945 | Unclassified | 2377 |
| 320 | Ga0207667_10116368 | 3300025949 | Bacteria | 2755 |
| 321 | Ga0207667_10807571 | 3300025949 | Bacteria | 934 |
| 322 | Ga0207651_10605826 | 3300025960 | Bacteria | 958 |
| 323 | Ga0207651_11264218 | 3300025960 | Unclassified | 663 |
| 324 | Ga0207712_10243897 | 3300025961 | Bacteria | 1449 |
| 325 | Ga0207712_10491284 | 3300025961 | Unclassified | 1048 |
| 326 | Ga0207668_10239256 | 3300025972 | Unclassified | 1468 |
| 327 | Ga0207668_10656067 | 3300025972 | Unclassified | 919 |
| 328 | Ga0207640_10149749 | 3300025981 | Unclassified | 1713 |
| 329 | Ga0207640_10780429 | 3300025981 | Bacteria | 826 |
| 330 | Ga0207658_12131294 | 3300025986 | Unclassified | 509 |
| 331 | Ga0207677_10066272 | 3300026023 | Bacteria | 2524 |
| 332 | Ga0207677_10350110 | 3300026023 | Bacteria | 1237 |
| 333 | Ga0207677_11206287 | 3300026023 | Bacteria | 693 |
| 334 | Ga0207678_10671902 | 3300026067 | Unclassified | 911 |
| 335 | Ga0207678_10695712 | 3300026067 | Unclassified | 894 |
| 336 | Ga0207708_10195376 | 3300026075 | Unclassified | 1612 |
| 337 | Ga0207708_10341469 | 3300026075 | Bacteria | 1226 |
| 338 | Ga0207708_10534118 | 3300026075 | Bacteria | 987 |
| 339 | Ga0207702_10323738 | 3300026078 | Bacteria | 1469 |
| 340 | Ga0207648_10474113 | 3300026089 | Bacteria | 1142 |
| 341 | Ga0207676_10980270 | 3300026095 | Bacteria | 832 |
| 342 | Ga0207674_10184657 | 3300026116 | Unclassified | 2036 |
| 343 | Ga0207674_10202707 | 3300026116 | Unclassified | 1933 |
| 344 | Ga0207674_10675175 | 3300026116 | Unclassified | 997 |
| 345 | Ga0207675_100068905 | 3300026118 | Unclassified | 3306 |
| 346 | Ga0207675_100204605 | 3300026118 | Unclassified | 1897 |
| 347 | Ga0207675_100771368 | 3300026118 | Unclassified | 974 |
| 348 | Ga0207683_10050553 | 3300026121 | Bacteria | 3641 |
| 349 | Ga0207683_10837057 | 3300026121 | Bacteria | 854 |
| 350 | Ga0207683_12095911 | 3300026121 | Bacteria | 514 |
| 351 | Ga0207698_12425568 | 3300026142 | Unclassified | 535 |
| 352 | Ga0209983_1078766 | 3300027665 | Bacteria | 738 |
| 353 | Ga0207428_10117258 | 3300027907 | Unclassified | 2044 |
| 354 | Ga0268265_10627792 | 3300028380 | Unclassified | 1030 |
| 355 | Ga0268265_11532888 | 3300028380 | Bacteria | 670 |
| 356 | Ga0268264_10049948 | 3300028381 | Bacteria | 3481 |
| 357 | Ga0268264_10696038 | 3300028381 | Bacteria | 1009 |
| 358 | Ga0268264_11004931 | 3300028381 | Bacteria | 841 |
| 359 | Ga0268264_11181337 | 3300028381 | Bacteria | 774 |
| 360 | Ga0268264_11609563 | 3300028381 | Bacteria | 660 |
| 361 | Ga0265326_10184090 | 3300028558 | Unclassified | 599 |
| 362 | Ga0265319_1017750 | 3300028563 | Bacteria | 2698 |
| 363 | Ga0265319_1283667 | 3300028563 | Bacteria | 503 |
| 364 | Ga0265334_10056107 | 3300028573 | Bacteria | 1497 |
| 365 | Ga0265318_10037932 | 3300028577 | Bacteria | 1844 |
| 366 | Ga0265318_10046987 | 3300028577 | Bacteria | 1629 |
| 367 | Ga0265318_10233930 | 3300028577 | Bacteria | 671 |
| 368 | Ga0265322_10015025 | 3300028654 | Bacteria | 2239 |
| 369 | Ga0265322_10022247 | 3300028654 | Bacteria | 1814 |
| 370 | Ga0265336_10040166 | 3300028666 | Bacteria | 1433 |
| 371 | Ga0265338_10107977 | 3300028800 | Bacteria | 2249 |
| 372 | Ga0265324_10019431 | 3300029957 | Bacteria | 2447 |
| 373 | Ga0265332_10058451 | 3300031238 | Bacteria | 1650 |
| 374 | Ga0265320_10026721 | 3300031240 | Bacteria | 3018 |
| 375 | Ga0265320_10079397 | 3300031240 | Unclassified | 1534 |
| 376 | Ga0265325_10032610 | 3300031241 | Bacteria | 2780 |
| 377 | Ga0265329_10047703 | 3300031242 | Bacteria | 1367 |
| 378 | Ga0265340_10029397 | 3300031247 | Bacteria | 2760 |
| 379 | Ga0265339_10080486 | 3300031249 | Bacteria | 1722 |
| 380 | Ga0265339_10250500 | 3300031249 | Bacteria | 857 |
| 381 | Ga0265316_10063139 | 3300031344 | Bacteria | 2873 |
| 382 | Ga0307408_100497912 | 3300031548 | Unclassified | 1066 |
| 383 | Ga0265314_10015810 | 3300031711 | Bacteria | 5975 |
| 384 | Ga0265342_10087745 | 3300031712 | Bacteria | 1787 |
| 385 | Ga0307405_12005986 | 3300031731 | Bacteria | 518 |
| 386 | Ga0307413_10268544 | 3300031824 | Bacteria | 1276 |
| 387 | Ga0307410_10052744 | 3300031852 | Unclassified | 2749 |
| 388 | Ga0307410_10530367 | 3300031852 | Unclassified | 973 |
| 389 | Ga0307410_10672534 | 3300031852 | Bacteria | 870 |
| 390 | Ga0307407_10603669 | 3300031903 | Unclassified | 817 |
| 391 | Ga0307407_10873370 | 3300031903 | Bacteria | 688 |
| 392 | Ga0307407_10884074 | 3300031903 | Unclassified | 685 |
| 393 | Ga0307412_10974513 | 3300031911 | Unclassified | 748 |
| 394 | Ga0307409_100330124 | 3300031995 | Bacteria | 1431 |
| 395 | Ga0307409_100390738 | 3300031995 | Bacteria | 1326 |
| 396 | Ga0307409_101650454 | 3300031995 | Unclassified | 669 |
| 397 | Ga0307409_101690343 | 3300031995 | Bacteria | 662 |
| 398 | Ga0307416_101455316 | 3300032002 | Bacteria | 791 |
| 399 | Ga0307416_101868618 | 3300032002 | Bacteria | 704 |
| 400 | Ga0307416_102190833 | 3300032002 | Unclassified | 654 |
| 401 | Ga0307411_10502868 | 3300032005 | Bacteria | 1025 |
| 402 | Ga0307411_10585804 | 3300032005 | Bacteria | 957 |
| 403 | Ga0307415_101629307 | 3300032126 | Unclassified | 621 |
| 404 | Ga0373959_0131475 | 3300034820 | Bacteria | 620 |
| 405 | Ga0373926_0344716 | 3300035083 | Unclassified | 584 |
| 406 | Ga0373929_0179602 | 3300035085 | Bacteria | 583 |
| 407 | Ga0373932_0207689 | 3300035112 | Unclassified | 699 |
| 408 | Ga0373941_0150442 | 3300035115 | Unclassified | 854 |
| 409 | Ga0373960_0375584 | 3300035121 | Bacteria | 544 |
| 410 | Ga0373943_0080086 | 3300035170 | Unclassified | 1673 |
| 411 | Ga0373943_0770298 | 3300035170 | Bacteria | 572 |
| 412 | Ga0373942_0334110 | 3300035207 | Unclassified | 532 |
| 413 | Ga0373962_0034715 | 3300035242 | Unclassified | 1398 |
| 414 | Ga0373962_0270982 | 3300035242 | Unclassified | 595 |
| 415 | Ga0373931_0088932 | 3300035691 | Unclassified | 1718 |
| 416 | Ga0373947_0130215 | 3300035725 | Unclassified | 1606 |
| 417 | Ga0373947_1056858 | 3300035725 | Bacteria | 554 |
| 418 | Ga0373937_0083843 | 3300036401 | Bacteria | 2949 |
| 419 | Ga0373937_0742723 | 3300036401 | Unclassified | 929 |
| 420 | Ga0373937_0815235 | 3300036401 | Unclassified | 881 |
| 421 | Ga0373937_1071420 | 3300036401 | Bacteria | 755 |
| 422 | Ga0373925_1103981 | 3300037068 | Unclassified | 653 |
| 423 | Ga0395900_1032906 | 3300037418 | Unclassified | 741 |
| 424 | Ga0436365_0765767 | 3300039437 | Bacteria | 5081 |
| 425 | Ga0451787_687447 | 3300041441 | Bacteria | 538 |
| 426 | Ga0451798_0280315 | 3300041458 | Bacteria | 814 |
| 427 | Ga0451800_0031615 | 3300041459 | Bacteria | 1076 |
| 428 | Ga0451802_1199723 | 3300041460 | Unclassified | 509 |
| 429 | Ga0451835_0607610 | 3300041492 | Unclassified | 1012 |
| 430 | Ga0451845_0979702 | 3300041501 | Bacteria | 1131 |
| 431 | Ga0451849_0510238 | 3300041505 | Bacteria | 629 |
| 432 | Ga0451849_0732597 | 3300041505 | Bacteria | 696 |
| 433 | Ga0451849_1315850 | 3300041505 | Unclassified | 557 |
| 434 | Ga0451851_1267513 | 3300041507 | Bacteria | 518 |
| 435 | Ga0451843_0341974 | 3300041509 | Bacteria | 706 |
| 436 | Ga0451853_0721060 | 3300041512 | Unclassified | 4044 |
| 437 | Ga0451853_1062934 | 3300041512 | Bacteria | 663 |
| 438 | Ga0451853_2459620 | 3300041512 | Unclassified | 593 |
| 439 | Ga0451853_3135647 | 3300041512 | Bacteria | 811 |
| 440 | Ga0451853_3169035 | 3300041512 | Bacteria | 784 |
| 441 | Ga0451853_3341543 | 3300041512 | Bacteria | 1930 |
| 442 | Ga0451853_3807259 | 3300041512 | Bacteria | 901 |
| 443 | Ga0439441_055415 | 3300042001 | Unclassified | 825 |
| 444 | Ga0439456_164624 | 3300042013 | Unclassified | 520 |
| 445 | Ga0450923_056310 | 3300042125 | Bacteria | 852 |
| 446 | Ga0450905_071183 | 3300042142 | Bacteria | 593 |
| 447 | Ga0450906_021369 | 3300042145 | Bacteria | 1157 |
| 448 | Ga0450910_027036 | 3300042147 | Bacteria | 888 |
| 449 | Ga0450910_055084 | 3300042147 | Bacteria | 663 |
| 450 | Ga0439435_0010683 | 3300042436 | Bacteria | 2186 |
| 451 | Ga0451577_0434987 | 3300042876 | Bacteria | 1191 |
| 452 | Ga0451577_0771813 | 3300042876 | Bacteria | 869 |
| 453 | Ga0451577_1110290 | 3300042876 | Bacteria | 707 |
| 454 | Ga0453683_0193716 | 3300044673 | Bacteria | 1290 |
| 455 | Ga0453683_0358927 | 3300044673 | Unclassified | 937 |
| 456 | Ga0451576_0369598 | 3300045051 | Bacteria | 1502 |
| 457 | Ga0451576_0590075 | 3300045051 | Bacteria | 1168 |
| 458 | Ga0466967_2356843 | 3300045976 | Bacteria | 528 |
| 459 | Ga0495603_0098059 | 3300046455 | Bacteria | 1712 |
| 460 | Ga0495653_0925502 | 3300046463 | Bacteria | 518 |
| 461 | Ga0495582_0919421 | 3300046473 | Bacteria | 506 |
| 462 | Ga0495584_0434380 | 3300046491 | Bacteria | 668 |
| 463 | Ga0495607_0367061 | 3300046501 | Bacteria | 661 |
| 464 | Ga0495608_0763669 | 3300046511 | Bacteria | 572 |
| 465 | Ga0495618_0371116 | 3300046514 | Bacteria | 879 |
| 466 | Ga0495618_0557904 | 3300046514 | Bacteria | 685 |
| 467 | Ga0495630_0490663 | 3300046517 | Bacteria | 942 |
| 468 | Ga0495667_0437029 | 3300046559 | Unclassified | 823 |
| 469 | Ga0495635_0146976 | 3300046663 | Unclassified | 1605 |
| 470 | Ga0495659_0344757 | 3300046664 | Bacteria | 636 |
| 471 | Ga0495588_0185584 | 3300046674 | Bacteria | 1099 |
| 472 | Ga0495657_0074615 | 3300046675 | Bacteria | 2207 |
| 473 | Ga0495657_0377776 | 3300046675 | Unclassified | 836 |
| 474 | Ga0495599_0813382 | 3300046678 | Unclassified | 533 |
| 475 | Ga0495647_0191575 | 3300046681 | Bacteria | 894 |
| 476 | Ga0495647_0329453 | 3300046681 | Bacteria | 692 |
| 477 | Ga0495658_0248725 | 3300046683 | Bacteria | 1118 |
| 478 | Ga0495658_0392165 | 3300046683 | Unclassified | 885 |
| 479 | Ga0495658_0401971 | 3300046683 | Bacteria | 873 |
| 480 | Ga0495670_0336673 | 3300046691 | Unclassified | 811 |
| 481 | Ga0495589_0582820 | 3300046794 | Bacteria | 510 |
| 482 | Ga0495604_0237781 | 3300047317 | Unclassified | 1247 |
| 483 | Ga0495674_0072465 | 3300047319 | Bacteria | 2971 |
| 484 | Ga0495674_0973219 | 3300047319 | Bacteria | 652 |
| 485 | Ga0495676_0815032 | 3300047321 | Bacteria | 601 |
| 486 | Ga0495680_0071659 | 3300047322 | Unclassified | 2638 |
| 487 | Ga0495602_0466291 | 3300048088 | Unclassified | 889 |
| 488 | Ga0496100_0082027 | 3300048903 | Unclassified | 2180 |
| 489 | Ga0496100_0208908 | 3300048903 | Unclassified | 1427 |
| 490 | Ga0496100_0769048 | 3300048903 | Bacteria | 754 |
| 491 | Ga0496101_0063247 | 3300048904 | Unclassified | 2693 |
| 492 | Ga0496101_0209452 | 3300048904 | Bacteria | 1510 |
| 493 | Ga0496101_0419361 | 3300048904 | Bacteria | 1055 |
| 494 | Ga0496101_0962098 | 3300048904 | Bacteria | 672 |
| 495 | Ga0496102_0032699 | 3300048905 | Bacteria | 4674 |
| 496 | Ga0496102_0089110 | 3300048905 | Bacteria | 2854 |
| 497 | Ga0496102_0144998 | 3300048905 | Unclassified | 2228 |
| 498 | Ga0496102_0235666 | 3300048905 | Unclassified | 1726 |
| 499 | Ga0496102_0248225 | 3300048905 | Bacteria | 1678 |
| 500 | Ga0496102_0602213 | 3300048905 | Unclassified | 1022 |
| 501 | Ga0496102_0640525 | 3300048905 | Bacteria | 986 |
| 502 | Ga0496102_1080801 | 3300048905 | Unclassified | 722 |
| 503 | Ga0496103_0023198 | 3300048906 | Bacteria | 3741 |
| 504 | Ga0496103_0062565 | 3300048906 | Archaea | 2317 |
| 505 | Ga0496103_0130956 | 3300048906 | Bacteria | 1602 |
| 506 | Ga0496103_0190691 | 3300048906 | Bacteria | 1318 |
| 507 | Ga0496103_0193456 | 3300048906 | Bacteria | 1308 |
| 508 | Ga0496104_0031392 | 3300048907 | Bacteria | 4940 |
| 509 | Ga0496104_0057140 | 3300048907 | Bacteria | 3692 |
| 510 | Ga0496105_0029703 | 3300048908 | Bacteria | 4475 |
| 511 | Ga0496105_0032184 | 3300048908 | Bacteria | 4303 |
| 512 | Ga0496106_0048480 | 3300048909 | Bacteria | 3199 |
| 513 | Ga0496106_0071570 | 3300048909 | Bacteria | 2651 |
| 514 | Ga0496106_0155286 | 3300048909 | Unclassified | 1807 |
| 515 | Ga0496106_0242305 | 3300048909 | Bacteria | 1441 |
| 516 | Ga0496106_0371138 | 3300048909 | Unclassified | 1150 |
| 517 | Ga0496106_0585225 | 3300048909 | Unclassified | 894 |
| 518 | Ga0496107_0091672 | 3300048910 | Bacteria | 2221 |
| 519 | Ga0496107_0783950 | 3300048910 | Bacteria | 698 |
| 520 | Ga0496107_0953524 | 3300048910 | Bacteria | 624 |
| 521 | Ga0496108_0008582 | 3300048911 | Bacteria | 8287 |
| 522 | Ga0496108_0149691 | 3300048911 | Unclassified | 2014 |
| 523 | Ga0496108_0265445 | 3300048911 | Bacteria | 1494 |
| 524 | Ga0496108_0462999 | 3300048911 | Unclassified | 1108 |
| 525 | Ga0496109_0011146 | 3300048912 | Bacteria | 7710 |
| 526 | Ga0496109_0011762 | 3300048912 | Bacteria | 7531 |
| 527 | Ga0496109_0196175 | 3300048912 | Bacteria | 1898 |
| 528 | Ga0496109_0203719 | 3300048912 | Bacteria | 1860 |
| 529 | Ga0496109_1321111 | 3300048912 | Unclassified | 657 |
| 530 | Ga0496110_0053483 | 3300048913 | Bacteria | 3550 |
| 531 | Ga0496110_0071357 | 3300048913 | Bacteria | 3079 |
| 532 | Ga0496111_0005402 | 3300048914 | Bacteria | 8184 |
| 533 | Ga0496111_0098635 | 3300048914 | Bacteria | 2145 |
| 534 | Ga0496111_0341462 | 3300048914 | Bacteria | 1108 |
| 535 | Ga0496112_0000005 | 3300048915 | Bacteria | 525541 |
| 536 | Ga0496112_0025792 | 3300048915 | Bacteria | 5646 |
| 537 | Ga0496112_0151165 | 3300048915 | Bacteria | 2289 |
| 538 | Ga0496112_0334790 | 3300048915 | Unclassified | 1457 |
| 539 | Ga0496112_1325012 | 3300048915 | Unclassified | 635 |
| 540 | Ga0496113_0044353 | 3300048916 | Bacteria | 3294 |
| 541 | Ga0496113_0218272 | 3300048916 | Unclassified | 1519 |
| 542 | Ga0496113_0312082 | 3300048916 | Bacteria | 1260 |
| 543 | Ga0496113_1042788 | 3300048916 | Bacteria | 643 |
| 544 | Ga0496113_1101019 | 3300048916 | Unclassified | 623 |
| 545 | Ga0496114_0061694 | 3300048917 | Bacteria | 3136 |
| 546 | Ga0496114_0115533 | 3300048917 | Bacteria | 2303 |
| 547 | Ga0496114_0275545 | 3300048917 | Bacteria | 1483 |
| 548 | Ga0496114_1513749 | 3300048917 | Bacteria | 559 |
| 549 | Ga0496115_0677056 | 3300048918 | Bacteria | 813 |
| 550 | Ga0501031_0022983 | 3300049568 | Bacteria | 4066 |
| 551 | Ga0501031_0732592 | 3300049568 | Bacteria | 634 |
| 552 | Ga0501033_0038777 | 3300049570 | Unclassified | 3559 |
| 553 | Ga0501034_0672896 | 3300049571 | Bacteria | 935 |
| 554 | Ga0501036_0010781 | 3300049572 | Bacteria | 7553 |
| 555 | Ga0501036_0761502 | 3300049572 | Bacteria | 798 |
| 556 | Ga0501037_0148915 | 3300049573 | Unclassified | 1673 |
| 557 | Ga0501038_0014355 | 3300049574 | Bacteria | 7218 |
| 558 | Ga0501038_0121349 | 3300049574 | Unclassified | 2155 |
| 559 | Ga0501038_0192742 | 3300049574 | Bacteria | 1639 |
| 560 | Ga0501039_0025325 | 3300049575 | Bacteria | 4557 |
| 561 | Ga0501039_0461657 | 3300049575 | Bacteria | 997 |
| 562 | Ga0501039_0552267 | 3300049575 | Unclassified | 904 |
| 563 | Ga0501040_0012754 | 3300049576 | Bacteria | 5516 |
| 564 | Ga0501040_0201826 | 3300049576 | Bacteria | 1412 |
| 565 | Ga0501040_0683610 | 3300049576 | Bacteria | 742 |
| 566 | Ga0501040_1200290 | 3300049576 | Unclassified | 550 |
| 567 | Ga0501041_0001964 | 3300049577 | Bacteria | 11557 |
| 568 | Ga0501042_0105504 | 3300049578 | Unclassified | 2028 |
| 569 | Ga0501042_0136750 | 3300049578 | Unclassified | 1766 |
| 570 | Ga0501042_0866946 | 3300049578 | Unclassified | 657 |
| 571 | Ga0501043_0065106 | 3300049579 | Unclassified | 2862 |
| 572 | Ga0501046_0018989 | 3300049580 | Bacteria | 5706 |
| 573 | Ga0501048_0058634 | 3300049582 | Unclassified | 2728 |
| 574 | Ga0501048_0580269 | 3300049582 | Unclassified | 805 |
| 575 | Ga0501067_0002998 | 3300049583 | Bacteria | 9316 |
| 576 | Ga0501067_0071909 | 3300049583 | Bacteria | 1916 |
| 577 | Ga0501067_0120781 | 3300049583 | Unclassified | 1458 |
| 578 | Ga0501067_0666324 | 3300049583 | Bacteria | 584 |
| 579 | Ga0501068_0057398 | 3300049584 | Unclassified | 2360 |
| 580 | Ga0501068_0073378 | 3300049584 | Bacteria | 2091 |
| 581 | Ga0501068_0155224 | 3300049584 | Unclassified | 1440 |
| 582 | Ga0501068_0238634 | 3300049584 | Bacteria | 1157 |
| 583 | Ga0501069_0010166 | 3300049585 | Bacteria | 4977 |
| 584 | Ga0501069_0019369 | 3300049585 | Bacteria | 3679 |
| 585 | Ga0501069_0267089 | 3300049585 | Unclassified | 1000 |
| 586 | Ga0501070_0008559 | 3300049586 | Bacteria | 8649 |
| 587 | Ga0501070_0362316 | 3300049586 | Unclassified | 1176 |
| 588 | Ga0501071_0155274 | 3300049587 | Bacteria | 1708 |
| 589 | Ga0501071_0886627 | 3300049587 | Unclassified | 688 |
| 590 | Ga0501071_1116195 | 3300049587 | Unclassified | 609 |
| 591 | Ga0501071_1242718 | 3300049587 | Unclassified | 575 |
| 592 | Ga0501071_1415265 | 3300049587 | Bacteria | 537 |
| 593 | Ga0501072_0008571 | 3300049588 | Bacteria | 7755 |
| 594 | Ga0501072_0078557 | 3300049588 | Bacteria | 2613 |
| 595 | Ga0501072_0440366 | 3300049588 | Unclassified | 1032 |
| 596 | Ga0501072_0694582 | 3300049588 | Bacteria | 800 |
| 597 | Ga0501072_0866983 | 3300049588 | Bacteria | 706 |
| 598 | Ga0501072_0870625 | 3300049588 | Unclassified | 704 |
| 599 | Ga0501073_0034131 | 3300049589 | Unclassified | 3622 |
| 600 | Ga0501074_0186885 | 3300049590 | Bacteria | 1477 |
| 601 | Ga0501074_0885610 | 3300049590 | Bacteria | 628 |
| 602 | Ga0501075_0003922 | 3300049591 | Bacteria | 10022 |
| 603 | Ga0501075_0110039 | 3300049591 | Bacteria | 2095 |
| 604 | Ga0501075_0367777 | 3300049591 | Bacteria | 1096 |
| 605 | Ga0501075_0447922 | 3300049591 | Unclassified | 984 |
| 606 | Ga0501075_0469830 | 3300049591 | Unclassified | 959 |
| 607 | Ga0501075_0560867 | 3300049591 | Bacteria | 871 |
| 608 | Ga0501076_0012429 | 3300049592 | Bacteria | 6363 |
| 609 | Ga0501076_0035128 | 3300049592 | Bacteria | 3922 |
| 610 | Ga0501076_0052652 | 3300049592 | Unclassified | 3225 |
| 611 | Ga0501076_1380492 | 3300049592 | Bacteria | 579 |
| 612 | Ga0501077_0007873 | 3300049593 | Bacteria | 6582 |
| 613 | Ga0501077_0363634 | 3300049593 | Unclassified | 924 |
| 614 | Ga0501077_0398977 | 3300049593 | Unclassified | 879 |
| 615 | Ga0501077_0407984 | 3300049593 | Unclassified | 869 |
| 616 | Ga0501077_0653865 | 3300049593 | Bacteria | 675 |
| 617 | Ga0501079_0133598 | 3300049741 | Unclassified | 1931 |
| 618 | Ga0501079_0551715 | 3300049741 | Bacteria | 906 |
| 619 | Ga0501079_0773561 | 3300049741 | Unclassified | 756 |
| 620 | Ga0501080_0002533 | 3300049742 | Bacteria | 15990 |
| 621 | Ga0501080_0204135 | 3300049742 | Bacteria | 1814 |
| 622 | Ga0501080_0316631 | 3300049742 | Bacteria | 1413 |
| 623 | Ga0501080_1325592 | 3300049742 | Bacteria | 616 |
| 624 | Ga0501081_0016561 | 3300049743 | Bacteria | 4874 |
| 625 | Ga0501081_0070099 | 3300049743 | Unclassified | 2443 |
| 626 | Ga0501081_0181540 | 3300049743 | Bacteria | 1522 |
| 627 | Ga0501083_0151530 | 3300049744 | Unclassified | 1518 |
| 628 | Ga0501035_0052987 | 3300049822 | Bacteria | 3629 |
| 629 | Ga0501044_0276434 | 3300049823 | Unclassified | 1614 |
| 630 | Ga0501045_0026997 | 3300049824 | Bacteria | 4134 |
| 631 | Ga0501045_0123671 | 3300049824 | Unclassified | 1921 |
| 632 | Ga0501045_0194510 | 3300049824 | Bacteria | 1511 |
| 633 | Ga0501045_0237170 | 3300049824 | Bacteria | 1358 |
| 634 | nmdc:mga05p37_479_c1 | 3300050507 | Bacteria | 43660 |
| 635 | nmdc:mga05p37_60876_c1 | 3300050507 | Unclassified | 4648 |
| 636 | nmdc:mga05p37_715099_c1 | 3300050507 | Bacteria | 1110 |
| 637 | nmdc:mga06r32_227720_c1 | 3300050510 | Bacteria | 1852 |
| 638 | nmdc:mga08y16_185693_c1 | 3300050511 | Unclassified | 2158 |
| 639 | nmdc:mga08y16_489716_c1 | 3300050511 | Unclassified | 1250 |
| 640 | nmdc:mga0n895_190315_c1 | 3300050512 | Bacteria | 2083 |
| 641 | nmdc:mga0n895_380716_c1 | 3300050512 | Archaea | 1428 |
| 642 | nmdc:mga0n895_544187_c1 | 3300050512 | Bacteria | 1167 |
| 643 | nmdc:mga0n895_684952_c1 | 3300050512 | Bacteria | 1022 |
| 644 | nmdc:mga0n895_736823_c1 | 3300050512 | Bacteria | 979 |
| 645 | nmdc:mga0rr50_317504_c1 | 3300050513 | Bacteria | 1305 |
| 646 | nmdc:mga0rr50_625495_c1 | 3300050513 | Bacteria | 918 |
| 647 | nmdc:mga0rr50_713284_c1 | 3300050513 | Bacteria | 856 |
| 648 | nmdc:mga0rr50_72568_c1 | 3300050513 | Bacteria | 2629 |
| 649 | nmdc:mga0rr50_948970_c1 | 3300050513 | Unclassified | 733 |
| 650 | nmdc:mga08x19_155710_c1 | 3300050514 | Bacteria | 1549 |
| 651 | nmdc:mga08x19_332316_c1 | 3300050514 | Bacteria | 1059 |
| 652 | nmdc:mga0a205_118151_c1 | 3300050515 | Bacteria | 2550 |
| 653 | nmdc:mga0a205_155009_c1 | 3300050515 | Bacteria | 2189 |
| 654 | nmdc:mga0a205_793514_c1 | 3300050515 | Bacteria | 795 |
| 655 | nmdc:mga0a205_81463_c1 | 3300050515 | Bacteria | 3127 |
| 656 | nmdc:mga0a205_99768_c1 | 3300050515 | Bacteria | 2802 |
| 657 | Ga0495601_0010055 | 3300053077 | Bacteria | 5616 |
| 658 | Ga0495601_0202512 | 3300053077 | Bacteria | 1297 |
| 659 | Ga0495601_0297955 | 3300053077 | Unclassified | 1051 |
| 660 | Ga0495612_0002104 | 3300053078 | Bacteria | 8182 |
| 661 | Ga0495595_0509510 | 3300053084 | Bacteria | 613 |
| 662 | Ga0495595_0609392 | 3300053084 | Bacteria | 558 |
| 663 | Ga0495619_0044175 | 3300053085 | Unclassified | 2924 |
| 664 | Ga0495619_0450747 | 3300053085 | Bacteria | 887 |
| 665 | Ga0495619_0656904 | 3300053085 | Bacteria | 715 |
| 666 | Ga0501084_0020362 | 3300054114 | Bacteria | 5531 |
| 667 | Ga0501084_0045525 | 3300054114 | Bacteria | 3674 |
| 668 | Ga0501084_0365834 | 3300054114 | Bacteria | 1219 |
| 669 | Ga0501084_1348225 | 3300054114 | Unclassified | 598 |
| 670 | Ga0501084_1394613 | 3300054114 | Bacteria | 587 |
| 671 | Ga0501084_1630324 | 3300054114 | Unclassified | 539 |
| 672 | Ga0501082_0027159 | 3300060353 | Bacteria | 4930 |
| 673 | Ga0501082_0039715 | 3300060353 | Bacteria | 4060 |
| 674 | Ga0501082_0441204 | 3300060353 | Bacteria | 1137 |
| 675 | Ga0501082_0952046 | 3300060353 | Unclassified | 751 |
| 676 | Ga0501082_0957968 | 3300060353 | Bacteria | 748 |
| 677 | Ga0501082_1091897 | 3300060353 | Bacteria | 698 |
| 678 | Ga0501082_1130432 | 3300060353 | Unclassified | 685 |
| 679 | Ga0530510_0003316 | 3300061734 | Bacteria | 11077 |
| 680 | Ga0530510_0015398 | 3300061734 | Bacteria | 5404 |
| 681 | Ga0530510_0249247 | 3300061734 | Unclassified | 1323 |
| 682 | Ga0530510_1052793 | 3300061734 | Bacteria | 623 |
| 683 | rootH2_10209206 | |||
| 684 | Ga0070683_100665028 | |||
| 685 | Ga0068869_100930643 | |||
| 686 | Ga0068869_101116947 | |||
| 687 | Ga0070666_11342380 | |||
| 688 | Ga0070680_100000004 | |||
| 689 | Ga0070680_100229985 | |||
| 690 | Ga0070680_100343925 | |||
| 691 | Ga0070680_100796814 | |||
| 692 | Ga0068868_100095923 | |||
| 693 | Ga0068868_100609529 | |||
| 694 | Ga0068868_100652827 | |||
| 695 | Ga0070689_100959289 | |||
| 696 | Ga0070691_10364628 | |||
| 697 | Ga0070691_10933278 | |||
| 698 | Ga0070687_100197990 | |||
| 699 | Ga0070687_100363578 | |||
| 700 | Ga0070661_101343502 | |||
| 701 | Ga0070692_11053028 | |||
| 702 | Ga0070668_100136976 | |||
| 703 | Ga0070668_100221430 | |||
| 704 | Ga0070668_100468791 | |||
| 705 | Ga0070675_100764551 | |||
| 706 | Ga0070671_100798047 | |||
| 707 | Ga0070673_100879484 | |||
| 708 | Ga0070673_101806876 | |||
| 709 | Ga0070688_101717942 | |||
| 710 | Ga0070659_100196590 | |||
| 711 | Ga0070703_10043736 | |||
| 712 | Ga0070703_10135998 | |||
| 713 | Ga0070701_10502220 | |||
| 714 | Ga0070705_100008081 | |||
| 715 | Ga0070705_100075304 | |||
| 716 | Ga0070705_100075614 | |||
| 717 | Ga0070705_100137080 | |||
| 718 | Ga0070705_100468609 | |||
| 719 | Ga0070705_100776472 | |||
| 720 | Ga0070705_101142278 | |||
| 721 | Ga0070700_100350218 | |||
| 722 | Ga0070700_100445335 | |||
| 723 | Ga0070700_100878888 | |||
| 724 | Ga0070694_100023551 | |||
| 725 | Ga0070694_100132721 | |||
| 726 | Ga0070694_100134104 | |||
| 727 | Ga0070694_100162948 | |||
| 728 | Ga0070694_100184053 | |||
| 729 | Ga0070694_100199827 | |||
| 730 | Ga0070694_100207770 | |||
| 731 | Ga0070694_100248677 | |||
| 732 | Ga0070694_101507724 | |||
| 733 | Ga0070694_101537238 | |||
| 734 | Ga0070708_100002686 | |||
| 735 | Ga0070708_100005943 | |||
| 736 | Ga0070708_100016932 | |||
| 737 | Ga0070708_100067648 | |||
| 738 | Ga0070708_100302666 | |||
| 739 | Ga0070708_100338216 | |||
| 740 | Ga0070708_101384831 | |||
| 741 | Ga0070663_101464429 | |||
| 742 | Ga0070678_100254543 | |||
| 743 | Ga0070662_100067198 | |||
| 744 | Ga0070662_100133481 | |||
| 745 | Ga0070662_100555108 | |||
| 746 | Ga0070662_100803606 | |||
| 747 | Ga0070681_11225014 | |||
| 748 | Ga0070685_11244421 | |||
| 749 | Ga0070706_100000076 | |||
| 750 | Ga0070706_100026464 | |||
| 751 | Ga0070706_100031017 | |||
| 752 | Ga0070706_100059967 | |||
| 753 | Ga0070706_100132439 | |||
| 754 | Ga0070706_100135512 | |||
| 755 | Ga0070706_100181952 | |||
| 756 | Ga0070707_100001005 | |||
| 757 | Ga0070707_100002140 | |||
| 758 | Ga0070707_100016836 | |||
| 759 | Ga0070707_100079203 | |||
| 760 | Ga0070707_100097481 | |||
| 761 | Ga0070707_100141484 | |||
| 762 | Ga0070707_100393511 | |||
| 763 | Ga0070707_100597140 | |||
| 764 | Ga0070698_100004268 | |||
| 765 | Ga0070698_100012889 | |||
| 766 | Ga0070698_100060838 | |||
| 767 | Ga0070698_100356822 | |||
| 768 | Ga0070698_100572198 | |||
| 769 | Ga0070698_100668551 | |||
| 770 | Ga0070698_100750366 | |||
| 771 | Ga0070698_101187637 | |||
| 772 | Ga0070698_101789015 | |||
| 773 | Ga0070699_100009857 | |||
| 774 | Ga0070699_100015555 | |||
| 775 | Ga0070699_100044947 | |||
| 776 | Ga0070699_100048538 | |||
| 777 | Ga0070699_100158662 | |||
| 778 | Ga0070699_100299456 | |||
| 779 | Ga0070699_100882857 | |||
| 780 | Ga0070699_102000641 | |||
| 781 | Ga0070679_100853614 | |||
| 782 | Ga0070684_101634629 | |||
| 783 | Ga0070697_100002053 | |||
| 784 | Ga0070697_100017350 | |||
| 785 | Ga0070697_100023024 | |||
| 786 | Ga0070697_100027704 | |||
| 787 | Ga0070697_100054473 | |||
| 788 | Ga0070697_100158485 | |||
| 789 | Ga0070697_100246606 | |||
| 790 | Ga0070697_100497407 | |||
| 791 | Ga0068853_100616461 | |||
| 792 | Ga0070686_100058424 | |||
| 793 | Ga0070695_100008396 | |||
| 794 | Ga0070695_100062964 | |||
| 795 | Ga0070695_100077054 | |||
| 796 | Ga0070695_100151092 | |||
| 797 | Ga0070695_100234006 | |||
| 798 | Ga0070695_100306460 | |||
| 799 | Ga0070695_100489270 | |||
| 800 | Ga0070695_101806485 | |||
| 801 | Ga0070696_100000947 | |||
| 802 | Ga0070696_100032403 | |||
| 803 | Ga0070696_100037249 | |||
| 804 | Ga0070696_100045833 | |||
| 805 | Ga0070696_100061369 | |||
| 806 | Ga0070696_100144302 | |||
| 807 | Ga0070696_100234834 | |||
| 808 | Ga0070696_100274918 | |||
| 809 | Ga0070696_100491469 | |||
| 810 | Ga0070693_100181685 | |||
| 811 | Ga0070693_100576432 | |||
| 812 | Ga0070693_100861683 | |||
| 813 | Ga0070704_100012305 | |||
| 814 | Ga0070704_100105568 | |||
| 815 | Ga0070704_100129919 | |||
| 816 | Ga0070704_100195090 | |||
| 817 | Ga0070704_100217054 | |||
| 818 | Ga0070704_101514708 | |||
| 819 | Ga0068855_100295850 | |||
| 820 | Ga0068855_100618933 | |||
| 821 | Ga0068857_100234709 | |||
| 822 | Ga0068857_100332390 | |||
| 823 | Ga0068854_100251193 | |||
| 824 | Ga0068854_101052296 | |||
| 825 | Ga0070702_100053284 | |||
| 826 | Ga0070702_100099728 | |||
| 827 | Ga0070702_101092942 | |||
| 828 | Ga0068852_101665646 | |||
| 829 | Ga0068861_100072048 | |||
| 830 | Ga0068861_100711658 | |||
| 831 | Ga0068860_100062870 | |||
| 832 | Ga0068860_100096622 | |||
| 833 | Ga0068860_101228514 | |||
| 834 | Ga0068860_101255533 | |||
| 835 | Ga0068862_100300118 | |||
| 836 | Ga0068862_100516720 | |||
| 837 | Ga0068862_101478099 | |||
| 838 | Ga0081538_10121345 | |||
| 839 | Ga0081539_10008188 | |||
| 840 | Ga0081539_10342818 | |||
| 841 | Ga0070716_100255216 | |||
| 842 | Ga0070716_100935899 | |||
| 843 | Ga0070716_101428139 | |||
| 844 | Ga0070712_100815698 | |||
| 845 | Ga0097621_100636291 | |||
| 846 | Ga0075428_100000219 | |||
| 847 | Ga0075428_100335561 | |||
| 848 | Ga0075428_102253636 | |||
| 849 | Ga0075431_100224370 | |||
| 850 | Ga0075433_10034667 | |||
| 851 | Ga0075433_10052542 | |||
| 852 | Ga0075433_10072483 | |||
| 853 | Ga0075433_10958574 | |||
| 854 | Ga0075433_11766992 | |||
| 855 | Ga0075434_100044017 | |||
| 856 | Ga0075434_100548274 | |||
| 857 | Ga0075434_100640903 | |||
| 858 | Ga0068865_100058228 | |||
| 859 | Ga0068865_100495145 | |||
| 860 | Ga0068865_100631805 | |||
| 861 | Ga0075436_100096293 | |||
| 862 | Ga0075436_100191080 | |||
| 863 | Ga0075436_100262837 | |||
| 864 | Ga0075436_100706125 | |||
| 865 | Ga0075435_100065290 | |||
| 866 | Ga0075435_100081902 | |||
| 867 | Ga0075435_100387371 | |||
| 868 | Ga0075435_100452686 | |||
| 869 | Ga0105250_10355726 | |||
| 870 | Ga0105240_11215893 | |||
| 871 | Ga0111539_10021644 | |||
| 872 | Ga0111539_10118777 | |||
| 873 | Ga0111539_13420602 | |||
| 874 | Ga0105245_10063615 | |||
| 875 | Ga0105245_10069042 | |||
| 876 | Ga0105245_10259076 | |||
| 877 | Ga0105245_10469663 | |||
| 878 | Ga0105245_10505655 | |||
| 879 | Ga0105245_11217491 | |||
| 880 | Ga0105245_12987731 | |||
| 881 | Ga0114129_10000738 | |||
| 882 | Ga0114129_10056093 | |||
| 883 | Ga0105243_10111020 | |||
| 884 | Ga0105243_10410100 | |||
| 885 | Ga0105243_10571740 | |||
| 886 | Ga0105243_10735843 | |||
| 887 | Ga0105243_10742428 | |||
| 888 | Ga0105243_10913863 | |||
| 889 | Ga0105243_13034043 | |||
| 890 | Ga0105241_10522649 | |||
| 891 | Ga0105242_10248341 | |||
| 892 | Ga0105242_10907711 | |||
| 893 | Ga0105242_10928301 | |||
| 894 | Ga0105242_11702386 | |||
| 895 | Ga0105242_11764176 | |||
| 896 | Ga0105242_12109006 | |||
| 897 | Ga0105242_12220897 | |||
| 898 | Ga0105248_10643200 | |||
| 899 | Ga0105248_10884111 | |||
| 900 | Ga0105238_10334328 | |||
| 901 | Ga0105249_10094980 | |||
| 902 | Ga0105249_10232905 | |||
| 903 | Ga0105249_10290173 | |||
| 904 | Ga0105249_10376990 | |||
| 905 | Ga0105249_11264916 | |||
| 906 | Ga0099796_10515263 | |||
| 907 | Ga0105239_10204150 | |||
| 908 | Ga0105239_10299849 | |||
| 909 | Ga0105239_11261497 | |||
| 910 | Ga0105246_10150045 | |||
| 911 | Ga0105246_12260175 | |||
| 912 | Ga0157325_1034347 | |||
| 913 | Ga0157323_1022135 | |||
| 914 | Ga0157373_11328178 | |||
| 915 | Ga0157374_10882785 | |||
| 916 | Ga0157374_10931697 | |||
| 917 | Ga0157374_11732533 | |||
| 918 | Ga0157378_10153498 | |||
| 919 | Ga0157378_10201917 | |||
| 920 | Ga0157378_10354378 | |||
| 921 | Ga0157378_11372181 | |||
| 922 | Ga0157378_11377876 | |||
| 923 | Ga0163162_10596719 | |||
| 924 | Ga0163162_11260240 | |||
| 925 | Ga0157372_10415662 | |||
| 926 | Ga0157372_10570311 | |||
| 927 | Ga0157372_11331912 | |||
| 928 | Ga0157375_10369870 | |||
| 929 | Ga0157375_12272268 | |||
| 930 | Ga0163163_10027493 | |||
| 931 | Ga0163163_11712723 | |||
| 932 | Ga0163163_12241633 | |||
| 933 | Ga0157380_10692890 | |||
| 934 | Ga0182008_10033608 | |||
| 935 | Ga0182008_10362119 | |||
| 936 | Ga0157377_10162272 | |||
| 937 | Ga0157377_10226952 | |||
| 938 | Ga0157377_11484304 | |||
| 939 | Ga0157379_10380949 | |||
| 940 | Ga0157379_12608548 | |||
| 941 | Ga0157376_10324454 | |||
| 942 | Ga0157376_10540001 | |||
| 943 | Ga0157376_11568149 | |||
| 944 | Ga0207653_10020526 | |||
| 945 | Ga0207653_10084252 | |||
| 946 | Ga0207653_10184681 | |||
| 947 | Ga0207688_10113309 | |||
| 948 | Ga0207688_10147585 | |||
| 949 | Ga0207647_10796297 | |||
| 950 | Ga0207645_10296942 | |||
| 951 | Ga0207645_10405880 | |||
| 952 | Ga0207684_10012109 | |||
| 953 | Ga0207684_10012499 | |||
| 954 | Ga0207684_10020370 | |||
| 955 | Ga0207684_10052627 | |||
| 956 | Ga0207684_10160841 | |||
| 957 | Ga0207684_10257344 | |||
| 958 | Ga0207684_10536349 | |||
| 959 | Ga0207684_11298265 | |||
| 960 | Ga0207660_10000001 | |||
| 961 | Ga0207660_10544880 | |||
| 962 | Ga0207662_10131707 | |||
| 963 | Ga0207662_10289050 | |||
| 964 | Ga0207662_10386911 | |||
| 965 | Ga0207657_10743748 | |||
| 966 | Ga0207652_10448312 | |||
| 967 | Ga0207646_10001570 | |||
| 968 | Ga0207646_10028092 | |||
| 969 | Ga0207646_10047024 | |||
| 970 | Ga0207646_10170937 | |||
| 971 | Ga0207646_10172138 | |||
| 972 | Ga0207646_10540642 | |||
| 973 | Ga0207646_10736371 | |||
| 974 | Ga0207646_10786817 | |||
| 975 | Ga0207646_10831763 | |||
| 976 | Ga0207694_10446743 | |||
| 977 | Ga0207659_10413507 | |||
| 978 | Ga0207659_10617811 | |||
| 979 | Ga0207687_10110006 | |||
| 980 | Ga0207687_10110441 | |||
| 981 | Ga0207687_10274790 | |||
| 982 | Ga0207687_10706308 | |||
| 983 | Ga0207687_11272636 | |||
| 984 | Ga0207706_10018442 | |||
| 985 | Ga0207706_10246626 | |||
| 986 | Ga0207686_10226712 | |||
| 987 | Ga0207686_10347580 | |||
| 988 | Ga0207686_10732082 | |||
| 989 | Ga0207686_10872815 | |||
| 990 | Ga0207709_10061950 | |||
| 991 | Ga0207709_10431589 | |||
| 992 | Ga0207709_10559598 | |||
| 993 | Ga0207669_10183489 | |||
| 994 | Ga0207669_11407554 | |||
| 995 | Ga0207704_10150165 | |||
| 996 | Ga0207691_11534888 | |||
| 997 | Ga0207711_10646325 | |||
| 998 | Ga0207689_10129617 | |||
| 999 | Ga0207689_10177869 | |||
| 1000 | Ga0207661_10192512 | |||
| 1001 | Ga0207679_10089454 | |||
| 1002 | Ga0207667_10116368 | |||
| 1003 | Ga0207667_10807571 | |||
| 1004 | Ga0207651_10605826 | |||
| 1005 | Ga0207651_11264218 | |||
| 1006 | Ga0207712_10243897 | |||
| 1007 | Ga0207712_10491284 | |||
| 1008 | Ga0207668_10239256 | |||
| 1009 | Ga0207668_10656067 | |||
| 1010 | Ga0207640_10149749 | |||
| 1011 | Ga0207640_10780429 | |||
| 1012 | Ga0207658_12131294 | |||
| 1013 | Ga0207677_10066272 | |||
| 1014 | Ga0207677_10350110 | |||
| 1015 | Ga0207677_11206287 | |||
| 1016 | Ga0207678_10671902 | |||
| 1017 | Ga0207678_10695712 | |||
| 1018 | Ga0207708_10195376 | |||
| 1019 | Ga0207708_10341469 | |||
| 1020 | Ga0207708_10534118 | |||
| 1021 | Ga0207702_10323738 | |||
| 1022 | Ga0207648_10474113 | |||
| 1023 | Ga0207676_10980270 | |||
| 1024 | Ga0207674_10184657 | |||
| 1025 | Ga0207674_10202707 | |||
| 1026 | Ga0207674_10675175 | |||
| 1027 | Ga0207675_100068905 | |||
| 1028 | Ga0207675_100204605 | |||
| 1029 | Ga0207675_100771368 | |||
| 1030 | Ga0207683_10050553 | |||
| 1031 | Ga0207683_10837057 | |||
| 1032 | Ga0207683_12095911 | |||
| 1033 | Ga0207698_12425568 | |||
| 1034 | Ga0209983_1078766 | |||
| 1035 | Ga0207428_10117258 | |||
| 1036 | Ga0268265_10627792 | |||
| 1037 | Ga0268265_11532888 | |||
| 1038 | Ga0268264_10049948 | |||
| 1039 | Ga0268264_10696038 | |||
| 1040 | Ga0268264_11004931 | |||
| 1041 | Ga0268264_11181337 | |||
| 1042 | Ga0268264_11609563 | |||
| 1043 | Ga0265326_10184090 | |||
| 1044 | Ga0265319_1017750 | |||
| 1045 | Ga0265319_1283667 | |||
| 1046 | Ga0265334_10056107 | |||
| 1047 | Ga0265318_10037932 | |||
| 1048 | Ga0265318_10046987 | |||
| 1049 | Ga0265318_10233930 | |||
| 1050 | Ga0265322_10015025 | |||
| 1051 | Ga0265322_10022247 | |||
| 1052 | Ga0265336_10040166 | |||
| 1053 | Ga0265338_10107977 | |||
| 1054 | Ga0265324_10019431 | |||
| 1055 | Ga0265332_10058451 | |||
| 1056 | Ga0265320_10026721 | |||
| 1057 | Ga0265320_10079397 | |||
| 1058 | Ga0265325_10032610 | |||
| 1059 | Ga0265329_10047703 | |||
| 1060 | Ga0265340_10029397 | |||
| 1061 | Ga0265339_10080486 | |||
| 1062 | Ga0265339_10250500 | |||
| 1063 | Ga0265316_10063139 | |||
| 1064 | Ga0307408_100497912 | |||
| 1065 | Ga0265314_10015810 | |||
| 1066 | Ga0265342_10087745 | |||
| 1067 | Ga0307405_12005986 | |||
| 1068 | Ga0307413_10268544 | |||
| 1069 | Ga0307410_10052744 | |||
| 1070 | Ga0307410_10530367 | |||
| 1071 | Ga0307410_10672534 | |||
| 1072 | Ga0307407_10603669 | |||
| 1073 | Ga0307407_10873370 | |||
| 1074 | Ga0307407_10884074 | |||
| 1075 | Ga0307412_10974513 | |||
| 1076 | Ga0307409_100330124 | |||
| 1077 | Ga0307409_100390738 | |||
| 1078 | Ga0307409_101650454 | |||
| 1079 | Ga0307409_101690343 | |||
| 1080 | Ga0307416_101455316 | |||
| 1081 | Ga0307416_101868618 | |||
| 1082 | Ga0307416_102190833 | |||
| 1083 | Ga0307411_10502868 | |||
| 1084 | Ga0307411_10585804 | |||
| 1085 | Ga0307415_101629307 | |||
| 1086 | Ga0373959_0131475 | |||
| 1087 | Ga0373926_0344716 | |||
| 1088 | Ga0373929_0179602 | |||
| 1089 | Ga0373932_0207689 | |||
| 1090 | Ga0373941_0150442 | |||
| 1091 | Ga0373960_0375584 | |||
| 1092 | Ga0373943_0080086 | |||
| 1093 | Ga0373943_0770298 | |||
| 1094 | Ga0373942_0334110 | |||
| 1095 | Ga0373962_0034715 | |||
| 1096 | Ga0373962_0270982 | |||
| 1097 | Ga0373931_0088932 | |||
| 1098 | Ga0373947_0130215 | |||
| 1099 | Ga0373947_1056858 | |||
| 1100 | Ga0373937_0083843 | |||
| 1101 | Ga0373937_0742723 | |||
| 1102 | Ga0373937_0815235 | |||
| 1103 | Ga0373937_1071420 | |||
| 1104 | Ga0373925_1103981 | |||
| 1105 | Ga0395900_1032906 | |||
| 1106 | Ga0436365_0765767 | |||
| 1107 | Ga0451787_687447 | |||
| 1108 | Ga0451798_0280315 | |||
| 1109 | Ga0451800_0031615 | |||
| 1110 | Ga0451802_1199723 | |||
| 1111 | Ga0451835_0607610 | |||
| 1112 | Ga0451845_0979702 | |||
| 1113 | Ga0451849_0510238 | |||
| 1114 | Ga0451849_0732597 | |||
| 1115 | Ga0451849_1315850 | |||
| 1116 | Ga0451851_1267513 | |||
| 1117 | Ga0451843_0341974 | |||
| 1118 | Ga0451853_0721060 | |||
| 1119 | Ga0451853_1062934 | |||
| 1120 | Ga0451853_2459620 | |||
| 1121 | Ga0451853_3135647 | |||
| 1122 | Ga0451853_3169035 | |||
| 1123 | Ga0451853_3341543 | |||
| 1124 | Ga0451853_3807259 | |||
| 1125 | Ga0439441_055415 | |||
| 1126 | Ga0439456_164624 | |||
| 1127 | Ga0450923_056310 | |||
| 1128 | Ga0450905_071183 | |||
| 1129 | Ga0450906_021369 | |||
| 1130 | Ga0450910_027036 | |||
| 1131 | Ga0450910_055084 | |||
| 1132 | Ga0439435_0010683 | |||
| 1133 | Ga0451577_0434987 | |||
| 1134 | Ga0451577_0771813 | |||
| 1135 | Ga0451577_1110290 | |||
| 1136 | Ga0453683_0193716 | |||
| 1137 | Ga0453683_0358927 | |||
| 1138 | Ga0451576_0369598 | |||
| 1139 | Ga0451576_0590075 | |||
| 1140 | Ga0466967_2356843 | |||
| 1141 | Ga0495603_0098059 | |||
| 1142 | Ga0495653_0925502 | |||
| 1143 | Ga0495582_0919421 | |||
| 1144 | Ga0495584_0434380 | |||
| 1145 | Ga0495607_0367061 | |||
| 1146 | Ga0495608_0763669 | |||
| 1147 | Ga0495618_0371116 | |||
| 1148 | Ga0495618_0557904 | |||
| 1149 | Ga0495630_0490663 | |||
| 1150 | Ga0495667_0437029 | |||
| 1151 | Ga0495635_0146976 | |||
| 1152 | Ga0495659_0344757 | |||
| 1153 | Ga0495588_0185584 | |||
| 1154 | Ga0495657_0074615 | |||
| 1155 | Ga0495657_0377776 | |||
| 1156 | Ga0495599_0813382 | |||
| 1157 | Ga0495647_0191575 | |||
| 1158 | Ga0495647_0329453 | |||
| 1159 | Ga0495658_0248725 | |||
| 1160 | Ga0495658_0392165 | |||
| 1161 | Ga0495658_0401971 | |||
| 1162 | Ga0495670_0336673 | |||
| 1163 | Ga0495589_0582820 | |||
| 1164 | Ga0495604_0237781 | |||
| 1165 | Ga0495674_0072465 | |||
| 1166 | Ga0495674_0973219 | |||
| 1167 | Ga0495676_0815032 | |||
| 1168 | Ga0495680_0071659 | |||
| 1169 | Ga0495602_0466291 | |||
| 1170 | Ga0496100_0082027 | |||
| 1171 | Ga0496100_0208908 | |||
| 1172 | Ga0496100_0769048 | |||
| 1173 | Ga0496101_0063247 | |||
| 1174 | Ga0496101_0209452 | |||
| 1175 | Ga0496101_0419361 | |||
| 1176 | Ga0496101_0962098 | |||
| 1177 | Ga0496102_0032699 | |||
| 1178 | Ga0496102_0089110 | |||
| 1179 | Ga0496102_0144998 | |||
| 1180 | Ga0496102_0235666 | |||
| 1181 | Ga0496102_0248225 | |||
| 1182 | Ga0496102_0602213 | |||
| 1183 | Ga0496102_0640525 | |||
| 1184 | Ga0496102_1080801 | |||
| 1185 | Ga0496103_0023198 | |||
| 1186 | Ga0496103_0062565 | |||
| 1187 | Ga0496103_0130956 | |||
| 1188 | Ga0496103_0190691 | |||
| 1189 | Ga0496103_0193456 | |||
| 1190 | Ga0496104_0031392 | |||
| 1191 | Ga0496104_0057140 | |||
| 1192 | Ga0496105_0029703 | |||
| 1193 | Ga0496105_0032184 | |||
| 1194 | Ga0496106_0048480 | |||
| 1195 | Ga0496106_0071570 | |||
| 1196 | Ga0496106_0155286 | |||
| 1197 | Ga0496106_0242305 | |||
| 1198 | Ga0496106_0371138 | |||
| 1199 | Ga0496106_0585225 | |||
| 1200 | Ga0496107_0091672 | |||
| 1201 | Ga0496107_0783950 | |||
| 1202 | Ga0496107_0953524 | |||
| 1203 | Ga0496108_0008582 | |||
| 1204 | Ga0496108_0149691 | |||
| 1205 | Ga0496108_0265445 | |||
| 1206 | Ga0496108_0462999 | |||
| 1207 | Ga0496109_0011146 | |||
| 1208 | Ga0496109_0011762 | |||
| 1209 | Ga0496109_0196175 | |||
| 1210 | Ga0496109_0203719 | |||
| 1211 | Ga0496109_1321111 | |||
| 1212 | Ga0496110_0053483 | |||
| 1213 | Ga0496110_0071357 | |||
| 1214 | Ga0496111_0005402 | |||
| 1215 | Ga0496111_0098635 | |||
| 1216 | Ga0496111_0341462 | |||
| 1217 | Ga0496112_0000005 | |||
| 1218 | Ga0496112_0025792 | |||
| 1219 | Ga0496112_0151165 | |||
| 1220 | Ga0496112_0334790 | |||
| 1221 | Ga0496112_1325012 | |||
| 1222 | Ga0496113_0044353 | |||
| 1223 | Ga0496113_0218272 | |||
| 1224 | Ga0496113_0312082 | |||
| 1225 | Ga0496113_1042788 | |||
| 1226 | Ga0496113_1101019 | |||
| 1227 | Ga0496114_0061694 | |||
| 1228 | Ga0496114_0115533 | |||
| 1229 | Ga0496114_0275545 | |||
| 1230 | Ga0496114_1513749 | |||
| 1231 | Ga0496115_0677056 | |||
| 1232 | Ga0501031_0022983 | |||
| 1233 | Ga0501031_0732592 | |||
| 1234 | Ga0501033_0038777 | |||
| 1235 | Ga0501034_0672896 | |||
| 1236 | Ga0501036_0010781 | |||
| 1237 | Ga0501036_0761502 | |||
| 1238 | Ga0501037_0148915 | |||
| 1239 | Ga0501038_0014355 | |||
| 1240 | Ga0501038_0121349 | |||
| 1241 | Ga0501038_0192742 | |||
| 1242 | Ga0501039_0025325 | |||
| 1243 | Ga0501039_0461657 | |||
| 1244 | Ga0501039_0552267 | |||
| 1245 | Ga0501040_0012754 | |||
| 1246 | Ga0501040_0201826 | |||
| 1247 | Ga0501040_0683610 | |||
| 1248 | Ga0501040_1200290 | |||
| 1249 | Ga0501041_0001964 | |||
| 1250 | Ga0501042_0105504 | |||
| 1251 | Ga0501042_0136750 | |||
| 1252 | Ga0501042_0866946 | |||
| 1253 | Ga0501043_0065106 | |||
| 1254 | Ga0501046_0018989 | |||
| 1255 | Ga0501048_0058634 | |||
| 1256 | Ga0501048_0580269 | |||
| 1257 | Ga0501067_0002998 | |||
| 1258 | Ga0501067_0071909 | |||
| 1259 | Ga0501067_0120781 | |||
| 1260 | Ga0501067_0666324 | |||
| 1261 | Ga0501068_0057398 | |||
| 1262 | Ga0501068_0073378 | |||
| 1263 | Ga0501068_0155224 | |||
| 1264 | Ga0501068_0238634 | |||
| 1265 | Ga0501069_0010166 | |||
| 1266 | Ga0501069_0019369 | |||
| 1267 | Ga0501069_0267089 | |||
| 1268 | Ga0501070_0008559 | |||
| 1269 | Ga0501070_0362316 | |||
| 1270 | Ga0501071_0155274 | |||
| 1271 | Ga0501071_0886627 | |||
| 1272 | Ga0501071_1116195 | |||
| 1273 | Ga0501071_1242718 | |||
| 1274 | Ga0501071_1415265 | |||
| 1275 | Ga0501072_0008571 | |||
| 1276 | Ga0501072_0078557 | |||
| 1277 | Ga0501072_0440366 | |||
| 1278 | Ga0501072_0694582 | |||
| 1279 | Ga0501072_0866983 | |||
| 1280 | Ga0501072_0870625 | |||
| 1281 | Ga0501073_0034131 | |||
| 1282 | Ga0501074_0186885 | |||
| 1283 | Ga0501074_0885610 | |||
| 1284 | Ga0501075_0003922 | |||
| 1285 | Ga0501075_0110039 | |||
| 1286 | Ga0501075_0367777 | |||
| 1287 | Ga0501075_0447922 | |||
| 1288 | Ga0501075_0469830 | |||
| 1289 | Ga0501075_0560867 | |||
| 1290 | Ga0501076_0012429 | |||
| 1291 | Ga0501076_0035128 | |||
| 1292 | Ga0501076_0052652 | |||
| 1293 | Ga0501076_1380492 | |||
| 1294 | Ga0501077_0007873 | |||
| 1295 | Ga0501077_0363634 | |||
| 1296 | Ga0501077_0398977 | |||
| 1297 | Ga0501077_0407984 | |||
| 1298 | Ga0501077_0653865 | |||
| 1299 | Ga0501079_0133598 | |||
| 1300 | Ga0501079_0551715 | |||
| 1301 | Ga0501079_0773561 | |||
| 1302 | Ga0501080_0002533 | |||
| 1303 | Ga0501080_0204135 | |||
| 1304 | Ga0501080_0316631 | |||
| 1305 | Ga0501080_1325592 | |||
| 1306 | Ga0501081_0016561 | |||
| 1307 | Ga0501081_0070099 | |||
| 1308 | Ga0501081_0181540 | |||
| 1309 | Ga0501083_0151530 | |||
| 1310 | Ga0501035_0052987 | |||
| 1311 | Ga0501044_0276434 | |||
| 1312 | Ga0501045_0026997 | |||
| 1313 | Ga0501045_0123671 | |||
| 1314 | Ga0501045_0194510 | |||
| 1315 | Ga0501045_0237170 | |||
| 1316 | nmdc:mga05p37_479_c1 | |||
| 1317 | nmdc:mga05p37_60876_c1 | |||
| 1318 | nmdc:mga05p37_715099_c1 | |||
| 1319 | nmdc:mga06r32_227720_c1 | |||
| 1320 | nmdc:mga08y16_185693_c1 | |||
| 1321 | nmdc:mga08y16_489716_c1 | |||
| 1322 | nmdc:mga0n895_190315_c1 | |||
| 1323 | nmdc:mga0n895_380716_c1 | |||
| 1324 | nmdc:mga0n895_544187_c1 | |||
| 1325 | nmdc:mga0n895_684952_c1 | |||
| 1326 | nmdc:mga0n895_736823_c1 | |||
| 1327 | nmdc:mga0rr50_317504_c1 | |||
| 1328 | nmdc:mga0rr50_625495_c1 | |||
| 1329 | nmdc:mga0rr50_713284_c1 | |||
| 1330 | nmdc:mga0rr50_72568_c1 | |||
| 1331 | nmdc:mga0rr50_948970_c1 | |||
| 1332 | nmdc:mga08x19_155710_c1 | |||
| 1333 | nmdc:mga08x19_332316_c1 | |||
| 1334 | nmdc:mga0a205_118151_c1 | |||
| 1335 | nmdc:mga0a205_155009_c1 | |||
| 1336 | nmdc:mga0a205_793514_c1 | |||
| 1337 | nmdc:mga0a205_81463_c1 | |||
| 1338 | nmdc:mga0a205_99768_c1 | |||
| 1339 | Ga0495601_0010055 | |||
| 1340 | Ga0495601_0202512 | |||
| 1341 | Ga0495601_0297955 | |||
| 1342 | Ga0495612_0002104 | |||
| 1343 | Ga0495595_0509510 | |||
| 1344 | Ga0495595_0609392 | |||
| 1345 | Ga0495619_0044175 | |||
| 1346 | Ga0495619_0450747 | |||
| 1347 | Ga0495619_0656904 | |||
| 1348 | Ga0501084_0020362 | |||
| 1349 | Ga0501084_0045525 | |||
| 1350 | Ga0501084_0365834 | |||
| 1351 | Ga0501084_1348225 | |||
| 1352 | Ga0501084_1394613 | |||
| 1353 | Ga0501084_1630324 | |||
| 1354 | Ga0501082_0027159 | |||
| 1355 | Ga0501082_0039715 | |||
| 1356 | Ga0501082_0441204 | |||
| 1357 | Ga0501082_0952046 | |||
| 1358 | Ga0501082_0957968 | |||
| 1359 | Ga0501082_1091897 | |||
| 1360 | Ga0501082_1130432 | |||
| 1361 | Ga0530510_0003316 | |||
| 1362 | Ga0530510_0015398 | |||
| 1363 | Ga0530510_0249247 | |||
| 1364 | Ga0530510_1052793 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zdt-assembly2.cif.gz_D | crystal structure of the ring finger domain of slx1 in complex with the c-terminal domain of slx4 | 0.8239 | 13 | 42 |
| 6amk-assembly1.cif.gz_B | structure of streptomyces venezuelae bldc-whii opt complex | 0.8033 | 12 | 62 |
| 6ama-assembly1.cif.gz_A | structure of s. coelicolor/s. venezuelae bldc-smea-ssfa complex to 3.09 angstrom | 0.7829 | 12 | 67 |
| 6ama-assembly1.cif.gz_B | structure of s. coelicolor/s. venezuelae bldc-smea-ssfa complex to 3.09 angstrom | 0.7824 | 12 | 67 |
| 6amk-assembly1.cif.gz_A | structure of streptomyces venezuelae bldc-whii opt complex | 0.7806 | 6 | 62 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WKT7_24_74_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8881 | 13 | 62 | 1.10.10.10 |
| af_P9WLC3_19_69_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8777 | 13 | 61 | 1.10.10.10 |
| af_Q54NH0_1_55_1.10.238.10 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand | 0.8405 | 9 | 33 | 1.10.238.10 |
| af_O53807_4_54_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8322 | 13 | 66 | 1.10.10.10 |
| af_O53807_4_54_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.7915 | 13 | 66 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z0RSD3-F1-model_v4 | Replication initiation factor domain-containing protein | 0.902 | 12 | 62 |
GO:0003743
|
| AF-A0A364K2N9-F1-model_v4 | HTH merR-type domain-containing protein | 0.8982 | 12 | 61 |
|
| AF-A0A844LSG8-F1-model_v4 | deleted | 0.8878 | 11 | 61 |
|
| AF-A0A0D6ZF00-F1-model_v4 | DNA-binding protein | 0.8766 | 11 | 61 |
|
| AF-A0A7C5Y5C0-F1-model_v4 | Helix-turn-helix domain-containing protein | 0.8753 | 10 | 62 |
|