F474859

General Info

Members Datasets Scaffolds Average Seq Length
681 224 1362 175

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0283313|Ga0495606_0283313_129_656
Length 163
Sequence MSRAVRFAPLALFLAIVIALIWRLATPTDTSVPSRLEGKPLPAFDLGDFADGRPHILNIFASWCVPCIGEVKVLQELKSRGAVIEGVAIRDTPEAVAAFLARNGDPYDKIGGDPQSALQISLGSSGVPESFIVDGKGVIRYQHIGPIERGDIGMIEQKLEQAR

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
164 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
165 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
179 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
180 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
181 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
182 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
190 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
196 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
197 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
215 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.31
Rhizosphere 92.8
Stem 0
Stem Tuber 0
Unclassified 2.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0283313 3300046507 Bacteria 905
2 JGI24741J21665_1018936 3300001915 Bacteria 1095
3 JGI24740J21852_10003670 3300001979 Bacteria 6682
4 JGI24740J21852_10036574 3300001979 Bacteria 1524
5 JGI24739J22299_10033755 3300001989 Bacteria 1748
6 JGI24739J22299_10083208 3300001989 Bacteria 980
7 JGI24737J22298_10001076 3300001990 Bacteria 9605
8 JGI24737J22298_10076053 3300001990 Bacteria 1001
9 JGI24735J21928_10019647 3300002067 Bacteria 2075
10 JGI24735J21928_10025655 3300002067 Bacteria 1777
11 JGI24735J21928_10101204 3300002067 Bacteria 827
12 JGI24738J21930_10000923 3300002075 Bacteria 8451
13 Ga0070658_10007453 3300005327 Bacteria 8833
14 Ga0070658_10060277 3300005327 Bacteria 3090
15 Ga0070658_10066154 3300005327 Bacteria 2952
16 Ga0070658_10081355 3300005327 Bacteria 2660
17 Ga0070658_10082101 3300005327 Bacteria 2648
18 Ga0070658_10083145 3300005327 Bacteria 2631
19 Ga0070658_10234548 3300005327 Bacteria 1554
20 Ga0070658_10263859 3300005327 Bacteria 1463
21 Ga0070676_10043717 3300005328 Bacteria 2604
22 Ga0070676_10221907 3300005328 Bacteria 1249
23 Ga0070683_100011711 3300005329 Bacteria 7593
24 Ga0070683_100129516 3300005329 Bacteria 2387
25 Ga0070670_100048789 3300005331 Bacteria 3643
26 Ga0070670_100197610 3300005331 Bacteria 1747
27 Ga0070670_100265181 3300005331 Bacteria 1498
28 Ga0070670_100800572 3300005331 Bacteria 851
29 Ga0068869_100015823 3300005334 Bacteria 5072
30 Ga0068869_100156539 3300005334 Bacteria 1771
31 Ga0070666_10005514 3300005335 Bacteria 7763
32 Ga0070666_10025320 3300005335 Bacteria 3867
33 Ga0070666_10170759 3300005335 Bacteria 1523
34 Ga0070680_100408047 3300005336 Bacteria 1158
35 Ga0070682_100573609 3300005337 Bacteria 886
36 Ga0068868_100008603 3300005338 Bacteria 7310
37 Ga0068868_100121121 3300005338 Bacteria 2134
38 Ga0068868_100766887 3300005338 Bacteria 868
39 Ga0068868_100807189 3300005338 Bacteria 847
40 Ga0070660_100005952 3300005339 Bacteria 8432
41 Ga0070660_100006235 3300005339 Bacteria 8254
42 Ga0070660_100136107 3300005339 Bacteria 1968
43 Ga0070660_100156617 3300005339 Bacteria 1834
44 Ga0070660_100201190 3300005339 Bacteria 1616
45 Ga0070660_100216633 3300005339 Bacteria 1555
46 Ga0070660_100385155 3300005339 Bacteria 1158
47 Ga0070660_100469977 3300005339 Bacteria 1044
48 Ga0070660_100818794 3300005339 Bacteria 783
49 Ga0070689_100116124 3300005340 Bacteria 2134
50 Ga0070689_100392747 3300005340 Bacteria 1171
51 Ga0070687_100297048 3300005343 Bacteria 1023
52 Ga0070661_100017784 3300005344 Bacteria 5046
53 Ga0070661_100083765 3300005344 Bacteria 2356
54 Ga0070661_100086587 3300005344 Bacteria 2317
55 Ga0070661_100225893 3300005344 Bacteria 1437
56 Ga0070661_100331798 3300005344 Unclassified 1190
57 Ga0070661_100657400 3300005344 Bacteria 851
58 Ga0070661_100843113 3300005344 Bacteria 754
59 Ga0070692_10014035 3300005345 Bacteria 3751
60 Ga0070692_10036450 3300005345 Bacteria 2496
61 Ga0070692_10386365 3300005345 Bacteria 880
62 Ga0070668_100000910 3300005347 Bacteria 20612
63 Ga0070668_100034845 3300005347 Bacteria 3836
64 Ga0070668_100463720 3300005347 Bacteria 1091
65 Ga0070669_100038018 3300005353 Bacteria 3493
66 Ga0070669_100091098 3300005353 Unclassified 2286
67 Ga0070669_100101663 3300005353 Bacteria 2169
68 Ga0070669_100316016 3300005353 Bacteria 1260
69 Ga0070675_100072207 3300005354 Bacteria 2865
70 Ga0070675_100072328 3300005354 Bacteria 2863
71 Ga0070675_100280442 3300005354 Bacteria 1464
72 Ga0070675_100394222 3300005354 Bacteria 1234
73 Ga0070675_100621588 3300005354 Bacteria 980
74 Ga0070671_100000327 3300005355 Bacteria 32467
75 Ga0070671_100028176 3300005355 Bacteria 4625
76 Ga0070671_100052609 3300005355 Bacteria 3385
77 Ga0070671_100097706 3300005355 Bacteria 2462
78 Ga0070671_100111604 3300005355 Bacteria 2297
79 Ga0070671_100159364 3300005355 Bacteria 1908
80 Ga0070671_100474275 3300005355 Bacteria 1075
81 Ga0070671_101040205 3300005355 Bacteria 718
82 Ga0070674_100106142 3300005356 Bacteria 2055
83 Ga0070673_100003726 3300005364 Bacteria 9552
84 Ga0070673_100007601 3300005364 Bacteria 7169
85 Ga0070673_100053820 3300005364 Bacteria 3163
86 Ga0070673_100973566 3300005364 Bacteria 789
87 Ga0070659_100011923 3300005366 Bacteria 6434
88 Ga0070659_100014160 3300005366 Bacteria 5953
89 Ga0070659_100030348 3300005366 Bacteria 4184
90 Ga0070659_100044754 3300005366 Bacteria 3467
91 Ga0070659_100063118 3300005366 Bacteria 2930
92 Ga0070659_100109236 3300005366 Bacteria 2232
93 Ga0070659_100179591 3300005366 Bacteria 1737
94 Ga0070659_100649423 3300005366 Bacteria 909
95 Ga0070659_100805436 3300005366 Bacteria 817
96 Ga0070667_100007076 3300005367 Bacteria 9324
97 Ga0070667_100008296 3300005367 Bacteria 8609
98 Ga0070667_100012023 3300005367 Bacteria 7165
99 Ga0070667_100044375 3300005367 Bacteria 3733
100 Ga0070667_100204895 3300005367 Bacteria 1751
101 Ga0070667_100444829 3300005367 Bacteria 1184
102 Ga0070667_101321715 3300005367 Bacteria 676
103 Ga0070714_100055287 3300005435 Bacteria 3392
104 Ga0070714_101157043 3300005435 Bacteria 754
105 Ga0070694_100005229 3300005444 Bacteria 7840
106 Ga0070694_100025636 3300005444 Bacteria 3814
107 Ga0070663_100463080 3300005455 Bacteria 1047
108 Ga0070663_100923744 3300005455 Bacteria 755
109 Ga0070678_100103228 3300005456 Bacteria 2215
110 Ga0070678_100142370 3300005456 Bacteria 1920
111 Ga0070678_101152668 3300005456 Unclassified 717
112 Ga0070662_100001246 3300005457 Bacteria 15625
113 Ga0070662_100001439 3300005457 Bacteria 14660
114 Ga0070662_100010112 3300005457 Bacteria 6182
115 Ga0070662_100405048 3300005457 Bacteria 1126
116 Ga0070681_10035870 3300005458 Bacteria 4981
117 Ga0068867_100001707 3300005459 Bacteria 15291
118 Ga0068867_100034778 3300005459 Bacteria 3654
119 Ga0068867_100047684 3300005459 Bacteria 3150
120 Ga0068867_100128139 3300005459 Bacteria 1969
121 Ga0068867_100407189 3300005459 Bacteria 1149
122 Ga0070679_100024300 3300005530 Bacteria 5938
123 Ga0070679_101004036 3300005530 Bacteria 779
124 Ga0070679_101287840 3300005530 Bacteria 676
125 Ga0070684_100002712 3300005535 Bacteria 13085
126 Ga0070684_100096705 3300005535 Bacteria 2633
127 Ga0070697_100527568 3300005536 Bacteria 1034
128 Ga0068853_100022954 3300005539 Bacteria 5217
129 Ga0068853_100058356 3300005539 Bacteria 3332
130 Ga0068853_100119162 3300005539 Bacteria 2352
131 Ga0068853_100135467 3300005539 Bacteria 2207
132 Ga0068853_100457203 3300005539 Bacteria 1201
133 Ga0068853_100547409 3300005539 Bacteria 1096
134 Ga0068853_100648811 3300005539 Bacteria 1004
135 Ga0068853_101215228 3300005539 Bacteria 728
136 Ga0070672_100001644 3300005543 Bacteria 13918
137 Ga0070672_100006787 3300005543 Bacteria 7730
138 Ga0070672_100047986 3300005543 Bacteria 3316
139 Ga0070672_100196498 3300005543 Bacteria 1685
140 Ga0070686_100145955 3300005544 Bacteria 1652
141 Ga0070695_100082469 3300005545 Bacteria 2129
142 Ga0070696_100004539 3300005546 Bacteria 9273
143 Ga0070696_100773063 3300005546 Bacteria 788
144 Ga0070693_100005860 3300005547 Bacteria 5935
145 Ga0070693_100092641 3300005547 Bacteria 1825
146 Ga0070665_100009576 3300005548 Bacteria 9796
147 Ga0070665_100016007 3300005548 Bacteria 7529
148 Ga0070665_100248566 3300005548 Bacteria 1779
149 Ga0070665_100716735 3300005548 Bacteria 1013
150 Ga0070704_100206255 3300005549 Bacteria 1590
151 Ga0068855_100007829 3300005563 Bacteria 12910
152 Ga0068855_100157442 3300005563 Bacteria 2580
153 Ga0068855_100298127 3300005563 Bacteria 1786
154 Ga0068855_100391451 3300005563 Bacteria 1524
155 Ga0068855_101028183 3300005563 Bacteria 864
156 Ga0070664_100000207 3300005564 Bacteria 42082
157 Ga0070664_100004638 3300005564 Bacteria 11035
158 Ga0070664_100030908 3300005564 Bacteria 4470
159 Ga0070664_100112461 3300005564 Bacteria 2378
160 Ga0070664_100115035 3300005564 Bacteria 2351
161 Ga0070664_100304667 3300005564 Bacteria 1440
162 Ga0070664_100338652 3300005564 Bacteria 1366
163 Ga0068857_100010833 3300005577 Bacteria 7939
164 Ga0068857_100026790 3300005577 Bacteria 5083
165 Ga0068854_100116764 3300005578 Bacteria 2020
166 Ga0068854_100215132 3300005578 Bacteria 1518
167 Ga0068854_100578575 3300005578 Bacteria 956
168 Ga0068856_100009734 3300005614 Bacteria 9337
169 Ga0068856_100050955 3300005614 Bacteria 4082
170 Ga0068856_100140757 3300005614 Bacteria 2420
171 Ga0068856_100941029 3300005614 Bacteria 883
172 Ga0070702_100209528 3300005615 Bacteria 1296
173 Ga0068852_100001072 3300005616 Bacteria 18069
174 Ga0068852_100045064 3300005616 Bacteria 3749
175 Ga0068852_100074801 3300005616 Bacteria 2985
176 Ga0068852_100088699 3300005616 Bacteria 2763
177 Ga0068852_100133017 3300005616 Bacteria 2293
178 Ga0068852_100217655 3300005616 Bacteria 1815
179 Ga0068852_100545166 3300005616 Bacteria 1160
180 Ga0068859_100016908 3300005617 Bacteria 7322
181 Ga0068859_100017902 3300005617 Bacteria 7122
182 Ga0068859_100058885 3300005617 Bacteria 3870
183 Ga0068859_100098255 3300005617 Bacteria 2982
184 Ga0068859_100161092 3300005617 Bacteria 2323
185 Ga0068859_100406202 3300005617 Bacteria 1458
186 Ga0068859_100897368 3300005617 Bacteria 971
187 Ga0068864_100002590 3300005618 Bacteria 14935
188 Ga0068864_100004492 3300005618 Bacteria 11475
189 Ga0068864_100006328 3300005618 Bacteria 9710
190 Ga0068864_100008279 3300005618 Bacteria 8577
191 Ga0068866_10244408 3300005718 Unclassified 1095
192 Ga0068866_10675651 3300005718 Bacteria 706
193 Ga0068861_100027990 3300005719 Bacteria 4110
194 Ga0068851_10023342 3300005834 Bacteria 3023
195 Ga0068851_10034744 3300005834 Bacteria 2517
196 Ga0068851_10192257 3300005834 Bacteria 1135
197 Ga0068851_10459295 3300005834 Bacteria 758
198 Ga0068851_10614747 3300005834 Bacteria 662
199 Ga0068863_100007439 3300005841 Bacteria 10717
200 Ga0068863_100007887 3300005841 Bacteria 10414
201 Ga0068863_100019788 3300005841 Bacteria 6437
202 Ga0068863_100154870 3300005841 Bacteria 2194
203 Ga0068863_100538582 3300005841 Bacteria 1152
204 Ga0068858_100008153 3300005842 Bacteria 10069
205 Ga0068858_100112457 3300005842 Bacteria 2543
206 Ga0068858_100794772 3300005842 Bacteria 923
207 Ga0068860_100008924 3300005843 Bacteria 9990
208 Ga0068860_100024964 3300005843 Bacteria 5770
209 Ga0068860_100027831 3300005843 Bacteria 5444
210 Ga0068860_100112235 3300005843 Bacteria 2606
211 Ga0068860_100924734 3300005843 Bacteria 889
212 Ga0068862_100006737 3300005844 Bacteria 9524
213 Ga0068862_100112553 3300005844 Bacteria 2391
214 Ga0068862_100350084 3300005844 Bacteria 1370
215 Ga0068862_100450408 3300005844 Bacteria 1213
216 Ga0068862_100459095 3300005844 Bacteria 1202
217 Ga0081539_10053998 3300005985 Bacteria 2246
218 Ga0070712_100054831 3300006175 Bacteria 2789
219 Ga0097621_100005924 3300006237 Bacteria 8639
220 Ga0097621_100023662 3300006237 Bacteria 4785
221 Ga0097621_100868810 3300006237 Bacteria 839
222 Ga0068871_100030158 3300006358 Bacteria 4269
223 Ga0068871_100115065 3300006358 Bacteria 2267
224 Ga0068871_100161886 3300006358 Bacteria 1914
225 Ga0075428_100200776 3300006844 Bacteria 2156
226 Ga0075433_10805903 3300006852 Bacteria 820
227 Ga0075434_100641291 3300006871 Bacteria 1081
228 Ga0068865_100007221 3300006881 Bacteria 6824
229 Ga0068865_100256313 3300006881 Unclassified 1383
230 Ga0097620_100016909 3300006931 Bacteria 7322
231 Ga0097620_100017902 3300006931 Bacteria 7122
232 Ga0097620_100058885 3300006931 Bacteria 3870
233 Ga0097620_100098253 3300006931 Bacteria 2982
234 Ga0097620_100161087 3300006931 Bacteria 2323
235 Ga0097620_100406174 3300006931 Bacteria 1458
236 Ga0097620_100897312 3300006931 Bacteria 971
237 Ga0105240_10234955 3300009093 Bacteria 2128
238 Ga0111539_10291902 3300009094 Bacteria 1897
239 Ga0111539_10883983 3300009094 Bacteria 1039
240 Ga0111539_11644107 3300009094 Bacteria 745
241 Ga0105245_10002347 3300009098 Bacteria 17117
242 Ga0105245_10113323 3300009098 Bacteria 2525
243 Ga0105247_10501200 3300009101 Bacteria 885
244 Ga0105243_10125980 3300009148 Bacteria 2167
245 Ga0105243_10815680 3300009148 Bacteria 921
246 Ga0105242_10466411 3300009176 Bacteria 1194
247 Ga0105242_11663029 3300009176 Bacteria 674
248 Ga0105248_10000135 3300009177 Bacteria 85668
249 Ga0105248_10002245 3300009177 Bacteria 21383
250 Ga0105248_10002563 3300009177 Bacteria 20234
251 Ga0105248_10009447 3300009177 Bacteria 10736
252 Ga0105248_10020222 3300009177 Bacteria 7374
253 Ga0105248_10106771 3300009177 Bacteria 3157
254 Ga0105248_10107186 3300009177 Bacteria 3151
255 Ga0105248_10247647 3300009177 Bacteria 2006
256 Ga0105248_10653878 3300009177 Bacteria 1186
257 Ga0105237_10300190 3300009545 Bacteria 1609
258 Ga0105238_10041976 3300009551 Bacteria 4633
259 Ga0105238_10316459 3300009551 Bacteria 1546
260 Ga0105249_10088910 3300009553 Bacteria 2886
261 Ga0105249_11138520 3300009553 Bacteria 851
262 Ga0105239_10065156 3300010375 Bacteria 4001
263 Ga0105239_10091075 3300010375 Bacteria 3365
264 Ga0105239_10965133 3300010375 Bacteria 979
265 Ga0157315_1017031 3300012508 Bacteria 726
266 Ga0157373_10019224 3300013100 Bacteria 4974
267 Ga0157373_10033226 3300013100 Bacteria 3712
268 Ga0157373_10043099 3300013100 Bacteria 3224
269 Ga0157373_10415501 3300013100 Bacteria 965
270 Ga0157373_10418176 3300013100 Bacteria 962
271 Ga0157373_10654511 3300013100 Bacteria 767
272 Ga0157371_10000867 3300013102 Bacteria 34332
273 Ga0157371_10018515 3300013102 Bacteria 5147
274 Ga0157371_10267515 3300013102 Bacteria 1233
275 Ga0157371_10286960 3300013102 Bacteria 1190
276 Ga0157371_10635545 3300013102 Bacteria 796
277 Ga0157370_10385119 3300013104 Bacteria 1291
278 Ga0157370_10515793 3300013104 Bacteria 1097
279 Ga0157369_10002818 3300013105 Bacteria 20750
280 Ga0157369_11348826 3300013105 Bacteria 726
281 Ga0157374_10065892 3300013296 Bacteria 3403
282 Ga0157378_10019260 3300013297 Bacteria 5998
283 Ga0163162_10031122 3300013306 Bacteria 5291
284 Ga0163162_10061453 3300013306 Bacteria 3794
285 Ga0163162_10117855 3300013306 Bacteria 2757
286 Ga0163162_10273111 3300013306 Bacteria 1822
287 Ga0163162_10509123 3300013306 Bacteria 1334
288 Ga0163162_11563936 3300013306 Bacteria 752
289 Ga0157372_10082424 3300013307 Bacteria 3641
290 Ga0157372_10161312 3300013307 Bacteria 2591
291 Ga0157372_10184084 3300013307 Bacteria 2419
292 Ga0157372_10648670 3300013307 Bacteria 1229
293 Ga0157372_10835581 3300013307 Bacteria 1069
294 Ga0157372_11353859 3300013307 Bacteria 821
295 Ga0157375_10005886 3300013308 Bacteria 10680
296 Ga0157375_10046878 3300013308 Bacteria 4217
297 Ga0157375_10060474 3300013308 Bacteria 3757
298 Ga0157375_10171869 3300013308 Bacteria 2315
299 Ga0157375_10347509 3300013308 Bacteria 1649
300 Ga0157375_11105660 3300013308 Bacteria 928
301 Ga0163163_10001398 3300014325 Bacteria 20368
302 Ga0163163_10107840 3300014325 Bacteria 2811
303 Ga0163163_10556970 3300014325 Bacteria 1209
304 Ga0182008_10094581 3300014497 Bacteria 1474
305 Ga0157377_10018468 3300014745 Bacteria 3624
306 Ga0157379_10634908 3300014968 Bacteria 999
307 Ga0157379_10644680 3300014968 Bacteria 991
308 Ga0157379_11389785 3300014968 Bacteria 680
309 Ga0163161_10008421 3300017792 Bacteria 7137
310 Ga0213875_10011121 3300021388 Bacteria 4489
311 Ga0207697_10002577 3300025315 Bacteria 9335
312 Ga0207656_10057960 3300025321 Bacteria 1691
313 Ga0207688_10000353 3300025901 Bacteria 21377
314 Ga0207688_10065901 3300025901 Bacteria 2047
315 Ga0207680_10035080 3300025903 Bacteria 2876
316 Ga0207680_10548711 3300025903 Bacteria 825
317 Ga0207680_10563233 3300025903 Bacteria 814
318 Ga0207647_10002939 3300025904 Bacteria 12824
319 Ga0207647_10004303 3300025904 Bacteria 10559
320 Ga0207647_10059436 3300025904 Bacteria 2339
321 Ga0207645_10000464 3300025907 Bacteria 33570
322 Ga0207645_10086573 3300025907 Bacteria 2013
323 Ga0207645_10443984 3300025907 Bacteria 875
324 Ga0207705_10017910 3300025909 Bacteria 5066
325 Ga0207705_10048806 3300025909 Bacteria 3046
326 Ga0207705_10060428 3300025909 Bacteria 2737
327 Ga0207705_10125461 3300025909 Bacteria 1908
328 Ga0207705_10198307 3300025909 Unclassified 1520
329 Ga0207705_10479716 3300025909 Bacteria 965
330 Ga0207705_10551167 3300025909 Bacteria 896
331 Ga0207705_10957013 3300025909 Bacteria 662
332 Ga0207707_10010255 3300025912 Bacteria 8130
333 Ga0207707_10085975 3300025912 Bacteria 2748
334 Ga0207695_10096987 3300025913 Bacteria 2949
335 Ga0207695_10434920 3300025913 Bacteria 1196
336 Ga0207695_10950829 3300025913 Bacteria 739
337 Ga0207660_10118546 3300025917 Bacteria 2002
338 Ga0207660_11097726 3300025917 Bacteria 648
339 Ga0207657_10014072 3300025919 Bacteria 7828
340 Ga0207657_10024801 3300025919 Bacteria 5544
341 Ga0207657_10081795 3300025919 Bacteria 2712
342 Ga0207657_10215255 3300025919 Bacteria 1541
343 Ga0207657_10267854 3300025919 Bacteria 1358
344 Ga0207657_10326864 3300025919 Bacteria 1212
345 Ga0207657_10340825 3300025919 Bacteria 1183
346 Ga0207657_10353011 3300025919 Bacteria 1160
347 Ga0207657_10493327 3300025919 Bacteria 960
348 Ga0207649_10013370 3300025920 Bacteria 4581
349 Ga0207649_10062427 3300025920 Bacteria 2349
350 Ga0207649_10091801 3300025920 Bacteria 1990
351 Ga0207649_10221331 3300025920 Bacteria 1348
352 Ga0207649_10223895 3300025920 Bacteria 1342
353 Ga0207649_10367928 3300025920 Bacteria 1068
354 Ga0207649_10448995 3300025920 Bacteria 973
355 Ga0207681_10079421 3300025923 Unclassified 2311
356 Ga0207681_10176301 3300025923 Bacteria 1624
357 Ga0207681_10623801 3300025923 Bacteria 892
358 Ga0207694_10088822 3300025924 Bacteria 2437
359 Ga0207694_10118662 3300025924 Bacteria 2111
360 Ga0207650_10063093 3300025925 Bacteria 2770
361 Ga0207650_10151693 3300025925 Bacteria 1829
362 Ga0207650_10291922 3300025925 Bacteria 1330
363 Ga0207659_10195068 3300025926 Bacteria 1613
364 Ga0207659_10336933 3300025926 Bacteria 1248
365 Ga0207659_10439851 3300025926 Bacteria 1097
366 Ga0207659_10648605 3300025926 Bacteria 902
367 Ga0207687_10092584 3300025927 Bacteria 2208
368 Ga0207664_10571142 3300025929 Bacteria 1015
369 Ga0207644_10000429 3300025931 Bacteria 27281
370 Ga0207644_10001320 3300025931 Bacteria 15911
371 Ga0207644_10004275 3300025931 Bacteria 9267
372 Ga0207644_10035217 3300025931 Bacteria 3506
373 Ga0207644_10056395 3300025931 Bacteria 2835
374 Ga0207644_10066349 3300025931 Bacteria 2627
375 Ga0207644_10090035 3300025931 Bacteria 2285
376 Ga0207644_10112256 3300025931 Bacteria 2062
377 Ga0207644_10174494 3300025931 Unclassified 1680
378 Ga0207644_10454527 3300025931 Bacteria 1052
379 Ga0207690_10002653 3300025932 Bacteria 10782
380 Ga0207690_10014839 3300025932 Bacteria 4714
381 Ga0207690_10019787 3300025932 Bacteria 4149
382 Ga0207690_10078011 3300025932 Bacteria 2304
383 Ga0207690_10177084 3300025932 Bacteria 1603
384 Ga0207690_10440310 3300025932 Bacteria 1046
385 Ga0207690_10589721 3300025932 Bacteria 906
386 Ga0207706_10002227 3300025933 Bacteria 18932
387 Ga0207706_10004069 3300025933 Bacteria 13822
388 Ga0207706_10023282 3300025933 Bacteria 5563
389 Ga0207706_10057062 3300025933 Bacteria 3441
390 Ga0207706_10213532 3300025933 Bacteria 1690
391 Ga0207706_10305994 3300025933 Bacteria 1384
392 Ga0207706_10483709 3300025933 Bacteria 1069
393 Ga0207686_10342773 3300025934 Bacteria 1123
394 Ga0207686_10786842 3300025934 Bacteria 762
395 Ga0207709_10027234 3300025935 Bacteria 3290
396 Ga0207709_10586488 3300025935 Bacteria 881
397 Ga0207670_10351807 3300025936 Bacteria 1167
398 Ga0207669_10324193 3300025937 Bacteria 1180
399 Ga0207704_10320025 3300025938 Bacteria 1196
400 Ga0207704_10884975 3300025938 Bacteria 750
401 Ga0207691_10001285 3300025940 Bacteria 25027
402 Ga0207691_10002986 3300025940 Bacteria 16500
403 Ga0207691_10041275 3300025940 Bacteria 4261
404 Ga0207691_10121989 3300025940 Bacteria 2309
405 Ga0207711_10000999 3300025941 Bacteria 27105
406 Ga0207711_10001758 3300025941 Bacteria 19856
407 Ga0207711_10003110 3300025941 Bacteria 14468
408 Ga0207711_10003334 3300025941 Bacteria 13924
409 Ga0207711_10033082 3300025941 Bacteria 4374
410 Ga0207711_10058414 3300025941 Bacteria 3319
411 Ga0207711_10073033 3300025941 Bacteria 2981
412 Ga0207711_10220952 3300025941 Bacteria 1733
413 Ga0207711_10635329 3300025941 Bacteria 996
414 Ga0207689_10000922 3300025942 Bacteria 28234
415 Ga0207689_10003524 3300025942 Bacteria 14298
416 Ga0207689_10042233 3300025942 Bacteria 3773
417 Ga0207661_10308739 3300025944 Bacteria 1419
418 Ga0207679_10000286 3300025945 Bacteria 38353
419 Ga0207679_10012790 3300025945 Bacteria 5484
420 Ga0207679_10014009 3300025945 Bacteria 5260
421 Ga0207679_10201781 3300025945 Bacteria 1662
422 Ga0207679_10399193 3300025945 Bacteria 1209
423 Ga0207679_10444798 3300025945 Bacteria 1148
424 Ga0207679_10863128 3300025945 Bacteria 827
425 Ga0207667_10066713 3300025949 Bacteria 3750
426 Ga0207667_10068487 3300025949 Bacteria 3696
427 Ga0207667_10110738 3300025949 Bacteria 2832
428 Ga0207667_10265451 3300025949 Bacteria 1755
429 Ga0207667_10783532 3300025949 Bacteria 951
430 Ga0207651_10005971 3300025960 Bacteria 6308
431 Ga0207651_10018559 3300025960 Bacteria 4144
432 Ga0207651_10848483 3300025960 Bacteria 812
433 Ga0207712_10002067 3300025961 Bacteria 13181
434 Ga0207668_10000074 3300025972 Bacteria 75726
435 Ga0207668_10041237 3300025972 Bacteria 3119
436 Ga0207640_10011746 3300025981 Bacteria 4967
437 Ga0207640_10043431 3300025981 Bacteria 2873
438 Ga0207640_10053510 3300025981 Bacteria 2635
439 Ga0207640_10593399 3300025981 Bacteria 937
440 Ga0207640_10939571 3300025981 Bacteria 757
441 Ga0207640_11221749 3300025981 Bacteria 669
442 Ga0207658_10011676 3300025986 Bacteria 5981
443 Ga0207658_10035407 3300025986 Bacteria 3575
444 Ga0207658_10164422 3300025986 Bacteria 1821
445 Ga0207658_10174302 3300025986 Bacteria 1775
446 Ga0207658_10289028 3300025986 Bacteria 1408
447 Ga0207677_10108126 3300026023 Bacteria 2064
448 Ga0207677_10121770 3300026023 Bacteria 1964
449 Ga0207703_10018472 3300026035 Bacteria 5445
450 Ga0207703_10070436 3300026035 Bacteria 2886
451 Ga0207703_10118675 3300026035 Bacteria 2268
452 Ga0207703_10528780 3300026035 Bacteria 1110
453 Ga0207639_10044748 3300026041 Bacteria 3330
454 Ga0207639_10065959 3300026041 Bacteria 2811
455 Ga0207639_10108539 3300026041 Bacteria 2257
456 Ga0207639_10574881 3300026041 Bacteria 1037
457 Ga0207639_10643966 3300026041 Bacteria 980
458 Ga0207639_11303910 3300026041 Unclassified 681
459 Ga0207678_10002360 3300026067 Bacteria 17124
460 Ga0207678_10338193 3300026067 Bacteria 1297
461 Ga0207678_10708028 3300026067 Bacteria 886
462 Ga0207702_10502174 3300026078 Bacteria 1182
463 Ga0207702_10750249 3300026078 Bacteria 963
464 Ga0207702_11636545 3300026078 Bacteria 637
465 Ga0207641_10013898 3300026088 Bacteria 6603
466 Ga0207641_10031469 3300026088 Bacteria 4401
467 Ga0207641_10065789 3300026088 Bacteria 3101
468 Ga0207641_10104644 3300026088 Bacteria 2499
469 Ga0207641_10248770 3300026088 Bacteria 1659
470 Ga0207641_11329790 3300026088 Unclassified 719
471 Ga0207648_10003858 3300026089 Bacteria 15664
472 Ga0207648_10015955 3300026089 Bacteria 6882
473 Ga0207648_10019688 3300026089 Bacteria 6089
474 Ga0207648_10465008 3300026089 Bacteria 1153
475 Ga0207676_10003937 3300026095 Bacteria 10487
476 Ga0207676_10012049 3300026095 Bacteria 6186
477 Ga0207676_10019500 3300026095 Bacteria 4949
478 Ga0207676_10101348 3300026095 Bacteria 2387
479 Ga0207674_10003595 3300026116 Bacteria 18906
480 Ga0207674_10004780 3300026116 Bacteria 16234
481 Ga0207674_10010131 3300026116 Bacteria 10717
482 Ga0207675_100047253 3300026118 Bacteria 4019
483 Ga0207683_10009090 3300026121 Bacteria 8469
484 Ga0207683_10015723 3300026121 Bacteria 6440
485 Ga0207698_10007199 3300026142 Bacteria 6970
486 Ga0207698_10063548 3300026142 Bacteria 2889
487 Ga0207698_10174443 3300026142 Bacteria 1897
488 Ga0207698_10486712 3300026142 Bacteria 1198
489 Ga0207698_10802962 3300026142 Bacteria 943
490 Ga0268266_10008818 3300028379 Bacteria 8931
491 Ga0268266_10049998 3300028379 Bacteria 3586
492 Ga0268266_10160945 3300028379 Bacteria 2031
493 Ga0268266_10914460 3300028379 Bacteria 848
494 Ga0268266_10963262 3300028379 Bacteria 825
495 Ga0268265_10004525 3300028380 Bacteria 9621
496 Ga0268265_10005676 3300028380 Bacteria 8522
497 Ga0268265_10192566 3300028380 Bacteria 1762
498 Ga0268265_10414019 3300028380 Bacteria 1249
499 Ga0268265_11728643 3300028380 Bacteria 632
500 Ga0268264_10002355 3300028381 Bacteria 16687
501 Ga0268264_10051196 3300028381 Bacteria 3440
502 Ga0268264_10056393 3300028381 Bacteria 3285
503 Ga0268264_10127527 3300028381 Bacteria 2251
504 Ga0268264_10529706 3300028381 Bacteria 1153
505 Ga0307408_100066862 3300031548 Bacteria 2641
506 Ga0307405_10020253 3300031731 Bacteria 3713
507 Ga0307405_10296731 3300031731 Bacteria 1224
508 Ga0307405_10538201 3300031731 Bacteria 943
509 Ga0307410_10071572 3300031852 Bacteria 2405
510 Ga0307406_10070371 3300031901 Bacteria 2291
511 Ga0307406_10169562 3300031901 Bacteria 1578
512 Ga0307406_10298356 3300031901 Bacteria 1237
513 Ga0307406_10695496 3300031901 Bacteria 848
514 Ga0307407_10039345 3300031903 Bacteria 2629
515 Ga0307412_10622978 3300031911 Bacteria 917
516 Ga0307409_100193409 3300031995 Bacteria 1813
517 Ga0307416_100555898 3300032002 Bacteria 1222
518 Ga0307414_10019766 3300032004 Bacteria 4182
519 Ga0307414_11156196 3300032004 Bacteria 716
520 Ga0307411_10019884 3300032005 Bacteria 3890
521 Ga0307411_10215841 3300032005 Bacteria 1485
522 Ga0307415_101486509 3300032126 Bacteria 648
523 Ga0373938_0105202 3300034957 Bacteria 713
524 Ga0373929_0024704 3300035085 Bacteria 1243
525 Ga0373923_0040154 3300035111 Bacteria 1924
526 Ga0373954_0023320 3300035118 Bacteria 2813
527 Ga0373957_0095168 3300035120 Bacteria 1187
528 Ga0373955_0006865 3300035172 Bacteria 5204
529 Ga0373931_0192651 3300035691 Unclassified 1214
530 Ga0373933_0053842 3300035724 Bacteria 2410
531 Ga0373937_0067611 3300036401 Bacteria 3293
532 Ga0395899_0003407 3300037312 Bacteria 12614
533 Ga0395899_0005863 3300037312 Bacteria 9535
534 Ga0395899_0062010 3300037312 Bacteria 2753
535 Ga0395899_0078911 3300037312 Bacteria 2399
536 Ga0395899_0084927 3300037312 Bacteria 2300
537 Ga0395899_0187417 3300037312 Bacteria 1449
538 Ga0395899_0290046 3300037312 Bacteria 1110
539 Ga0395899_0368818 3300037312 Bacteria 956
540 Ga0395900_0000130 3300037418 Bacteria 126231
541 Ga0395900_0002112 3300037418 Bacteria 22261
542 Ga0395900_0003022 3300037418 Bacteria 18307
543 Ga0395900_0012338 3300037418 Bacteria 8742
544 Ga0395900_0073260 3300037418 Bacteria 3521
545 Ga0395900_0076271 3300037418 Bacteria 3445
546 Ga0395900_0077825 3300037418 Bacteria 3407
547 Ga0395900_0110672 3300037418 Bacteria 2821
548 Ga0395900_0138763 3300037418 Bacteria 2490
549 Ga0395900_0287292 3300037418 Bacteria 1635
550 Ga0395900_0864194 3300037418 Bacteria 829
551 Ga0395900_1283391 3300037418 Bacteria 646
552 Ga0395898_0000274 3300037466 Bacteria 125922
553 Ga0395898_0042484 3300037466 Bacteria 4484
554 Ga0395898_0074580 3300037466 Bacteria 3277
555 Ga0395898_0076238 3300037466 Bacteria 3238
556 Ga0395898_0256516 3300037466 Bacteria 1667
557 Ga0395898_0274221 3300037466 Bacteria 1609
558 Ga0395898_0492362 3300037466 Bacteria 1166
559 Ga0395898_0633346 3300037466 Bacteria 1012
560 Ga0395898_0695609 3300037466 Bacteria 958
561 Ga0395905_0000287 3300037471 Bacteria 73803
562 Ga0395905_0000313 3300037471 Bacteria 70446
563 Ga0395905_0007739 3300037471 Bacteria 10657
564 Ga0395905_0009581 3300037471 Bacteria 9457
565 Ga0395905_0009944 3300037471 Bacteria 9268
566 Ga0395905_0024821 3300037471 Bacteria 5657
567 Ga0395905_0039621 3300037471 Bacteria 4420
568 Ga0395905_0044455 3300037471 Bacteria 4169
569 Ga0395905_0066456 3300037471 Bacteria 3377
570 Ga0395905_0084971 3300037471 Bacteria 2965
571 Ga0395905_0086724 3300037471 Bacteria 2934
572 Ga0395905_0098520 3300037471 Bacteria 2745
573 Ga0395905_0133095 3300037471 Bacteria 2339
574 Ga0395905_0274848 3300037471 Bacteria 1571
575 Ga0395905_0302273 3300037471 Bacteria 1488
576 Ga0395905_0349843 3300037471 Bacteria 1369
577 Ga0395905_0591037 3300037471 Bacteria 1012
578 Ga0395905_0696739 3300037471 Bacteria 918
579 Ga0395905_0714363 3300037471 Bacteria 904
580 Ga0436364_1370264 3300037853 Bacteria 12527
581 Ga0395901_0000397 3300038443 Bacteria 51973
582 Ga0395901_0000463 3300038443 Bacteria 47092
583 Ga0395901_0000613 3300038443 Bacteria 41465
584 Ga0395901_0011593 3300038443 Bacteria 8930
585 Ga0395901_0037903 3300038443 Bacteria 4984
586 Ga0395901_0079298 3300038443 Bacteria 3428
587 Ga0395901_0127189 3300038443 Bacteria 2678
588 Ga0395901_0166232 3300038443 Bacteria 2316
589 Ga0395901_0188928 3300038443 Bacteria 2160
590 Ga0395901_0337503 3300038443 Bacteria 1557
591 Ga0395901_0371367 3300038443 Bacteria 1473
592 Ga0395901_0411581 3300038443 Bacteria 1388
593 Ga0395901_0610827 3300038443 Unclassified 1098
594 Ga0450914_001186 3300042118 Bacteria 1561
595 Ga0450920_091556 3300042122 Unclassified 628
596 Ga0450890_009336 3300042127 Bacteria 1256
597 Ga0450889_000087 3300042144 Bacteria 8538
598 Ga0450918_088119 3300042531 Unclassified 598
599 Ga0466965_0011753 3300044683 Bacteria 4109
600 Ga0466963_0008943 3300044694 Bacteria 6012
601 Ga0466963_0062294 3300044694 Bacteria 2495
602 Ga0466963_0152962 3300044694 Bacteria 1603
603 Ga0466957_0114897 3300044842 Bacteria 1711
604 Ga0466957_0457459 3300044842 Bacteria 880
605 Ga0466960_0053416 3300044901 Bacteria 1958
606 Ga0466958_0333221 3300045836 Unclassified 976
607 Ga0466967_0027804 3300045976 Bacteria 4710
608 Ga0466967_0266413 3300045976 Bacteria 1640
609 Ga0466967_0524938 3300045976 Bacteria 1164
610 Ga0466967_0976931 3300045976 Bacteria 843
611 Ga0495663_0014700 3300046525 Bacteria 2196
612 Ga0495663_0060173 3300046525 Bacteria 1193
613 Ga0495654_0262293 3300046530 Bacteria 716
614 Ga0495668_0006757 3300046616 Bacteria 7457
615 Ga0495668_0019978 3300046616 Bacteria 3852
616 Ga0495668_0304115 3300046616 Bacteria 874
617 Ga0495588_0448505 3300046674 Bacteria 677
618 Ga0495669_0000579 3300046684 Bacteria 16267
619 Ga0495669_0002632 3300046684 Bacteria 7343
620 Ga0495669_0016151 3300046684 Bacteria 3197
621 Ga0495670_0522953 3300046691 Bacteria 645
622 Ga0495683_0366606 3300047323 Bacteria 605
623 Ga0495677_0026000 3300047445 Bacteria 2124
624 Ga0495677_0033335 3300047445 Bacteria 1877
625 Ga0495685_108547 3300047447 Bacteria 914
626 Ga0495602_0011898 3300048088 Bacteria 8976
627 Ga0496100_0003605 3300048903 Bacteria 8080
628 Ga0496101_0005969 3300048904 Bacteria 7806
629 Ga0496101_0120510 3300048904 Bacteria 1983
630 Ga0496101_0186591 3300048904 Bacteria 1599
631 Ga0496102_0000120 3300048905 Bacteria 112432
632 Ga0496102_0514552 3300048905 Bacteria 1119
633 Ga0496103_0000612 3300048906 Bacteria 27747
634 Ga0496103_0460887 3300048906 Bacteria 815
635 Ga0496104_0541455 3300048907 Bacteria 1075
636 Ga0496106_0000612 3300048909 Bacteria 25476
637 Ga0496107_0000238 3300048910 Bacteria 28814
638 Ga0496108_0024623 3300048911 Bacteria 4957
639 Ga0496108_0091946 3300048911 Bacteria 2579
640 Ga0496108_0112003 3300048911 Bacteria 2334
641 Ga0496108_0209113 3300048911 Bacteria 1693
642 Ga0496108_0335919 3300048911 Bacteria 1318
643 Ga0496109_0001676 3300048912 Bacteria 18462
644 Ga0496109_0007700 3300048912 Bacteria 9129
645 Ga0496109_0070476 3300048912 Bacteria 3208
646 Ga0496109_0316827 3300048912 Bacteria 1472
647 Ga0496110_0009606 3300048913 Bacteria 7830
648 Ga0496110_0028556 3300048913 Bacteria 4793
649 Ga0496110_0056036 3300048913 Bacteria 3469
650 Ga0496110_0105326 3300048913 Bacteria 2530
651 Ga0496110_0147230 3300048913 Bacteria 2131
652 Ga0496111_0001277 3300048914 Bacteria 14106
653 Ga0496111_0014695 3300048914 Bacteria 5355
654 Ga0496111_0028303 3300048914 Bacteria 3971
655 Ga0496111_0136489 3300048914 Bacteria 1817
656 Ga0496112_0001644 3300048915 Bacteria 17341
657 Ga0496112_0003263 3300048915 Bacteria 13387
658 Ga0496112_0009205 3300048915 Bacteria 8876
659 Ga0496112_0016619 3300048915 Bacteria 6899
660 Ga0496112_0022425 3300048915 Bacteria 6017
661 Ga0496112_0439149 3300048915 Bacteria 1243
662 Ga0496113_0001833 3300048916 Bacteria 12097
663 Ga0496113_0005805 3300048916 Bacteria 7744
664 Ga0496113_0005955 3300048916 Bacteria 7667
665 Ga0496113_0039526 3300048916 Bacteria 3472
666 Ga0496113_0357208 3300048916 Unclassified 1172
667 Ga0496114_0017017 3300048917 Bacteria 5863
668 Ga0496114_0048052 3300048917 Bacteria 3549
669 Ga0496115_0001778 3300048918 Bacteria 15423
670 Ga0496116_0001356 3300048919 Bacteria 27717
671 Ga0496117_0001920 3300048920 Bacteria 27775
672 Ga0496118_0002120 3300048921 Bacteria 27775
673 Ga0496124_0000214 3300048927 Bacteria 113007
674 Ga0501070_0108304 3300049586 Bacteria 2296
675 Ga0501076_0406292 3300049592 Bacteria 1120
676 nmdc:mga09592_789978_c1 3300050508 Bacteria 803
677 nmdc:mga08y16_251814_c1 3300050511 Bacteria 1825
678 nmdc:mga0n895_1195648_c1 3300050512 Bacteria 734
679 nmdc:mga0n895_277689_c1 3300050512 Bacteria 1699
680 nmdc:mga0a205_1442_c1 3300050515 Bacteria 20250
681 Ga0495612_0094145 3300053078 Bacteria 1271
682 Ga0495606_0283313
683 JGI24741J21665_1018936
684 JGI24740J21852_10003670
685 JGI24740J21852_10036574
686 JGI24739J22299_10033755
687 JGI24739J22299_10083208
688 JGI24737J22298_10001076
689 JGI24737J22298_10076053
690 JGI24735J21928_10019647
691 JGI24735J21928_10025655
692 JGI24735J21928_10101204
693 JGI24738J21930_10000923
694 Ga0070658_10007453
695 Ga0070658_10060277
696 Ga0070658_10066154
697 Ga0070658_10081355
698 Ga0070658_10082101
699 Ga0070658_10083145
700 Ga0070658_10234548
701 Ga0070658_10263859
702 Ga0070676_10043717
703 Ga0070676_10221907
704 Ga0070683_100011711
705 Ga0070683_100129516
706 Ga0070670_100048789
707 Ga0070670_100197610
708 Ga0070670_100265181
709 Ga0070670_100800572
710 Ga0068869_100015823
711 Ga0068869_100156539
712 Ga0070666_10005514
713 Ga0070666_10025320
714 Ga0070666_10170759
715 Ga0070680_100408047
716 Ga0070682_100573609
717 Ga0068868_100008603
718 Ga0068868_100121121
719 Ga0068868_100766887
720 Ga0068868_100807189
721 Ga0070660_100005952
722 Ga0070660_100006235
723 Ga0070660_100136107
724 Ga0070660_100156617
725 Ga0070660_100201190
726 Ga0070660_100216633
727 Ga0070660_100385155
728 Ga0070660_100469977
729 Ga0070660_100818794
730 Ga0070689_100116124
731 Ga0070689_100392747
732 Ga0070687_100297048
733 Ga0070661_100017784
734 Ga0070661_100083765
735 Ga0070661_100086587
736 Ga0070661_100225893
737 Ga0070661_100331798
738 Ga0070661_100657400
739 Ga0070661_100843113
740 Ga0070692_10014035
741 Ga0070692_10036450
742 Ga0070692_10386365
743 Ga0070668_100000910
744 Ga0070668_100034845
745 Ga0070668_100463720
746 Ga0070669_100038018
747 Ga0070669_100091098
748 Ga0070669_100101663
749 Ga0070669_100316016
750 Ga0070675_100072207
751 Ga0070675_100072328
752 Ga0070675_100280442
753 Ga0070675_100394222
754 Ga0070675_100621588
755 Ga0070671_100000327
756 Ga0070671_100028176
757 Ga0070671_100052609
758 Ga0070671_100097706
759 Ga0070671_100111604
760 Ga0070671_100159364
761 Ga0070671_100474275
762 Ga0070671_101040205
763 Ga0070674_100106142
764 Ga0070673_100003726
765 Ga0070673_100007601
766 Ga0070673_100053820
767 Ga0070673_100973566
768 Ga0070659_100011923
769 Ga0070659_100014160
770 Ga0070659_100030348
771 Ga0070659_100044754
772 Ga0070659_100063118
773 Ga0070659_100109236
774 Ga0070659_100179591
775 Ga0070659_100649423
776 Ga0070659_100805436
777 Ga0070667_100007076
778 Ga0070667_100008296
779 Ga0070667_100012023
780 Ga0070667_100044375
781 Ga0070667_100204895
782 Ga0070667_100444829
783 Ga0070667_101321715
784 Ga0070714_100055287
785 Ga0070714_101157043
786 Ga0070694_100005229
787 Ga0070694_100025636
788 Ga0070663_100463080
789 Ga0070663_100923744
790 Ga0070678_100103228
791 Ga0070678_100142370
792 Ga0070678_101152668
793 Ga0070662_100001246
794 Ga0070662_100001439
795 Ga0070662_100010112
796 Ga0070662_100405048
797 Ga0070681_10035870
798 Ga0068867_100001707
799 Ga0068867_100034778
800 Ga0068867_100047684
801 Ga0068867_100128139
802 Ga0068867_100407189
803 Ga0070679_100024300
804 Ga0070679_101004036
805 Ga0070679_101287840
806 Ga0070684_100002712
807 Ga0070684_100096705
808 Ga0070697_100527568
809 Ga0068853_100022954
810 Ga0068853_100058356
811 Ga0068853_100119162
812 Ga0068853_100135467
813 Ga0068853_100457203
814 Ga0068853_100547409
815 Ga0068853_100648811
816 Ga0068853_101215228
817 Ga0070672_100001644
818 Ga0070672_100006787
819 Ga0070672_100047986
820 Ga0070672_100196498
821 Ga0070686_100145955
822 Ga0070695_100082469
823 Ga0070696_100004539
824 Ga0070696_100773063
825 Ga0070693_100005860
826 Ga0070693_100092641
827 Ga0070665_100009576
828 Ga0070665_100016007
829 Ga0070665_100248566
830 Ga0070665_100716735
831 Ga0070704_100206255
832 Ga0068855_100007829
833 Ga0068855_100157442
834 Ga0068855_100298127
835 Ga0068855_100391451
836 Ga0068855_101028183
837 Ga0070664_100000207
838 Ga0070664_100004638
839 Ga0070664_100030908
840 Ga0070664_100112461
841 Ga0070664_100115035
842 Ga0070664_100304667
843 Ga0070664_100338652
844 Ga0068857_100010833
845 Ga0068857_100026790
846 Ga0068854_100116764
847 Ga0068854_100215132
848 Ga0068854_100578575
849 Ga0068856_100009734
850 Ga0068856_100050955
851 Ga0068856_100140757
852 Ga0068856_100941029
853 Ga0070702_100209528
854 Ga0068852_100001072
855 Ga0068852_100045064
856 Ga0068852_100074801
857 Ga0068852_100088699
858 Ga0068852_100133017
859 Ga0068852_100217655
860 Ga0068852_100545166
861 Ga0068859_100016908
862 Ga0068859_100017902
863 Ga0068859_100058885
864 Ga0068859_100098255
865 Ga0068859_100161092
866 Ga0068859_100406202
867 Ga0068859_100897368
868 Ga0068864_100002590
869 Ga0068864_100004492
870 Ga0068864_100006328
871 Ga0068864_100008279
872 Ga0068866_10244408
873 Ga0068866_10675651
874 Ga0068861_100027990
875 Ga0068851_10023342
876 Ga0068851_10034744
877 Ga0068851_10192257
878 Ga0068851_10459295
879 Ga0068851_10614747
880 Ga0068863_100007439
881 Ga0068863_100007887
882 Ga0068863_100019788
883 Ga0068863_100154870
884 Ga0068863_100538582
885 Ga0068858_100008153
886 Ga0068858_100112457
887 Ga0068858_100794772
888 Ga0068860_100008924
889 Ga0068860_100024964
890 Ga0068860_100027831
891 Ga0068860_100112235
892 Ga0068860_100924734
893 Ga0068862_100006737
894 Ga0068862_100112553
895 Ga0068862_100350084
896 Ga0068862_100450408
897 Ga0068862_100459095
898 Ga0081539_10053998
899 Ga0070712_100054831
900 Ga0097621_100005924
901 Ga0097621_100023662
902 Ga0097621_100868810
903 Ga0068871_100030158
904 Ga0068871_100115065
905 Ga0068871_100161886
906 Ga0075428_100200776
907 Ga0075433_10805903
908 Ga0075434_100641291
909 Ga0068865_100007221
910 Ga0068865_100256313
911 Ga0097620_100016909
912 Ga0097620_100017902
913 Ga0097620_100058885
914 Ga0097620_100098253
915 Ga0097620_100161087
916 Ga0097620_100406174
917 Ga0097620_100897312
918 Ga0105240_10234955
919 Ga0111539_10291902
920 Ga0111539_10883983
921 Ga0111539_11644107
922 Ga0105245_10002347
923 Ga0105245_10113323
924 Ga0105247_10501200
925 Ga0105243_10125980
926 Ga0105243_10815680
927 Ga0105242_10466411
928 Ga0105242_11663029
929 Ga0105248_10000135
930 Ga0105248_10002245
931 Ga0105248_10002563
932 Ga0105248_10009447
933 Ga0105248_10020222
934 Ga0105248_10106771
935 Ga0105248_10107186
936 Ga0105248_10247647
937 Ga0105248_10653878
938 Ga0105237_10300190
939 Ga0105238_10041976
940 Ga0105238_10316459
941 Ga0105249_10088910
942 Ga0105249_11138520
943 Ga0105239_10065156
944 Ga0105239_10091075
945 Ga0105239_10965133
946 Ga0157315_1017031
947 Ga0157373_10019224
948 Ga0157373_10033226
949 Ga0157373_10043099
950 Ga0157373_10415501
951 Ga0157373_10418176
952 Ga0157373_10654511
953 Ga0157371_10000867
954 Ga0157371_10018515
955 Ga0157371_10267515
956 Ga0157371_10286960
957 Ga0157371_10635545
958 Ga0157370_10385119
959 Ga0157370_10515793
960 Ga0157369_10002818
961 Ga0157369_11348826
962 Ga0157374_10065892
963 Ga0157378_10019260
964 Ga0163162_10031122
965 Ga0163162_10061453
966 Ga0163162_10117855
967 Ga0163162_10273111
968 Ga0163162_10509123
969 Ga0163162_11563936
970 Ga0157372_10082424
971 Ga0157372_10161312
972 Ga0157372_10184084
973 Ga0157372_10648670
974 Ga0157372_10835581
975 Ga0157372_11353859
976 Ga0157375_10005886
977 Ga0157375_10046878
978 Ga0157375_10060474
979 Ga0157375_10171869
980 Ga0157375_10347509
981 Ga0157375_11105660
982 Ga0163163_10001398
983 Ga0163163_10107840
984 Ga0163163_10556970
985 Ga0182008_10094581
986 Ga0157377_10018468
987 Ga0157379_10634908
988 Ga0157379_10644680
989 Ga0157379_11389785
990 Ga0163161_10008421
991 Ga0213875_10011121
992 Ga0207697_10002577
993 Ga0207656_10057960
994 Ga0207688_10000353
995 Ga0207688_10065901
996 Ga0207680_10035080
997 Ga0207680_10548711
998 Ga0207680_10563233
999 Ga0207647_10002939
1000 Ga0207647_10004303
1001 Ga0207647_10059436
1002 Ga0207645_10000464
1003 Ga0207645_10086573
1004 Ga0207645_10443984
1005 Ga0207705_10017910
1006 Ga0207705_10048806
1007 Ga0207705_10060428
1008 Ga0207705_10125461
1009 Ga0207705_10198307
1010 Ga0207705_10479716
1011 Ga0207705_10551167
1012 Ga0207705_10957013
1013 Ga0207707_10010255
1014 Ga0207707_10085975
1015 Ga0207695_10096987
1016 Ga0207695_10434920
1017 Ga0207695_10950829
1018 Ga0207660_10118546
1019 Ga0207660_11097726
1020 Ga0207657_10014072
1021 Ga0207657_10024801
1022 Ga0207657_10081795
1023 Ga0207657_10215255
1024 Ga0207657_10267854
1025 Ga0207657_10326864
1026 Ga0207657_10340825
1027 Ga0207657_10353011
1028 Ga0207657_10493327
1029 Ga0207649_10013370
1030 Ga0207649_10062427
1031 Ga0207649_10091801
1032 Ga0207649_10221331
1033 Ga0207649_10223895
1034 Ga0207649_10367928
1035 Ga0207649_10448995
1036 Ga0207681_10079421
1037 Ga0207681_10176301
1038 Ga0207681_10623801
1039 Ga0207694_10088822
1040 Ga0207694_10118662
1041 Ga0207650_10063093
1042 Ga0207650_10151693
1043 Ga0207650_10291922
1044 Ga0207659_10195068
1045 Ga0207659_10336933
1046 Ga0207659_10439851
1047 Ga0207659_10648605
1048 Ga0207687_10092584
1049 Ga0207664_10571142
1050 Ga0207644_10000429
1051 Ga0207644_10001320
1052 Ga0207644_10004275
1053 Ga0207644_10035217
1054 Ga0207644_10056395
1055 Ga0207644_10066349
1056 Ga0207644_10090035
1057 Ga0207644_10112256
1058 Ga0207644_10174494
1059 Ga0207644_10454527
1060 Ga0207690_10002653
1061 Ga0207690_10014839
1062 Ga0207690_10019787
1063 Ga0207690_10078011
1064 Ga0207690_10177084
1065 Ga0207690_10440310
1066 Ga0207690_10589721
1067 Ga0207706_10002227
1068 Ga0207706_10004069
1069 Ga0207706_10023282
1070 Ga0207706_10057062
1071 Ga0207706_10213532
1072 Ga0207706_10305994
1073 Ga0207706_10483709
1074 Ga0207686_10342773
1075 Ga0207686_10786842
1076 Ga0207709_10027234
1077 Ga0207709_10586488
1078 Ga0207670_10351807
1079 Ga0207669_10324193
1080 Ga0207704_10320025
1081 Ga0207704_10884975
1082 Ga0207691_10001285
1083 Ga0207691_10002986
1084 Ga0207691_10041275
1085 Ga0207691_10121989
1086 Ga0207711_10000999
1087 Ga0207711_10001758
1088 Ga0207711_10003110
1089 Ga0207711_10003334
1090 Ga0207711_10033082
1091 Ga0207711_10058414
1092 Ga0207711_10073033
1093 Ga0207711_10220952
1094 Ga0207711_10635329
1095 Ga0207689_10000922
1096 Ga0207689_10003524
1097 Ga0207689_10042233
1098 Ga0207661_10308739
1099 Ga0207679_10000286
1100 Ga0207679_10012790
1101 Ga0207679_10014009
1102 Ga0207679_10201781
1103 Ga0207679_10399193
1104 Ga0207679_10444798
1105 Ga0207679_10863128
1106 Ga0207667_10066713
1107 Ga0207667_10068487
1108 Ga0207667_10110738
1109 Ga0207667_10265451
1110 Ga0207667_10783532
1111 Ga0207651_10005971
1112 Ga0207651_10018559
1113 Ga0207651_10848483
1114 Ga0207712_10002067
1115 Ga0207668_10000074
1116 Ga0207668_10041237
1117 Ga0207640_10011746
1118 Ga0207640_10043431
1119 Ga0207640_10053510
1120 Ga0207640_10593399
1121 Ga0207640_10939571
1122 Ga0207640_11221749
1123 Ga0207658_10011676
1124 Ga0207658_10035407
1125 Ga0207658_10164422
1126 Ga0207658_10174302
1127 Ga0207658_10289028
1128 Ga0207677_10108126
1129 Ga0207677_10121770
1130 Ga0207703_10018472
1131 Ga0207703_10070436
1132 Ga0207703_10118675
1133 Ga0207703_10528780
1134 Ga0207639_10044748
1135 Ga0207639_10065959
1136 Ga0207639_10108539
1137 Ga0207639_10574881
1138 Ga0207639_10643966
1139 Ga0207639_11303910
1140 Ga0207678_10002360
1141 Ga0207678_10338193
1142 Ga0207678_10708028
1143 Ga0207702_10502174
1144 Ga0207702_10750249
1145 Ga0207702_11636545
1146 Ga0207641_10013898
1147 Ga0207641_10031469
1148 Ga0207641_10065789
1149 Ga0207641_10104644
1150 Ga0207641_10248770
1151 Ga0207641_11329790
1152 Ga0207648_10003858
1153 Ga0207648_10015955
1154 Ga0207648_10019688
1155 Ga0207648_10465008
1156 Ga0207676_10003937
1157 Ga0207676_10012049
1158 Ga0207676_10019500
1159 Ga0207676_10101348
1160 Ga0207674_10003595
1161 Ga0207674_10004780
1162 Ga0207674_10010131
1163 Ga0207675_100047253
1164 Ga0207683_10009090
1165 Ga0207683_10015723
1166 Ga0207698_10007199
1167 Ga0207698_10063548
1168 Ga0207698_10174443
1169 Ga0207698_10486712
1170 Ga0207698_10802962
1171 Ga0268266_10008818
1172 Ga0268266_10049998
1173 Ga0268266_10160945
1174 Ga0268266_10914460
1175 Ga0268266_10963262
1176 Ga0268265_10004525
1177 Ga0268265_10005676
1178 Ga0268265_10192566
1179 Ga0268265_10414019
1180 Ga0268265_11728643
1181 Ga0268264_10002355
1182 Ga0268264_10051196
1183 Ga0268264_10056393
1184 Ga0268264_10127527
1185 Ga0268264_10529706
1186 Ga0307408_100066862
1187 Ga0307405_10020253
1188 Ga0307405_10296731
1189 Ga0307405_10538201
1190 Ga0307410_10071572
1191 Ga0307406_10070371
1192 Ga0307406_10169562
1193 Ga0307406_10298356
1194 Ga0307406_10695496
1195 Ga0307407_10039345
1196 Ga0307412_10622978
1197 Ga0307409_100193409
1198 Ga0307416_100555898
1199 Ga0307414_10019766
1200 Ga0307414_11156196
1201 Ga0307411_10019884
1202 Ga0307411_10215841
1203 Ga0307415_101486509
1204 Ga0373938_0105202
1205 Ga0373929_0024704
1206 Ga0373923_0040154
1207 Ga0373954_0023320
1208 Ga0373957_0095168
1209 Ga0373955_0006865
1210 Ga0373931_0192651
1211 Ga0373933_0053842
1212 Ga0373937_0067611
1213 Ga0395899_0003407
1214 Ga0395899_0005863
1215 Ga0395899_0062010
1216 Ga0395899_0078911
1217 Ga0395899_0084927
1218 Ga0395899_0187417
1219 Ga0395899_0290046
1220 Ga0395899_0368818
1221 Ga0395900_0000130
1222 Ga0395900_0002112
1223 Ga0395900_0003022
1224 Ga0395900_0012338
1225 Ga0395900_0073260
1226 Ga0395900_0076271
1227 Ga0395900_0077825
1228 Ga0395900_0110672
1229 Ga0395900_0138763
1230 Ga0395900_0287292
1231 Ga0395900_0864194
1232 Ga0395900_1283391
1233 Ga0395898_0000274
1234 Ga0395898_0042484
1235 Ga0395898_0074580
1236 Ga0395898_0076238
1237 Ga0395898_0256516
1238 Ga0395898_0274221
1239 Ga0395898_0492362
1240 Ga0395898_0633346
1241 Ga0395898_0695609
1242 Ga0395905_0000287
1243 Ga0395905_0000313
1244 Ga0395905_0007739
1245 Ga0395905_0009581
1246 Ga0395905_0009944
1247 Ga0395905_0024821
1248 Ga0395905_0039621
1249 Ga0395905_0044455
1250 Ga0395905_0066456
1251 Ga0395905_0084971
1252 Ga0395905_0086724
1253 Ga0395905_0098520
1254 Ga0395905_0133095
1255 Ga0395905_0274848
1256 Ga0395905_0302273
1257 Ga0395905_0349843
1258 Ga0395905_0591037
1259 Ga0395905_0696739
1260 Ga0395905_0714363
1261 Ga0436364_1370264
1262 Ga0395901_0000397
1263 Ga0395901_0000463
1264 Ga0395901_0000613
1265 Ga0395901_0011593
1266 Ga0395901_0037903
1267 Ga0395901_0079298
1268 Ga0395901_0127189
1269 Ga0395901_0166232
1270 Ga0395901_0188928
1271 Ga0395901_0337503
1272 Ga0395901_0371367
1273 Ga0395901_0411581
1274 Ga0395901_0610827
1275 Ga0450914_001186
1276 Ga0450920_091556
1277 Ga0450890_009336
1278 Ga0450889_000087
1279 Ga0450918_088119
1280 Ga0466965_0011753
1281 Ga0466963_0008943
1282 Ga0466963_0062294
1283 Ga0466963_0152962
1284 Ga0466957_0114897
1285 Ga0466957_0457459
1286 Ga0466960_0053416
1287 Ga0466958_0333221
1288 Ga0466967_0027804
1289 Ga0466967_0266413
1290 Ga0466967_0524938
1291 Ga0466967_0976931
1292 Ga0495663_0014700
1293 Ga0495663_0060173
1294 Ga0495654_0262293
1295 Ga0495668_0006757
1296 Ga0495668_0019978
1297 Ga0495668_0304115
1298 Ga0495588_0448505
1299 Ga0495669_0000579
1300 Ga0495669_0002632
1301 Ga0495669_0016151
1302 Ga0495670_0522953
1303 Ga0495683_0366606
1304 Ga0495677_0026000
1305 Ga0495677_0033335
1306 Ga0495685_108547
1307 Ga0495602_0011898
1308 Ga0496100_0003605
1309 Ga0496101_0005969
1310 Ga0496101_0120510
1311 Ga0496101_0186591
1312 Ga0496102_0000120
1313 Ga0496102_0514552
1314 Ga0496103_0000612
1315 Ga0496103_0460887
1316 Ga0496104_0541455
1317 Ga0496106_0000612
1318 Ga0496107_0000238
1319 Ga0496108_0024623
1320 Ga0496108_0091946
1321 Ga0496108_0112003
1322 Ga0496108_0209113
1323 Ga0496108_0335919
1324 Ga0496109_0001676
1325 Ga0496109_0007700
1326 Ga0496109_0070476
1327 Ga0496109_0316827
1328 Ga0496110_0009606
1329 Ga0496110_0028556
1330 Ga0496110_0056036
1331 Ga0496110_0105326
1332 Ga0496110_0147230
1333 Ga0496111_0001277
1334 Ga0496111_0014695
1335 Ga0496111_0028303
1336 Ga0496111_0136489
1337 Ga0496112_0001644
1338 Ga0496112_0003263
1339 Ga0496112_0009205
1340 Ga0496112_0016619
1341 Ga0496112_0022425
1342 Ga0496112_0439149
1343 Ga0496113_0001833
1344 Ga0496113_0005805
1345 Ga0496113_0005955
1346 Ga0496113_0039526
1347 Ga0496113_0357208
1348 Ga0496114_0017017
1349 Ga0496114_0048052
1350 Ga0496115_0001778
1351 Ga0496116_0001356
1352 Ga0496117_0001920
1353 Ga0496118_0002120
1354 Ga0496124_0000214
1355 Ga0501070_0108304
1356 Ga0501076_0406292
1357 nmdc:mga09592_789978_c1
1358 nmdc:mga08y16_251814_c1
1359 nmdc:mga0n895_1195648_c1
1360 nmdc:mga0n895_277689_c1
1361 nmdc:mga0a205_1442_c1
1362 Ga0495612_0094145

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

29

142

0.91

PF08534

Redoxin

Redoxin

27

159

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kng-assembly1.cif.gz_A crystal structure of ccmg reducing oxidoreductase at 1.14 a 0.9435 39 175
3kh9-assembly1.cif.gz_A crystal structure of the periplasmic soluble domain of oxidized ccmg from pseudomonas aeruginosa 0.9045 31 174
2g0f-assembly1.cif.gz_A crystal structure of p144a mutant of e.coli ccmg protein 0.898 32 175
2b1k-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8966 32 175
1kng-assembly1.cif.gz_A crystal structure of ccmg reducing oxidoreductase at 1.14 a 0.8932 39 175
ID Description Score Start End Superfamily
1kngA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9435 39 175 3.40.30.10
2b1kA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8966 32 175 3.40.30.10
1kngA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8932 39 175 3.40.30.10
2b1kA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8627 32 175 3.40.30.10
af_Q8BZW8_26_197_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8242 37 174 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2W4YS53-F1-model_v4 deleted 0.9935 42 175
AF-A0A520JFX6-F1-model_v4 DsbE family thiol:disulfide interchange protein 0.9831 70 175 GO:0016491
GO:0017004
AF-A0A4D7C6G8-F1-model_v4 Redoxin domain-containing protein 0.9829 37 175 GO:0015036
GO:0017004
GO:0030313
AF-A0A2W4YS53-F1-model_v4 deleted 0.9789 42 175
AF-U7P6S0-F1-model_v4 Thioredoxin domain-containing protein 0.973 63 175 GO:0005886
GO:0015036
GO:0017004
GO:0030288

Map