F474879

General Info

Members Datasets Scaffolds Average Seq Length
682 279 1364 79

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10209206|rootH2_102092062
Length 84
Sequence VATDVPPSATDWISLEEAAGILSASNVRFRPATIGGWARAGKVQSIKLGGRRFVRRGEIRALVAAPRRVRASDLQPGLFEELRD

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
77 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
134 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
138 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
161 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
162 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
176 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
177 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
178 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
179 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
180 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
181 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
182 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
183 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
186 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
187 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
188 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
189 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
190 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
191 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
249 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
250 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
262 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
275 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.68
Rhizosphere 87.98
Stem 0
Stem Tuber 0
Unclassified 31.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10209206 3300003320 Bacteria 1115
2 Ga0070683_100665028 3300005329 Bacteria 997
3 Ga0068869_100930643 3300005334 Bacteria 754
4 Ga0068869_101116947 3300005334 Bacteria 690
5 Ga0070666_11342380 3300005335 Bacteria 534
6 Ga0070680_100000004 3300005336 Bacteria 129387
7 Ga0070680_100229985 3300005336 Bacteria 1566
8 Ga0070680_100343925 3300005336 Unclassified 1268
9 Ga0070680_100796814 3300005336 Unclassified 814
10 Ga0068868_100095923 3300005338 Bacteria 2395
11 Ga0068868_100609529 3300005338 Bacteria 968
12 Ga0068868_100652827 3300005338 Bacteria 937
13 Ga0070689_100959289 3300005340 Unclassified 759
14 Ga0070691_10364628 3300005341 Bacteria 806
15 Ga0070691_10933278 3300005341 Bacteria 537
16 Ga0070687_100197990 3300005343 Bacteria 1215
17 Ga0070687_100363578 3300005343 Bacteria 937
18 Ga0070661_101343502 3300005344 Bacteria 600
19 Ga0070692_11053028 3300005345 Bacteria 572
20 Ga0070668_100136976 3300005347 Bacteria 1970
21 Ga0070668_100221430 3300005347 Bacteria 1561
22 Ga0070668_100468791 3300005347 Unclassified 1086
23 Ga0070675_100764551 3300005354 Unclassified 882
24 Ga0070671_100798047 3300005355 Bacteria 822
25 Ga0070673_100879484 3300005364 Bacteria 830
26 Ga0070673_101806876 3300005364 Bacteria 579
27 Ga0070688_101717942 3300005365 Bacteria 514
28 Ga0070659_100196590 3300005366 Unclassified 1659
29 Ga0070703_10043736 3300005406 Unclassified 1406
30 Ga0070703_10135998 3300005406 Bacteria 908
31 Ga0070701_10502220 3300005438 Bacteria 788
32 Ga0070705_100008081 3300005440 Bacteria 5203
33 Ga0070705_100075304 3300005440 Bacteria 2055
34 Ga0070705_100075614 3300005440 Bacteria 2051
35 Ga0070705_100137080 3300005440 Unclassified 1605
36 Ga0070705_100468609 3300005440 Unclassified 949
37 Ga0070705_100776472 3300005440 Unclassified 760
38 Ga0070705_101142278 3300005440 Bacteria 639
39 Ga0070700_100350218 3300005441 Bacteria 1095
40 Ga0070700_100445335 3300005441 Bacteria 984
41 Ga0070700_100878888 3300005441 Unclassified 728
42 Ga0070694_100023551 3300005444 Bacteria 3962
43 Ga0070694_100132721 3300005444 Bacteria 1801
44 Ga0070694_100134104 3300005444 Unclassified 1792
45 Ga0070694_100162948 3300005444 Bacteria 1638
46 Ga0070694_100184053 3300005444 Bacteria 1547
47 Ga0070694_100199827 3300005444 Unclassified 1489
48 Ga0070694_100207770 3300005444 Unclassified 1463
49 Ga0070694_100248677 3300005444 Unclassified 1344
50 Ga0070694_101507724 3300005444 Bacteria 569
51 Ga0070694_101537238 3300005444 Bacteria 564
52 Ga0070708_100002686 3300005445 Bacteria 13785
53 Ga0070708_100005943 3300005445 Bacteria 9704
54 Ga0070708_100016932 3300005445 Bacteria 6063
55 Ga0070708_100067648 3300005445 Bacteria 3209
56 Ga0070708_100302666 3300005445 Bacteria 1505
57 Ga0070708_100338216 3300005445 Unclassified 1418
58 Ga0070708_101384831 3300005445 Bacteria 656
59 Ga0070663_101464429 3300005455 Unclassified 606
60 Ga0070678_100254543 3300005456 Bacteria 1474
61 Ga0070662_100067198 3300005457 Unclassified 2632
62 Ga0070662_100133481 3300005457 Unclassified 1917
63 Ga0070662_100555108 3300005457 Bacteria 963
64 Ga0070662_100803606 3300005457 Bacteria 800
65 Ga0070681_11225014 3300005458 Bacteria 673
66 Ga0070685_11244421 3300005466 Unclassified 567
67 Ga0070706_100000076 3300005467 Bacteria 114519
68 Ga0070706_100026464 3300005467 Bacteria 5336
69 Ga0070706_100031017 3300005467 Bacteria 4929
70 Ga0070706_100059967 3300005467 Unclassified 3512
71 Ga0070706_100132439 3300005467 Unclassified 2327
72 Ga0070706_100135512 3300005467 Unclassified 2299
73 Ga0070706_100181952 3300005467 Bacteria 1963
74 Ga0070707_100001005 3300005468 Bacteria 27919
75 Ga0070707_100002140 3300005468 Bacteria 18919
76 Ga0070707_100016836 3300005468 Bacteria 6864
77 Ga0070707_100079203 3300005468 Bacteria 3171
78 Ga0070707_100097481 3300005468 Archaea 2848
79 Ga0070707_100141484 3300005468 Bacteria 2342
80 Ga0070707_100393511 3300005468 Bacteria 1346
81 Ga0070707_100597140 3300005468 Unclassified 1066
82 Ga0070698_100004268 3300005471 Bacteria 15715
83 Ga0070698_100012889 3300005471 Bacteria 8852
84 Ga0070698_100060838 3300005471 Bacteria 3810
85 Ga0070698_100356822 3300005471 Bacteria 1394
86 Ga0070698_100572198 3300005471 Bacteria 1069
87 Ga0070698_100668551 3300005471 Bacteria 980
88 Ga0070698_100750366 3300005471 Bacteria 919
89 Ga0070698_101187637 3300005471 Unclassified 712
90 Ga0070698_101789015 3300005471 Unclassified 567
91 Ga0070699_100009857 3300005518 Bacteria 8273
92 Ga0070699_100015555 3300005518 Bacteria 6539
93 Ga0070699_100044947 3300005518 Bacteria 3823
94 Ga0070699_100048538 3300005518 Bacteria 3674
95 Ga0070699_100158662 3300005518 Bacteria 2001
96 Ga0070699_100299456 3300005518 Unclassified 1443
97 Ga0070699_100882857 3300005518 Unclassified 819
98 Ga0070699_102000641 3300005518 Bacteria 530
99 Ga0070679_100853614 3300005530 Bacteria 854
100 Ga0070684_101634629 3300005535 Bacteria 608
101 Ga0070697_100002053 3300005536 Bacteria 15432
102 Ga0070697_100017350 3300005536 Bacteria 5663
103 Ga0070697_100023024 3300005536 Bacteria 4954
104 Ga0070697_100027704 3300005536 Bacteria 4534
105 Ga0070697_100054473 3300005536 Bacteria 3251
106 Ga0070697_100158485 3300005536 Bacteria 1912
107 Ga0070697_100246606 3300005536 Bacteria 1526
108 Ga0070697_100497407 3300005536 Unclassified 1066
109 Ga0068853_100616461 3300005539 Unclassified 1031
110 Ga0070686_100058424 3300005544 Bacteria 2481
111 Ga0070695_100008396 3300005545 Bacteria 6131
112 Ga0070695_100062964 3300005545 Unclassified 2410
113 Ga0070695_100077054 3300005545 Unclassified 2196
114 Ga0070695_100151092 3300005545 Bacteria 1621
115 Ga0070695_100234006 3300005545 Bacteria 1329
116 Ga0070695_100306460 3300005545 Unclassified 1176
117 Ga0070695_100489270 3300005545 Bacteria 949
118 Ga0070695_101806485 3300005545 Bacteria 513
119 Ga0070696_100000947 3300005546 Bacteria 18832
120 Ga0070696_100032403 3300005546 Bacteria 3585
121 Ga0070696_100037249 3300005546 Bacteria 3355
122 Ga0070696_100045833 3300005546 Bacteria 3030
123 Ga0070696_100061369 3300005546 Bacteria 2630
124 Ga0070696_100144302 3300005546 Bacteria 1742
125 Ga0070696_100234834 3300005546 Bacteria 1381
126 Ga0070696_100274918 3300005546 Unclassified 1282
127 Ga0070696_100491469 3300005546 Bacteria 975
128 Ga0070693_100181685 3300005547 Bacteria 1354
129 Ga0070693_100576432 3300005547 Bacteria 809
130 Ga0070693_100861683 3300005547 Bacteria 676
131 Ga0070704_100012305 3300005549 Bacteria 5284
132 Ga0070704_100105568 3300005549 Bacteria 2133
133 Ga0070704_100129919 3300005549 Unclassified 1950
134 Ga0070704_100195090 3300005549 Unclassified 1630
135 Ga0070704_100217054 3300005549 Unclassified 1553
136 Ga0070704_101514708 3300005549 Bacteria 617
137 Ga0068855_100295850 3300005563 Bacteria 1794
138 Ga0068855_100618933 3300005563 Unclassified 1166
139 Ga0068857_100234709 3300005577 Unclassified 1678
140 Ga0068857_100332390 3300005577 Unclassified 1405
141 Ga0068854_100251193 3300005578 Unclassified 1412
142 Ga0068854_101052296 3300005578 Bacteria 723
143 Ga0070702_100053284 3300005615 Bacteria 2323
144 Ga0070702_100099728 3300005615 Unclassified 1779
145 Ga0070702_101092942 3300005615 Bacteria 637
146 Ga0068852_101665646 3300005616 Unclassified 660
147 Ga0068861_100072048 3300005719 Unclassified 2680
148 Ga0068861_100711658 3300005719 Unclassified 934
149 Ga0068860_100062870 3300005843 Bacteria 3527
150 Ga0068860_100096622 3300005843 Bacteria 2816
151 Ga0068860_101228514 3300005843 Bacteria 770
152 Ga0068860_101255533 3300005843 Bacteria 761
153 Ga0068862_100300118 3300005844 Bacteria 1477
154 Ga0068862_100516720 3300005844 Bacteria 1136
155 Ga0068862_101478099 3300005844 Bacteria 684
156 Ga0081538_10121345 3300005981 Bacteria 1255
157 Ga0081539_10008188 3300005985 Bacteria 9210
158 Ga0081539_10342818 3300005985 Bacteria 630
159 Ga0070716_100255216 3300006173 Unclassified 1197
160 Ga0070716_100935899 3300006173 Bacteria 681
161 Ga0070716_101428139 3300006173 Unclassified 563
162 Ga0070712_100815698 3300006175 Bacteria 801
163 Ga0097621_100636291 3300006237 Unclassified 978
164 Ga0075428_100000219 3300006844 Bacteria 55414
165 Ga0075428_100335561 3300006844 Unclassified 1624
166 Ga0075428_102253636 3300006844 Archaea 561
167 Ga0075431_100224370 3300006847 Bacteria 1916
168 Ga0075433_10034667 3300006852 Bacteria 4336
169 Ga0075433_10052542 3300006852 Bacteria 3551
170 Ga0075433_10072483 3300006852 Bacteria 3029
171 Ga0075433_10958574 3300006852 Bacteria 746
172 Ga0075433_11766992 3300006852 Archaea 532
173 Ga0075434_100044017 3300006871 Bacteria 4428
174 Ga0075434_100548274 3300006871 Bacteria 1176
175 Ga0075434_100640903 3300006871 Bacteria 1081
176 Ga0068865_100058228 3300006881 Bacteria 2698
177 Ga0068865_100495145 3300006881 Unclassified 1018
178 Ga0068865_100631805 3300006881 Bacteria 908
179 Ga0075436_100096293 3300006914 Bacteria 2059
180 Ga0075436_100191080 3300006914 Bacteria 1449
181 Ga0075436_100262837 3300006914 Bacteria 1231
182 Ga0075436_100706125 3300006914 Unclassified 747
183 Ga0075435_100065290 3300007076 Bacteria 2958
184 Ga0075435_100081902 3300007076 Bacteria 2652
185 Ga0075435_100387371 3300007076 Bacteria 1201
186 Ga0075435_100452686 3300007076 Bacteria 1107
187 Ga0105250_10355726 3300009092 Unclassified 642
188 Ga0105240_11215893 3300009093 Unclassified 797
189 Ga0111539_10021644 3300009094 Bacteria 7909
190 Ga0111539_10118777 3300009094 Bacteria 3099
191 Ga0111539_13420602 3300009094 Bacteria 510
192 Ga0105245_10063615 3300009098 Bacteria 3332
193 Ga0105245_10069042 3300009098 Bacteria 3204
194 Ga0105245_10259076 3300009098 Unclassified 1692
195 Ga0105245_10469663 3300009098 Bacteria 1269
196 Ga0105245_10505655 3300009098 Bacteria 1225
197 Ga0105245_11217491 3300009098 Unclassified 801
198 Ga0105245_12987731 3300009098 Bacteria 524
199 Ga0114129_10000738 3300009147 Bacteria 41604
200 Ga0114129_10056093 3300009147 Bacteria 5520
201 Ga0105243_10111020 3300009148 Bacteria 2294
202 Ga0105243_10410100 3300009148 Bacteria 1261
203 Ga0105243_10571740 3300009148 Bacteria 1083
204 Ga0105243_10735843 3300009148 Unclassified 965
205 Ga0105243_10742428 3300009148 Bacteria 961
206 Ga0105243_10913863 3300009148 Bacteria 874
207 Ga0105243_13034043 3300009148 Bacteria 509
208 Ga0105241_10522649 3300009174 Unclassified 1061
209 Ga0105242_10248341 3300009176 Unclassified 1602
210 Ga0105242_10907711 3300009176 Unclassified 881
211 Ga0105242_10928301 3300009176 Bacteria 873
212 Ga0105242_11702386 3300009176 Unclassified 667
213 Ga0105242_11764176 3300009176 Unclassified 656
214 Ga0105242_12109006 3300009176 Bacteria 608
215 Ga0105242_12220897 3300009176 Unclassified 594
216 Ga0105248_10643200 3300009177 Bacteria 1197
217 Ga0105248_10884111 3300009177 Bacteria 1009
218 Ga0105238_10334328 3300009551 Bacteria 1502
219 Ga0105249_10094980 3300009553 Bacteria 2795
220 Ga0105249_10232905 3300009553 Bacteria 1817
221 Ga0105249_10290173 3300009553 Unclassified 1637
222 Ga0105249_10376990 3300009553 Bacteria 1444
223 Ga0105249_11264916 3300009553 Bacteria 809
224 Ga0099796_10515263 3300010159 Unclassified 536
225 Ga0105239_10204150 3300010375 Bacteria 2214
226 Ga0105239_10299849 3300010375 Unclassified 1810
227 Ga0105239_11261497 3300010375 Bacteria 852
228 Ga0105246_10150045 3300011119 Bacteria 1763
229 Ga0105246_12260175 3300011119 Unclassified 530
230 Ga0157325_1034347 3300012485 Unclassified 524
231 Ga0157323_1022135 3300012495 Unclassified 614
232 Ga0157373_11328178 3300013100 Bacteria 545
233 Ga0157374_10882785 3300013296 Bacteria 911
234 Ga0157374_10931697 3300013296 Bacteria 887
235 Ga0157374_11732533 3300013296 Bacteria 650
236 Ga0157378_10153498 3300013297 Bacteria 2147
237 Ga0157378_10201917 3300013297 Bacteria 1881
238 Ga0157378_10354378 3300013297 Bacteria 1434
239 Ga0157378_11372181 3300013297 Bacteria 749
240 Ga0157378_11377876 3300013297 Bacteria 748
241 Ga0163162_10596719 3300013306 Unclassified 1231
242 Ga0163162_11260240 3300013306 Bacteria 840
243 Ga0157372_10415662 3300013307 Bacteria 1567
244 Ga0157372_10570311 3300013307 Unclassified 1319
245 Ga0157372_11331912 3300013307 Bacteria 828
246 Ga0157375_10369870 3300013308 Unclassified 1600
247 Ga0157375_12272268 3300013308 Archaea 646
248 Ga0163163_10027493 3300014325 Bacteria 5450
249 Ga0163163_11712723 3300014325 Bacteria 689
250 Ga0163163_12241633 3300014325 Unclassified 605
251 Ga0157380_10692890 3300014326 Unclassified 1023
252 Ga0182008_10033608 3300014497 Unclassified 2573
253 Ga0182008_10362119 3300014497 Bacteria 771
254 Ga0157377_10162272 3300014745 Unclassified 1391
255 Ga0157377_10226952 3300014745 Unclassified 1199
256 Ga0157377_11484304 3300014745 Unclassified 538
257 Ga0157379_10380949 3300014968 Bacteria 1294
258 Ga0157379_12608548 3300014968 Unclassified 506
259 Ga0157376_10324454 3300014969 Bacteria 1465
260 Ga0157376_10540001 3300014969 Bacteria 1152
261 Ga0157376_11568149 3300014969 Bacteria 692
262 Ga0207653_10020526 3300025885 Unclassified 2091
263 Ga0207653_10084252 3300025885 Bacteria 1105
264 Ga0207653_10184681 3300025885 Bacteria 781
265 Ga0207688_10113309 3300025901 Bacteria 1576
266 Ga0207688_10147585 3300025901 Unclassified 1387
267 Ga0207647_10796297 3300025904 Unclassified 509
268 Ga0207645_10296942 3300025907 Bacteria 1075
269 Ga0207645_10405880 3300025907 Bacteria 917
270 Ga0207684_10012109 3300025910 Bacteria 7510
271 Ga0207684_10012499 3300025910 Bacteria 7380
272 Ga0207684_10020370 3300025910 Bacteria 5666
273 Ga0207684_10052627 3300025910 Bacteria 3456
274 Ga0207684_10160841 3300025910 Unclassified 1934
275 Ga0207684_10257344 3300025910 Unclassified 1506
276 Ga0207684_10536349 3300025910 Bacteria 1002
277 Ga0207684_11298265 3300025910 Unclassified 599
278 Ga0207660_10000001 3300025917 Bacteria 1034169
279 Ga0207660_10544880 3300025917 Unclassified 943
280 Ga0207662_10131707 3300025918 Bacteria 1577
281 Ga0207662_10289050 3300025918 Bacteria 1087
282 Ga0207662_10386911 3300025918 Unclassified 946
283 Ga0207657_10743748 3300025919 Bacteria 760
284 Ga0207652_10448312 3300025921 Unclassified 1163
285 Ga0207646_10001570 3300025922 Bacteria 27969
286 Ga0207646_10028092 3300025922 Bacteria 5124
287 Ga0207646_10047024 3300025922 Bacteria 3871
288 Ga0207646_10170937 3300025922 Bacteria 1962
289 Ga0207646_10172138 3300025922 Bacteria 1955
290 Ga0207646_10540642 3300025922 Bacteria 1048
291 Ga0207646_10736371 3300025922 Unclassified 880
292 Ga0207646_10786817 3300025922 Bacteria 848
293 Ga0207646_10831763 3300025922 Bacteria 821
294 Ga0207694_10446743 3300025924 Bacteria 1079
295 Ga0207659_10413507 3300025926 Unclassified 1130
296 Ga0207659_10617811 3300025926 Unclassified 925
297 Ga0207687_10110006 3300025927 Unclassified 2043
298 Ga0207687_10110441 3300025927 Bacteria 2039
299 Ga0207687_10274790 3300025927 Bacteria 1348
300 Ga0207687_10706308 3300025927 Bacteria 856
301 Ga0207687_11272636 3300025927 Bacteria 632
302 Ga0207706_10018442 3300025933 Bacteria 6280
303 Ga0207706_10246626 3300025933 Unclassified 1561
304 Ga0207686_10226712 3300025934 Bacteria 1352
305 Ga0207686_10347580 3300025934 Bacteria 1115
306 Ga0207686_10732082 3300025934 Bacteria 788
307 Ga0207686_10872815 3300025934 Unclassified 725
308 Ga0207709_10061950 3300025935 Bacteria 2339
309 Ga0207709_10431589 3300025935 Bacteria 1014
310 Ga0207709_10559598 3300025935 Unclassified 900
311 Ga0207669_10183489 3300025937 Bacteria 1503
312 Ga0207669_11407554 3300025937 Bacteria 594
313 Ga0207704_10150165 3300025938 Unclassified 1643
314 Ga0207691_11534888 3300025940 Bacteria 543
315 Ga0207711_10646325 3300025941 Bacteria 987
316 Ga0207689_10129617 3300025942 Bacteria 2076
317 Ga0207689_10177869 3300025942 Bacteria 1754
318 Ga0207661_10192512 3300025944 Unclassified 1789
319 Ga0207679_10089454 3300025945 Unclassified 2377
320 Ga0207667_10116368 3300025949 Bacteria 2755
321 Ga0207667_10807571 3300025949 Bacteria 934
322 Ga0207651_10605826 3300025960 Bacteria 958
323 Ga0207651_11264218 3300025960 Unclassified 663
324 Ga0207712_10243897 3300025961 Bacteria 1449
325 Ga0207712_10491284 3300025961 Unclassified 1048
326 Ga0207668_10239256 3300025972 Unclassified 1468
327 Ga0207668_10656067 3300025972 Unclassified 919
328 Ga0207640_10149749 3300025981 Unclassified 1713
329 Ga0207640_10780429 3300025981 Bacteria 826
330 Ga0207658_12131294 3300025986 Unclassified 509
331 Ga0207677_10066272 3300026023 Bacteria 2524
332 Ga0207677_10350110 3300026023 Bacteria 1237
333 Ga0207677_11206287 3300026023 Bacteria 693
334 Ga0207678_10671902 3300026067 Unclassified 911
335 Ga0207678_10695712 3300026067 Unclassified 894
336 Ga0207708_10195376 3300026075 Unclassified 1612
337 Ga0207708_10341469 3300026075 Bacteria 1226
338 Ga0207708_10534118 3300026075 Bacteria 987
339 Ga0207702_10323738 3300026078 Bacteria 1469
340 Ga0207648_10474113 3300026089 Bacteria 1142
341 Ga0207676_10980270 3300026095 Bacteria 832
342 Ga0207674_10184657 3300026116 Unclassified 2036
343 Ga0207674_10202707 3300026116 Unclassified 1933
344 Ga0207674_10675175 3300026116 Unclassified 997
345 Ga0207675_100068905 3300026118 Unclassified 3306
346 Ga0207675_100204605 3300026118 Unclassified 1897
347 Ga0207675_100771368 3300026118 Unclassified 974
348 Ga0207683_10050553 3300026121 Bacteria 3641
349 Ga0207683_10837057 3300026121 Bacteria 854
350 Ga0207683_12095911 3300026121 Bacteria 514
351 Ga0207698_12425568 3300026142 Unclassified 535
352 Ga0209983_1078766 3300027665 Bacteria 738
353 Ga0207428_10117258 3300027907 Unclassified 2044
354 Ga0268265_10627792 3300028380 Unclassified 1030
355 Ga0268265_11532888 3300028380 Bacteria 670
356 Ga0268264_10049948 3300028381 Bacteria 3481
357 Ga0268264_10696038 3300028381 Bacteria 1009
358 Ga0268264_11004931 3300028381 Bacteria 841
359 Ga0268264_11181337 3300028381 Bacteria 774
360 Ga0268264_11609563 3300028381 Bacteria 660
361 Ga0265326_10184090 3300028558 Unclassified 599
362 Ga0265319_1017750 3300028563 Bacteria 2698
363 Ga0265319_1283667 3300028563 Bacteria 503
364 Ga0265334_10056107 3300028573 Bacteria 1497
365 Ga0265318_10037932 3300028577 Bacteria 1844
366 Ga0265318_10046987 3300028577 Bacteria 1629
367 Ga0265318_10233930 3300028577 Bacteria 671
368 Ga0265322_10015025 3300028654 Bacteria 2239
369 Ga0265322_10022247 3300028654 Bacteria 1814
370 Ga0265336_10040166 3300028666 Bacteria 1433
371 Ga0265338_10107977 3300028800 Bacteria 2249
372 Ga0265324_10019431 3300029957 Bacteria 2447
373 Ga0265332_10058451 3300031238 Bacteria 1650
374 Ga0265320_10026721 3300031240 Bacteria 3018
375 Ga0265320_10079397 3300031240 Unclassified 1534
376 Ga0265325_10032610 3300031241 Bacteria 2780
377 Ga0265329_10047703 3300031242 Bacteria 1367
378 Ga0265340_10029397 3300031247 Bacteria 2760
379 Ga0265339_10080486 3300031249 Bacteria 1722
380 Ga0265339_10250500 3300031249 Bacteria 857
381 Ga0265316_10063139 3300031344 Bacteria 2873
382 Ga0307408_100497912 3300031548 Unclassified 1066
383 Ga0265314_10015810 3300031711 Bacteria 5975
384 Ga0265342_10087745 3300031712 Bacteria 1787
385 Ga0307405_12005986 3300031731 Bacteria 518
386 Ga0307413_10268544 3300031824 Bacteria 1276
387 Ga0307410_10052744 3300031852 Unclassified 2749
388 Ga0307410_10530367 3300031852 Unclassified 973
389 Ga0307410_10672534 3300031852 Bacteria 870
390 Ga0307407_10603669 3300031903 Unclassified 817
391 Ga0307407_10873370 3300031903 Bacteria 688
392 Ga0307407_10884074 3300031903 Unclassified 685
393 Ga0307412_10974513 3300031911 Unclassified 748
394 Ga0307409_100330124 3300031995 Bacteria 1431
395 Ga0307409_100390738 3300031995 Bacteria 1326
396 Ga0307409_101650454 3300031995 Unclassified 669
397 Ga0307409_101690343 3300031995 Bacteria 662
398 Ga0307416_101455316 3300032002 Bacteria 791
399 Ga0307416_101868618 3300032002 Bacteria 704
400 Ga0307416_102190833 3300032002 Unclassified 654
401 Ga0307411_10502868 3300032005 Bacteria 1025
402 Ga0307411_10585804 3300032005 Bacteria 957
403 Ga0307415_101629307 3300032126 Unclassified 621
404 Ga0373959_0131475 3300034820 Bacteria 620
405 Ga0373926_0344716 3300035083 Unclassified 584
406 Ga0373929_0179602 3300035085 Bacteria 583
407 Ga0373932_0207689 3300035112 Unclassified 699
408 Ga0373941_0150442 3300035115 Unclassified 854
409 Ga0373960_0375584 3300035121 Bacteria 544
410 Ga0373943_0080086 3300035170 Unclassified 1673
411 Ga0373943_0770298 3300035170 Bacteria 572
412 Ga0373942_0334110 3300035207 Unclassified 532
413 Ga0373962_0034715 3300035242 Unclassified 1398
414 Ga0373962_0270982 3300035242 Unclassified 595
415 Ga0373931_0088932 3300035691 Unclassified 1718
416 Ga0373947_0130215 3300035725 Unclassified 1606
417 Ga0373947_1056858 3300035725 Bacteria 554
418 Ga0373937_0083843 3300036401 Bacteria 2949
419 Ga0373937_0742723 3300036401 Unclassified 929
420 Ga0373937_0815235 3300036401 Unclassified 881
421 Ga0373937_1071420 3300036401 Bacteria 755
422 Ga0373925_1103981 3300037068 Unclassified 653
423 Ga0395900_1032906 3300037418 Unclassified 741
424 Ga0436365_0765767 3300039437 Bacteria 5081
425 Ga0451787_687447 3300041441 Bacteria 538
426 Ga0451798_0280315 3300041458 Bacteria 814
427 Ga0451800_0031615 3300041459 Bacteria 1076
428 Ga0451802_1199723 3300041460 Unclassified 509
429 Ga0451835_0607610 3300041492 Unclassified 1012
430 Ga0451845_0979702 3300041501 Bacteria 1131
431 Ga0451849_0510238 3300041505 Bacteria 629
432 Ga0451849_0732597 3300041505 Bacteria 696
433 Ga0451849_1315850 3300041505 Unclassified 557
434 Ga0451851_1267513 3300041507 Bacteria 518
435 Ga0451843_0341974 3300041509 Bacteria 706
436 Ga0451853_0721060 3300041512 Unclassified 4044
437 Ga0451853_1062934 3300041512 Bacteria 663
438 Ga0451853_2459620 3300041512 Unclassified 593
439 Ga0451853_3135647 3300041512 Bacteria 811
440 Ga0451853_3169035 3300041512 Bacteria 784
441 Ga0451853_3341543 3300041512 Bacteria 1930
442 Ga0451853_3807259 3300041512 Bacteria 901
443 Ga0439441_055415 3300042001 Unclassified 825
444 Ga0439456_164624 3300042013 Unclassified 520
445 Ga0450923_056310 3300042125 Bacteria 852
446 Ga0450905_071183 3300042142 Bacteria 593
447 Ga0450906_021369 3300042145 Bacteria 1157
448 Ga0450910_027036 3300042147 Bacteria 888
449 Ga0450910_055084 3300042147 Bacteria 663
450 Ga0439435_0010683 3300042436 Bacteria 2186
451 Ga0451577_0434987 3300042876 Bacteria 1191
452 Ga0451577_0771813 3300042876 Bacteria 869
453 Ga0451577_1110290 3300042876 Bacteria 707
454 Ga0453683_0193716 3300044673 Bacteria 1290
455 Ga0453683_0358927 3300044673 Unclassified 937
456 Ga0451576_0369598 3300045051 Bacteria 1502
457 Ga0451576_0590075 3300045051 Bacteria 1168
458 Ga0466967_2356843 3300045976 Bacteria 528
459 Ga0495603_0098059 3300046455 Bacteria 1712
460 Ga0495653_0925502 3300046463 Bacteria 518
461 Ga0495582_0919421 3300046473 Bacteria 506
462 Ga0495584_0434380 3300046491 Bacteria 668
463 Ga0495607_0367061 3300046501 Bacteria 661
464 Ga0495608_0763669 3300046511 Bacteria 572
465 Ga0495618_0371116 3300046514 Bacteria 879
466 Ga0495618_0557904 3300046514 Bacteria 685
467 Ga0495630_0490663 3300046517 Bacteria 942
468 Ga0495667_0437029 3300046559 Unclassified 823
469 Ga0495635_0146976 3300046663 Unclassified 1605
470 Ga0495659_0344757 3300046664 Bacteria 636
471 Ga0495588_0185584 3300046674 Bacteria 1099
472 Ga0495657_0074615 3300046675 Bacteria 2207
473 Ga0495657_0377776 3300046675 Unclassified 836
474 Ga0495599_0813382 3300046678 Unclassified 533
475 Ga0495647_0191575 3300046681 Bacteria 894
476 Ga0495647_0329453 3300046681 Bacteria 692
477 Ga0495658_0248725 3300046683 Bacteria 1118
478 Ga0495658_0392165 3300046683 Unclassified 885
479 Ga0495658_0401971 3300046683 Bacteria 873
480 Ga0495670_0336673 3300046691 Unclassified 811
481 Ga0495589_0582820 3300046794 Bacteria 510
482 Ga0495604_0237781 3300047317 Unclassified 1247
483 Ga0495674_0072465 3300047319 Bacteria 2971
484 Ga0495674_0973219 3300047319 Bacteria 652
485 Ga0495676_0815032 3300047321 Bacteria 601
486 Ga0495680_0071659 3300047322 Unclassified 2638
487 Ga0495602_0466291 3300048088 Unclassified 889
488 Ga0496100_0082027 3300048903 Unclassified 2180
489 Ga0496100_0208908 3300048903 Unclassified 1427
490 Ga0496100_0769048 3300048903 Bacteria 754
491 Ga0496101_0063247 3300048904 Unclassified 2693
492 Ga0496101_0209452 3300048904 Bacteria 1510
493 Ga0496101_0419361 3300048904 Bacteria 1055
494 Ga0496101_0962098 3300048904 Bacteria 672
495 Ga0496102_0032699 3300048905 Bacteria 4674
496 Ga0496102_0089110 3300048905 Bacteria 2854
497 Ga0496102_0144998 3300048905 Unclassified 2228
498 Ga0496102_0235666 3300048905 Unclassified 1726
499 Ga0496102_0248225 3300048905 Bacteria 1678
500 Ga0496102_0602213 3300048905 Unclassified 1022
501 Ga0496102_0640525 3300048905 Bacteria 986
502 Ga0496102_1080801 3300048905 Unclassified 722
503 Ga0496103_0023198 3300048906 Bacteria 3741
504 Ga0496103_0062565 3300048906 Archaea 2317
505 Ga0496103_0130956 3300048906 Bacteria 1602
506 Ga0496103_0190691 3300048906 Bacteria 1318
507 Ga0496103_0193456 3300048906 Bacteria 1308
508 Ga0496104_0031392 3300048907 Bacteria 4940
509 Ga0496104_0057140 3300048907 Bacteria 3692
510 Ga0496105_0029703 3300048908 Bacteria 4475
511 Ga0496105_0032184 3300048908 Bacteria 4303
512 Ga0496106_0048480 3300048909 Bacteria 3199
513 Ga0496106_0071570 3300048909 Bacteria 2651
514 Ga0496106_0155286 3300048909 Unclassified 1807
515 Ga0496106_0242305 3300048909 Bacteria 1441
516 Ga0496106_0371138 3300048909 Unclassified 1150
517 Ga0496106_0585225 3300048909 Unclassified 894
518 Ga0496107_0091672 3300048910 Bacteria 2221
519 Ga0496107_0783950 3300048910 Bacteria 698
520 Ga0496107_0953524 3300048910 Bacteria 624
521 Ga0496108_0008582 3300048911 Bacteria 8287
522 Ga0496108_0149691 3300048911 Unclassified 2014
523 Ga0496108_0265445 3300048911 Bacteria 1494
524 Ga0496108_0462999 3300048911 Unclassified 1108
525 Ga0496109_0011146 3300048912 Bacteria 7710
526 Ga0496109_0011762 3300048912 Bacteria 7531
527 Ga0496109_0196175 3300048912 Bacteria 1898
528 Ga0496109_0203719 3300048912 Bacteria 1860
529 Ga0496109_1321111 3300048912 Unclassified 657
530 Ga0496110_0053483 3300048913 Bacteria 3550
531 Ga0496110_0071357 3300048913 Bacteria 3079
532 Ga0496111_0005402 3300048914 Bacteria 8184
533 Ga0496111_0098635 3300048914 Bacteria 2145
534 Ga0496111_0341462 3300048914 Bacteria 1108
535 Ga0496112_0000005 3300048915 Bacteria 525541
536 Ga0496112_0025792 3300048915 Bacteria 5646
537 Ga0496112_0151165 3300048915 Bacteria 2289
538 Ga0496112_0334790 3300048915 Unclassified 1457
539 Ga0496112_1325012 3300048915 Unclassified 635
540 Ga0496113_0044353 3300048916 Bacteria 3294
541 Ga0496113_0218272 3300048916 Unclassified 1519
542 Ga0496113_0312082 3300048916 Bacteria 1260
543 Ga0496113_1042788 3300048916 Bacteria 643
544 Ga0496113_1101019 3300048916 Unclassified 623
545 Ga0496114_0061694 3300048917 Bacteria 3136
546 Ga0496114_0115533 3300048917 Bacteria 2303
547 Ga0496114_0275545 3300048917 Bacteria 1483
548 Ga0496114_1513749 3300048917 Bacteria 559
549 Ga0496115_0677056 3300048918 Bacteria 813
550 Ga0501031_0022983 3300049568 Bacteria 4066
551 Ga0501031_0732592 3300049568 Bacteria 634
552 Ga0501033_0038777 3300049570 Unclassified 3559
553 Ga0501034_0672896 3300049571 Bacteria 935
554 Ga0501036_0010781 3300049572 Bacteria 7553
555 Ga0501036_0761502 3300049572 Bacteria 798
556 Ga0501037_0148915 3300049573 Unclassified 1673
557 Ga0501038_0014355 3300049574 Bacteria 7218
558 Ga0501038_0121349 3300049574 Unclassified 2155
559 Ga0501038_0192742 3300049574 Bacteria 1639
560 Ga0501039_0025325 3300049575 Bacteria 4557
561 Ga0501039_0461657 3300049575 Bacteria 997
562 Ga0501039_0552267 3300049575 Unclassified 904
563 Ga0501040_0012754 3300049576 Bacteria 5516
564 Ga0501040_0201826 3300049576 Bacteria 1412
565 Ga0501040_0683610 3300049576 Bacteria 742
566 Ga0501040_1200290 3300049576 Unclassified 550
567 Ga0501041_0001964 3300049577 Bacteria 11557
568 Ga0501042_0105504 3300049578 Unclassified 2028
569 Ga0501042_0136750 3300049578 Unclassified 1766
570 Ga0501042_0866946 3300049578 Unclassified 657
571 Ga0501043_0065106 3300049579 Unclassified 2862
572 Ga0501046_0018989 3300049580 Bacteria 5706
573 Ga0501048_0058634 3300049582 Unclassified 2728
574 Ga0501048_0580269 3300049582 Unclassified 805
575 Ga0501067_0002998 3300049583 Bacteria 9316
576 Ga0501067_0071909 3300049583 Bacteria 1916
577 Ga0501067_0120781 3300049583 Unclassified 1458
578 Ga0501067_0666324 3300049583 Bacteria 584
579 Ga0501068_0057398 3300049584 Unclassified 2360
580 Ga0501068_0073378 3300049584 Bacteria 2091
581 Ga0501068_0155224 3300049584 Unclassified 1440
582 Ga0501068_0238634 3300049584 Bacteria 1157
583 Ga0501069_0010166 3300049585 Bacteria 4977
584 Ga0501069_0019369 3300049585 Bacteria 3679
585 Ga0501069_0267089 3300049585 Unclassified 1000
586 Ga0501070_0008559 3300049586 Bacteria 8649
587 Ga0501070_0362316 3300049586 Unclassified 1176
588 Ga0501071_0155274 3300049587 Bacteria 1708
589 Ga0501071_0886627 3300049587 Unclassified 688
590 Ga0501071_1116195 3300049587 Unclassified 609
591 Ga0501071_1242718 3300049587 Unclassified 575
592 Ga0501071_1415265 3300049587 Bacteria 537
593 Ga0501072_0008571 3300049588 Bacteria 7755
594 Ga0501072_0078557 3300049588 Bacteria 2613
595 Ga0501072_0440366 3300049588 Unclassified 1032
596 Ga0501072_0694582 3300049588 Bacteria 800
597 Ga0501072_0866983 3300049588 Bacteria 706
598 Ga0501072_0870625 3300049588 Unclassified 704
599 Ga0501073_0034131 3300049589 Unclassified 3622
600 Ga0501074_0186885 3300049590 Bacteria 1477
601 Ga0501074_0885610 3300049590 Bacteria 628
602 Ga0501075_0003922 3300049591 Bacteria 10022
603 Ga0501075_0110039 3300049591 Bacteria 2095
604 Ga0501075_0367777 3300049591 Bacteria 1096
605 Ga0501075_0447922 3300049591 Unclassified 984
606 Ga0501075_0469830 3300049591 Unclassified 959
607 Ga0501075_0560867 3300049591 Bacteria 871
608 Ga0501076_0012429 3300049592 Bacteria 6363
609 Ga0501076_0035128 3300049592 Bacteria 3922
610 Ga0501076_0052652 3300049592 Unclassified 3225
611 Ga0501076_1380492 3300049592 Bacteria 579
612 Ga0501077_0007873 3300049593 Bacteria 6582
613 Ga0501077_0363634 3300049593 Unclassified 924
614 Ga0501077_0398977 3300049593 Unclassified 879
615 Ga0501077_0407984 3300049593 Unclassified 869
616 Ga0501077_0653865 3300049593 Bacteria 675
617 Ga0501079_0133598 3300049741 Unclassified 1931
618 Ga0501079_0551715 3300049741 Bacteria 906
619 Ga0501079_0773561 3300049741 Unclassified 756
620 Ga0501080_0002533 3300049742 Bacteria 15990
621 Ga0501080_0204135 3300049742 Bacteria 1814
622 Ga0501080_0316631 3300049742 Bacteria 1413
623 Ga0501080_1325592 3300049742 Bacteria 616
624 Ga0501081_0016561 3300049743 Bacteria 4874
625 Ga0501081_0070099 3300049743 Unclassified 2443
626 Ga0501081_0181540 3300049743 Bacteria 1522
627 Ga0501083_0151530 3300049744 Unclassified 1518
628 Ga0501035_0052987 3300049822 Bacteria 3629
629 Ga0501044_0276434 3300049823 Unclassified 1614
630 Ga0501045_0026997 3300049824 Bacteria 4134
631 Ga0501045_0123671 3300049824 Unclassified 1921
632 Ga0501045_0194510 3300049824 Bacteria 1511
633 Ga0501045_0237170 3300049824 Bacteria 1358
634 nmdc:mga05p37_479_c1 3300050507 Bacteria 43660
635 nmdc:mga05p37_60876_c1 3300050507 Unclassified 4648
636 nmdc:mga05p37_715099_c1 3300050507 Bacteria 1110
637 nmdc:mga06r32_227720_c1 3300050510 Bacteria 1852
638 nmdc:mga08y16_185693_c1 3300050511 Unclassified 2158
639 nmdc:mga08y16_489716_c1 3300050511 Unclassified 1250
640 nmdc:mga0n895_190315_c1 3300050512 Bacteria 2083
641 nmdc:mga0n895_380716_c1 3300050512 Archaea 1428
642 nmdc:mga0n895_544187_c1 3300050512 Bacteria 1167
643 nmdc:mga0n895_684952_c1 3300050512 Bacteria 1022
644 nmdc:mga0n895_736823_c1 3300050512 Bacteria 979
645 nmdc:mga0rr50_317504_c1 3300050513 Bacteria 1305
646 nmdc:mga0rr50_625495_c1 3300050513 Bacteria 918
647 nmdc:mga0rr50_713284_c1 3300050513 Bacteria 856
648 nmdc:mga0rr50_72568_c1 3300050513 Bacteria 2629
649 nmdc:mga0rr50_948970_c1 3300050513 Unclassified 733
650 nmdc:mga08x19_155710_c1 3300050514 Bacteria 1549
651 nmdc:mga08x19_332316_c1 3300050514 Bacteria 1059
652 nmdc:mga0a205_118151_c1 3300050515 Bacteria 2550
653 nmdc:mga0a205_155009_c1 3300050515 Bacteria 2189
654 nmdc:mga0a205_793514_c1 3300050515 Bacteria 795
655 nmdc:mga0a205_81463_c1 3300050515 Bacteria 3127
656 nmdc:mga0a205_99768_c1 3300050515 Bacteria 2802
657 Ga0495601_0010055 3300053077 Bacteria 5616
658 Ga0495601_0202512 3300053077 Bacteria 1297
659 Ga0495601_0297955 3300053077 Unclassified 1051
660 Ga0495612_0002104 3300053078 Bacteria 8182
661 Ga0495595_0509510 3300053084 Bacteria 613
662 Ga0495595_0609392 3300053084 Bacteria 558
663 Ga0495619_0044175 3300053085 Unclassified 2924
664 Ga0495619_0450747 3300053085 Bacteria 887
665 Ga0495619_0656904 3300053085 Bacteria 715
666 Ga0501084_0020362 3300054114 Bacteria 5531
667 Ga0501084_0045525 3300054114 Bacteria 3674
668 Ga0501084_0365834 3300054114 Bacteria 1219
669 Ga0501084_1348225 3300054114 Unclassified 598
670 Ga0501084_1394613 3300054114 Bacteria 587
671 Ga0501084_1630324 3300054114 Unclassified 539
672 Ga0501082_0027159 3300060353 Bacteria 4930
673 Ga0501082_0039715 3300060353 Bacteria 4060
674 Ga0501082_0441204 3300060353 Bacteria 1137
675 Ga0501082_0952046 3300060353 Unclassified 751
676 Ga0501082_0957968 3300060353 Bacteria 748
677 Ga0501082_1091897 3300060353 Bacteria 698
678 Ga0501082_1130432 3300060353 Unclassified 685
679 Ga0530510_0003316 3300061734 Bacteria 11077
680 Ga0530510_0015398 3300061734 Bacteria 5404
681 Ga0530510_0249247 3300061734 Unclassified 1323
682 Ga0530510_1052793 3300061734 Bacteria 623
683 rootH2_10209206
684 Ga0070683_100665028
685 Ga0068869_100930643
686 Ga0068869_101116947
687 Ga0070666_11342380
688 Ga0070680_100000004
689 Ga0070680_100229985
690 Ga0070680_100343925
691 Ga0070680_100796814
692 Ga0068868_100095923
693 Ga0068868_100609529
694 Ga0068868_100652827
695 Ga0070689_100959289
696 Ga0070691_10364628
697 Ga0070691_10933278
698 Ga0070687_100197990
699 Ga0070687_100363578
700 Ga0070661_101343502
701 Ga0070692_11053028
702 Ga0070668_100136976
703 Ga0070668_100221430
704 Ga0070668_100468791
705 Ga0070675_100764551
706 Ga0070671_100798047
707 Ga0070673_100879484
708 Ga0070673_101806876
709 Ga0070688_101717942
710 Ga0070659_100196590
711 Ga0070703_10043736
712 Ga0070703_10135998
713 Ga0070701_10502220
714 Ga0070705_100008081
715 Ga0070705_100075304
716 Ga0070705_100075614
717 Ga0070705_100137080
718 Ga0070705_100468609
719 Ga0070705_100776472
720 Ga0070705_101142278
721 Ga0070700_100350218
722 Ga0070700_100445335
723 Ga0070700_100878888
724 Ga0070694_100023551
725 Ga0070694_100132721
726 Ga0070694_100134104
727 Ga0070694_100162948
728 Ga0070694_100184053
729 Ga0070694_100199827
730 Ga0070694_100207770
731 Ga0070694_100248677
732 Ga0070694_101507724
733 Ga0070694_101537238
734 Ga0070708_100002686
735 Ga0070708_100005943
736 Ga0070708_100016932
737 Ga0070708_100067648
738 Ga0070708_100302666
739 Ga0070708_100338216
740 Ga0070708_101384831
741 Ga0070663_101464429
742 Ga0070678_100254543
743 Ga0070662_100067198
744 Ga0070662_100133481
745 Ga0070662_100555108
746 Ga0070662_100803606
747 Ga0070681_11225014
748 Ga0070685_11244421
749 Ga0070706_100000076
750 Ga0070706_100026464
751 Ga0070706_100031017
752 Ga0070706_100059967
753 Ga0070706_100132439
754 Ga0070706_100135512
755 Ga0070706_100181952
756 Ga0070707_100001005
757 Ga0070707_100002140
758 Ga0070707_100016836
759 Ga0070707_100079203
760 Ga0070707_100097481
761 Ga0070707_100141484
762 Ga0070707_100393511
763 Ga0070707_100597140
764 Ga0070698_100004268
765 Ga0070698_100012889
766 Ga0070698_100060838
767 Ga0070698_100356822
768 Ga0070698_100572198
769 Ga0070698_100668551
770 Ga0070698_100750366
771 Ga0070698_101187637
772 Ga0070698_101789015
773 Ga0070699_100009857
774 Ga0070699_100015555
775 Ga0070699_100044947
776 Ga0070699_100048538
777 Ga0070699_100158662
778 Ga0070699_100299456
779 Ga0070699_100882857
780 Ga0070699_102000641
781 Ga0070679_100853614
782 Ga0070684_101634629
783 Ga0070697_100002053
784 Ga0070697_100017350
785 Ga0070697_100023024
786 Ga0070697_100027704
787 Ga0070697_100054473
788 Ga0070697_100158485
789 Ga0070697_100246606
790 Ga0070697_100497407
791 Ga0068853_100616461
792 Ga0070686_100058424
793 Ga0070695_100008396
794 Ga0070695_100062964
795 Ga0070695_100077054
796 Ga0070695_100151092
797 Ga0070695_100234006
798 Ga0070695_100306460
799 Ga0070695_100489270
800 Ga0070695_101806485
801 Ga0070696_100000947
802 Ga0070696_100032403
803 Ga0070696_100037249
804 Ga0070696_100045833
805 Ga0070696_100061369
806 Ga0070696_100144302
807 Ga0070696_100234834
808 Ga0070696_100274918
809 Ga0070696_100491469
810 Ga0070693_100181685
811 Ga0070693_100576432
812 Ga0070693_100861683
813 Ga0070704_100012305
814 Ga0070704_100105568
815 Ga0070704_100129919
816 Ga0070704_100195090
817 Ga0070704_100217054
818 Ga0070704_101514708
819 Ga0068855_100295850
820 Ga0068855_100618933
821 Ga0068857_100234709
822 Ga0068857_100332390
823 Ga0068854_100251193
824 Ga0068854_101052296
825 Ga0070702_100053284
826 Ga0070702_100099728
827 Ga0070702_101092942
828 Ga0068852_101665646
829 Ga0068861_100072048
830 Ga0068861_100711658
831 Ga0068860_100062870
832 Ga0068860_100096622
833 Ga0068860_101228514
834 Ga0068860_101255533
835 Ga0068862_100300118
836 Ga0068862_100516720
837 Ga0068862_101478099
838 Ga0081538_10121345
839 Ga0081539_10008188
840 Ga0081539_10342818
841 Ga0070716_100255216
842 Ga0070716_100935899
843 Ga0070716_101428139
844 Ga0070712_100815698
845 Ga0097621_100636291
846 Ga0075428_100000219
847 Ga0075428_100335561
848 Ga0075428_102253636
849 Ga0075431_100224370
850 Ga0075433_10034667
851 Ga0075433_10052542
852 Ga0075433_10072483
853 Ga0075433_10958574
854 Ga0075433_11766992
855 Ga0075434_100044017
856 Ga0075434_100548274
857 Ga0075434_100640903
858 Ga0068865_100058228
859 Ga0068865_100495145
860 Ga0068865_100631805
861 Ga0075436_100096293
862 Ga0075436_100191080
863 Ga0075436_100262837
864 Ga0075436_100706125
865 Ga0075435_100065290
866 Ga0075435_100081902
867 Ga0075435_100387371
868 Ga0075435_100452686
869 Ga0105250_10355726
870 Ga0105240_11215893
871 Ga0111539_10021644
872 Ga0111539_10118777
873 Ga0111539_13420602
874 Ga0105245_10063615
875 Ga0105245_10069042
876 Ga0105245_10259076
877 Ga0105245_10469663
878 Ga0105245_10505655
879 Ga0105245_11217491
880 Ga0105245_12987731
881 Ga0114129_10000738
882 Ga0114129_10056093
883 Ga0105243_10111020
884 Ga0105243_10410100
885 Ga0105243_10571740
886 Ga0105243_10735843
887 Ga0105243_10742428
888 Ga0105243_10913863
889 Ga0105243_13034043
890 Ga0105241_10522649
891 Ga0105242_10248341
892 Ga0105242_10907711
893 Ga0105242_10928301
894 Ga0105242_11702386
895 Ga0105242_11764176
896 Ga0105242_12109006
897 Ga0105242_12220897
898 Ga0105248_10643200
899 Ga0105248_10884111
900 Ga0105238_10334328
901 Ga0105249_10094980
902 Ga0105249_10232905
903 Ga0105249_10290173
904 Ga0105249_10376990
905 Ga0105249_11264916
906 Ga0099796_10515263
907 Ga0105239_10204150
908 Ga0105239_10299849
909 Ga0105239_11261497
910 Ga0105246_10150045
911 Ga0105246_12260175
912 Ga0157325_1034347
913 Ga0157323_1022135
914 Ga0157373_11328178
915 Ga0157374_10882785
916 Ga0157374_10931697
917 Ga0157374_11732533
918 Ga0157378_10153498
919 Ga0157378_10201917
920 Ga0157378_10354378
921 Ga0157378_11372181
922 Ga0157378_11377876
923 Ga0163162_10596719
924 Ga0163162_11260240
925 Ga0157372_10415662
926 Ga0157372_10570311
927 Ga0157372_11331912
928 Ga0157375_10369870
929 Ga0157375_12272268
930 Ga0163163_10027493
931 Ga0163163_11712723
932 Ga0163163_12241633
933 Ga0157380_10692890
934 Ga0182008_10033608
935 Ga0182008_10362119
936 Ga0157377_10162272
937 Ga0157377_10226952
938 Ga0157377_11484304
939 Ga0157379_10380949
940 Ga0157379_12608548
941 Ga0157376_10324454
942 Ga0157376_10540001
943 Ga0157376_11568149
944 Ga0207653_10020526
945 Ga0207653_10084252
946 Ga0207653_10184681
947 Ga0207688_10113309
948 Ga0207688_10147585
949 Ga0207647_10796297
950 Ga0207645_10296942
951 Ga0207645_10405880
952 Ga0207684_10012109
953 Ga0207684_10012499
954 Ga0207684_10020370
955 Ga0207684_10052627
956 Ga0207684_10160841
957 Ga0207684_10257344
958 Ga0207684_10536349
959 Ga0207684_11298265
960 Ga0207660_10000001
961 Ga0207660_10544880
962 Ga0207662_10131707
963 Ga0207662_10289050
964 Ga0207662_10386911
965 Ga0207657_10743748
966 Ga0207652_10448312
967 Ga0207646_10001570
968 Ga0207646_10028092
969 Ga0207646_10047024
970 Ga0207646_10170937
971 Ga0207646_10172138
972 Ga0207646_10540642
973 Ga0207646_10736371
974 Ga0207646_10786817
975 Ga0207646_10831763
976 Ga0207694_10446743
977 Ga0207659_10413507
978 Ga0207659_10617811
979 Ga0207687_10110006
980 Ga0207687_10110441
981 Ga0207687_10274790
982 Ga0207687_10706308
983 Ga0207687_11272636
984 Ga0207706_10018442
985 Ga0207706_10246626
986 Ga0207686_10226712
987 Ga0207686_10347580
988 Ga0207686_10732082
989 Ga0207686_10872815
990 Ga0207709_10061950
991 Ga0207709_10431589
992 Ga0207709_10559598
993 Ga0207669_10183489
994 Ga0207669_11407554
995 Ga0207704_10150165
996 Ga0207691_11534888
997 Ga0207711_10646325
998 Ga0207689_10129617
999 Ga0207689_10177869
1000 Ga0207661_10192512
1001 Ga0207679_10089454
1002 Ga0207667_10116368
1003 Ga0207667_10807571
1004 Ga0207651_10605826
1005 Ga0207651_11264218
1006 Ga0207712_10243897
1007 Ga0207712_10491284
1008 Ga0207668_10239256
1009 Ga0207668_10656067
1010 Ga0207640_10149749
1011 Ga0207640_10780429
1012 Ga0207658_12131294
1013 Ga0207677_10066272
1014 Ga0207677_10350110
1015 Ga0207677_11206287
1016 Ga0207678_10671902
1017 Ga0207678_10695712
1018 Ga0207708_10195376
1019 Ga0207708_10341469
1020 Ga0207708_10534118
1021 Ga0207702_10323738
1022 Ga0207648_10474113
1023 Ga0207676_10980270
1024 Ga0207674_10184657
1025 Ga0207674_10202707
1026 Ga0207674_10675175
1027 Ga0207675_100068905
1028 Ga0207675_100204605
1029 Ga0207675_100771368
1030 Ga0207683_10050553
1031 Ga0207683_10837057
1032 Ga0207683_12095911
1033 Ga0207698_12425568
1034 Ga0209983_1078766
1035 Ga0207428_10117258
1036 Ga0268265_10627792
1037 Ga0268265_11532888
1038 Ga0268264_10049948
1039 Ga0268264_10696038
1040 Ga0268264_11004931
1041 Ga0268264_11181337
1042 Ga0268264_11609563
1043 Ga0265326_10184090
1044 Ga0265319_1017750
1045 Ga0265319_1283667
1046 Ga0265334_10056107
1047 Ga0265318_10037932
1048 Ga0265318_10046987
1049 Ga0265318_10233930
1050 Ga0265322_10015025
1051 Ga0265322_10022247
1052 Ga0265336_10040166
1053 Ga0265338_10107977
1054 Ga0265324_10019431
1055 Ga0265332_10058451
1056 Ga0265320_10026721
1057 Ga0265320_10079397
1058 Ga0265325_10032610
1059 Ga0265329_10047703
1060 Ga0265340_10029397
1061 Ga0265339_10080486
1062 Ga0265339_10250500
1063 Ga0265316_10063139
1064 Ga0307408_100497912
1065 Ga0265314_10015810
1066 Ga0265342_10087745
1067 Ga0307405_12005986
1068 Ga0307413_10268544
1069 Ga0307410_10052744
1070 Ga0307410_10530367
1071 Ga0307410_10672534
1072 Ga0307407_10603669
1073 Ga0307407_10873370
1074 Ga0307407_10884074
1075 Ga0307412_10974513
1076 Ga0307409_100330124
1077 Ga0307409_100390738
1078 Ga0307409_101650454
1079 Ga0307409_101690343
1080 Ga0307416_101455316
1081 Ga0307416_101868618
1082 Ga0307416_102190833
1083 Ga0307411_10502868
1084 Ga0307411_10585804
1085 Ga0307415_101629307
1086 Ga0373959_0131475
1087 Ga0373926_0344716
1088 Ga0373929_0179602
1089 Ga0373932_0207689
1090 Ga0373941_0150442
1091 Ga0373960_0375584
1092 Ga0373943_0080086
1093 Ga0373943_0770298
1094 Ga0373942_0334110
1095 Ga0373962_0034715
1096 Ga0373962_0270982
1097 Ga0373931_0088932
1098 Ga0373947_0130215
1099 Ga0373947_1056858
1100 Ga0373937_0083843
1101 Ga0373937_0742723
1102 Ga0373937_0815235
1103 Ga0373937_1071420
1104 Ga0373925_1103981
1105 Ga0395900_1032906
1106 Ga0436365_0765767
1107 Ga0451787_687447
1108 Ga0451798_0280315
1109 Ga0451800_0031615
1110 Ga0451802_1199723
1111 Ga0451835_0607610
1112 Ga0451845_0979702
1113 Ga0451849_0510238
1114 Ga0451849_0732597
1115 Ga0451849_1315850
1116 Ga0451851_1267513
1117 Ga0451843_0341974
1118 Ga0451853_0721060
1119 Ga0451853_1062934
1120 Ga0451853_2459620
1121 Ga0451853_3135647
1122 Ga0451853_3169035
1123 Ga0451853_3341543
1124 Ga0451853_3807259
1125 Ga0439441_055415
1126 Ga0439456_164624
1127 Ga0450923_056310
1128 Ga0450905_071183
1129 Ga0450906_021369
1130 Ga0450910_027036
1131 Ga0450910_055084
1132 Ga0439435_0010683
1133 Ga0451577_0434987
1134 Ga0451577_0771813
1135 Ga0451577_1110290
1136 Ga0453683_0193716
1137 Ga0453683_0358927
1138 Ga0451576_0369598
1139 Ga0451576_0590075
1140 Ga0466967_2356843
1141 Ga0495603_0098059
1142 Ga0495653_0925502
1143 Ga0495582_0919421
1144 Ga0495584_0434380
1145 Ga0495607_0367061
1146 Ga0495608_0763669
1147 Ga0495618_0371116
1148 Ga0495618_0557904
1149 Ga0495630_0490663
1150 Ga0495667_0437029
1151 Ga0495635_0146976
1152 Ga0495659_0344757
1153 Ga0495588_0185584
1154 Ga0495657_0074615
1155 Ga0495657_0377776
1156 Ga0495599_0813382
1157 Ga0495647_0191575
1158 Ga0495647_0329453
1159 Ga0495658_0248725
1160 Ga0495658_0392165
1161 Ga0495658_0401971
1162 Ga0495670_0336673
1163 Ga0495589_0582820
1164 Ga0495604_0237781
1165 Ga0495674_0072465
1166 Ga0495674_0973219
1167 Ga0495676_0815032
1168 Ga0495680_0071659
1169 Ga0495602_0466291
1170 Ga0496100_0082027
1171 Ga0496100_0208908
1172 Ga0496100_0769048
1173 Ga0496101_0063247
1174 Ga0496101_0209452
1175 Ga0496101_0419361
1176 Ga0496101_0962098
1177 Ga0496102_0032699
1178 Ga0496102_0089110
1179 Ga0496102_0144998
1180 Ga0496102_0235666
1181 Ga0496102_0248225
1182 Ga0496102_0602213
1183 Ga0496102_0640525
1184 Ga0496102_1080801
1185 Ga0496103_0023198
1186 Ga0496103_0062565
1187 Ga0496103_0130956
1188 Ga0496103_0190691
1189 Ga0496103_0193456
1190 Ga0496104_0031392
1191 Ga0496104_0057140
1192 Ga0496105_0029703
1193 Ga0496105_0032184
1194 Ga0496106_0048480
1195 Ga0496106_0071570
1196 Ga0496106_0155286
1197 Ga0496106_0242305
1198 Ga0496106_0371138
1199 Ga0496106_0585225
1200 Ga0496107_0091672
1201 Ga0496107_0783950
1202 Ga0496107_0953524
1203 Ga0496108_0008582
1204 Ga0496108_0149691
1205 Ga0496108_0265445
1206 Ga0496108_0462999
1207 Ga0496109_0011146
1208 Ga0496109_0011762
1209 Ga0496109_0196175
1210 Ga0496109_0203719
1211 Ga0496109_1321111
1212 Ga0496110_0053483
1213 Ga0496110_0071357
1214 Ga0496111_0005402
1215 Ga0496111_0098635
1216 Ga0496111_0341462
1217 Ga0496112_0000005
1218 Ga0496112_0025792
1219 Ga0496112_0151165
1220 Ga0496112_0334790
1221 Ga0496112_1325012
1222 Ga0496113_0044353
1223 Ga0496113_0218272
1224 Ga0496113_0312082
1225 Ga0496113_1042788
1226 Ga0496113_1101019
1227 Ga0496114_0061694
1228 Ga0496114_0115533
1229 Ga0496114_0275545
1230 Ga0496114_1513749
1231 Ga0496115_0677056
1232 Ga0501031_0022983
1233 Ga0501031_0732592
1234 Ga0501033_0038777
1235 Ga0501034_0672896
1236 Ga0501036_0010781
1237 Ga0501036_0761502
1238 Ga0501037_0148915
1239 Ga0501038_0014355
1240 Ga0501038_0121349
1241 Ga0501038_0192742
1242 Ga0501039_0025325
1243 Ga0501039_0461657
1244 Ga0501039_0552267
1245 Ga0501040_0012754
1246 Ga0501040_0201826
1247 Ga0501040_0683610
1248 Ga0501040_1200290
1249 Ga0501041_0001964
1250 Ga0501042_0105504
1251 Ga0501042_0136750
1252 Ga0501042_0866946
1253 Ga0501043_0065106
1254 Ga0501046_0018989
1255 Ga0501048_0058634
1256 Ga0501048_0580269
1257 Ga0501067_0002998
1258 Ga0501067_0071909
1259 Ga0501067_0120781
1260 Ga0501067_0666324
1261 Ga0501068_0057398
1262 Ga0501068_0073378
1263 Ga0501068_0155224
1264 Ga0501068_0238634
1265 Ga0501069_0010166
1266 Ga0501069_0019369
1267 Ga0501069_0267089
1268 Ga0501070_0008559
1269 Ga0501070_0362316
1270 Ga0501071_0155274
1271 Ga0501071_0886627
1272 Ga0501071_1116195
1273 Ga0501071_1242718
1274 Ga0501071_1415265
1275 Ga0501072_0008571
1276 Ga0501072_0078557
1277 Ga0501072_0440366
1278 Ga0501072_0694582
1279 Ga0501072_0866983
1280 Ga0501072_0870625
1281 Ga0501073_0034131
1282 Ga0501074_0186885
1283 Ga0501074_0885610
1284 Ga0501075_0003922
1285 Ga0501075_0110039
1286 Ga0501075_0367777
1287 Ga0501075_0447922
1288 Ga0501075_0469830
1289 Ga0501075_0560867
1290 Ga0501076_0012429
1291 Ga0501076_0035128
1292 Ga0501076_0052652
1293 Ga0501076_1380492
1294 Ga0501077_0007873
1295 Ga0501077_0363634
1296 Ga0501077_0398977
1297 Ga0501077_0407984
1298 Ga0501077_0653865
1299 Ga0501079_0133598
1300 Ga0501079_0551715
1301 Ga0501079_0773561
1302 Ga0501080_0002533
1303 Ga0501080_0204135
1304 Ga0501080_0316631
1305 Ga0501080_1325592
1306 Ga0501081_0016561
1307 Ga0501081_0070099
1308 Ga0501081_0181540
1309 Ga0501083_0151530
1310 Ga0501035_0052987
1311 Ga0501044_0276434
1312 Ga0501045_0026997
1313 Ga0501045_0123671
1314 Ga0501045_0194510
1315 Ga0501045_0237170
1316 nmdc:mga05p37_479_c1
1317 nmdc:mga05p37_60876_c1
1318 nmdc:mga05p37_715099_c1
1319 nmdc:mga06r32_227720_c1
1320 nmdc:mga08y16_185693_c1
1321 nmdc:mga08y16_489716_c1
1322 nmdc:mga0n895_190315_c1
1323 nmdc:mga0n895_380716_c1
1324 nmdc:mga0n895_544187_c1
1325 nmdc:mga0n895_684952_c1
1326 nmdc:mga0n895_736823_c1
1327 nmdc:mga0rr50_317504_c1
1328 nmdc:mga0rr50_625495_c1
1329 nmdc:mga0rr50_713284_c1
1330 nmdc:mga0rr50_72568_c1
1331 nmdc:mga0rr50_948970_c1
1332 nmdc:mga08x19_155710_c1
1333 nmdc:mga08x19_332316_c1
1334 nmdc:mga0a205_118151_c1
1335 nmdc:mga0a205_155009_c1
1336 nmdc:mga0a205_793514_c1
1337 nmdc:mga0a205_81463_c1
1338 nmdc:mga0a205_99768_c1
1339 Ga0495601_0010055
1340 Ga0495601_0202512
1341 Ga0495601_0297955
1342 Ga0495612_0002104
1343 Ga0495595_0509510
1344 Ga0495595_0609392
1345 Ga0495619_0044175
1346 Ga0495619_0450747
1347 Ga0495619_0656904
1348 Ga0501084_0020362
1349 Ga0501084_0045525
1350 Ga0501084_0365834
1351 Ga0501084_1348225
1352 Ga0501084_1394613
1353 Ga0501084_1630324
1354 Ga0501082_0027159
1355 Ga0501082_0039715
1356 Ga0501082_0441204
1357 Ga0501082_0952046
1358 Ga0501082_0957968
1359 Ga0501082_1091897
1360 Ga0501082_1130432
1361 Ga0530510_0003316
1362 Ga0530510_0015398
1363 Ga0530510_0249247
1364 Ga0530510_1052793

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zdt-assembly2.cif.gz_D crystal structure of the ring finger domain of slx1 in complex with the c-terminal domain of slx4 0.8239 13 42
6amk-assembly1.cif.gz_B structure of streptomyces venezuelae bldc-whii opt complex 0.8033 12 62
6ama-assembly1.cif.gz_A structure of s. coelicolor/s. venezuelae bldc-smea-ssfa complex to 3.09 angstrom 0.7829 12 67
6ama-assembly1.cif.gz_B structure of s. coelicolor/s. venezuelae bldc-smea-ssfa complex to 3.09 angstrom 0.7824 12 67
6amk-assembly1.cif.gz_A structure of streptomyces venezuelae bldc-whii opt complex 0.7806 6 62
ID Description Score Start End Superfamily
af_P9WKT7_24_74_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8881 13 62 1.10.10.10
af_P9WLC3_19_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8777 13 61 1.10.10.10
af_Q54NH0_1_55_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.8405 9 33 1.10.238.10
af_O53807_4_54_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8322 13 66 1.10.10.10
af_O53807_4_54_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7915 13 66 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Z0RSD3-F1-model_v4 Replication initiation factor domain-containing protein 0.902 12 62 GO:0003743
AF-A0A364K2N9-F1-model_v4 HTH merR-type domain-containing protein 0.8982 12 61
AF-A0A844LSG8-F1-model_v4 deleted 0.8878 11 61
AF-A0A0D6ZF00-F1-model_v4 DNA-binding protein 0.8766 11 61
AF-A0A7C5Y5C0-F1-model_v4 Helix-turn-helix domain-containing protein 0.8753 10 62

Map