F474855
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 681 | 289 | 619 | 339 |
Family's Representative Sequence
| Representative Sequence | 3300046452|Ga0495617_000070|Ga0495617_000070_26798_27865 |
| Length | 355 |
| Sequence | LIFNGSNIETPRSIMKLASLKTGGRDGTLVVVSRDLVTCQPVPAIARTLQAALDDWDHVAPQLHQIYELLNQGMAADAVSFLEEECASPLPRAYQWADGSAYINHVELVRKARGAQVPPSFYTDPLMYQGGSDSFVGPRDPIAVQSEEWGVDLEAEVAVVTGDVPMGASPEQAARAIRLVMLVNDVSLRNLIPKELEKGFGFFQSKPASAFSPVAVTPDELGDAWRDSKLGLPLQVTLNGEPFGRPNAGDDMTFSFAQLVAHAAKTRELAAGSIIGSGTVSNKQGDLHGSSIANGGVGYCCLAELRMYETIEQGAPQTPFLRYGDTVRIEMLDAAGASIFGAIDQEVAHYQGRKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 4 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 5 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 6 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 7 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 8 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 9 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 10 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 11 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 12 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 13 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 14 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 15 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 16 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 17 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 18 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 19 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 20 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 21 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 22 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 23 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 24 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 25 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 26 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 27 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 28 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 29 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 30 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 31 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 32 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 33 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 34 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 35 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 36 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 37 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 38 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 39 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 40 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 41 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 42 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 43 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 44 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 45 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 46 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 47 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 48 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 49 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 50 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 51 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 52 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 53 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 54 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 55 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 56 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 57 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 58 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 59 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 60 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 61 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 62 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 63 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 64 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 65 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 66 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 67 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 68 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 69 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 70 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 71 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 72 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 73 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 74 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 75 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 76 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 77 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 78 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 79 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 80 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 81 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 90 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 95 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 149 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 153 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 154 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 155 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 157 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 158 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 161 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 162 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 163 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 164 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 165 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 166 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 167 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 168 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 169 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 170 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 171 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 172 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 173 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 174 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 175 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 176 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 177 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 178 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 179 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 180 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 181 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 182 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 258 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 259 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 262 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 263 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 264 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 265 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 266 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 267 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 268 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 269 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 270 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 271 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 272 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 273 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 274 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 279 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 282 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 283 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 287 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 288 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 289 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.16 |
| Metatranscriptomes | 0.73 |
| Isolates | 9.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.29 |
| Bulb | 0 |
| Endosphere | 8.52 |
| Nodule | 0.29 |
| Rhizoplane | 8.66 |
| Rhizosphere | 76.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3016416 | 2162886007 | Bacteria | 21736 |
| 2 | MRS1b_contig_6168241 | 2162886011 | Bacteria | 1629 |
| 3 | JGI25158J39367_1000851 | 3300002739 | Bacteria | 5837 |
| 4 | JGI25152J39213_1013788 | 3300002773 | Bacteria | 1667 |
| 5 | JGI25150J39212_1000554 | 3300002774 | Bacteria | 15048 |
| 6 | JGI25150J39212_1000999 | 3300002774 | Bacteria | 8827 |
| 7 | JGI25159J45721_1003101 | 3300002987 | Bacteria | 5999 |
| 8 | JGI25159J45721_1005160 | 3300002987 | Bacteria | 4138 |
| 9 | JGI25153J46596_10013131 | 3300003215 | Bacteria | 3521 |
| 10 | JGI25161J50226_1000776 | 3300003374 | Bacteria | 12129 |
| 11 | JGI25161J50226_1008967 | 3300003374 | Bacteria | 1478 |
| 12 | Ga0007409J51694_1008320 | 3300003575 | Bacteria | 3036 |
| 13 | Ga0007409J51694_1008322 | 3300003575 | Bacteria | 2250 |
| 14 | Ga0055525_1000001 | 3300003759 | Bacteria | 1016948 |
| 15 | Ga0055526_1000198 | 3300003771 | Bacteria | 51889 |
| 16 | Ga0055526_1002566 | 3300003771 | Bacteria | 12180 |
| 17 | Ga0055526_1003773 | 3300003771 | Bacteria | 9447 |
| 18 | Ga0055537_1001803 | 3300003773 | Bacteria | 7796 |
| 19 | Ga0055524_1001038 | 3300003775 | Bacteria | 17138 |
| 20 | Ga0055524_1002298 | 3300003775 | Bacteria | 9962 |
| 21 | Ga0055524_1009932 | 3300003775 | Bacteria | 3826 |
| 22 | Ga0055534_1006496 | 3300003784 | Bacteria | 2934 |
| 23 | Ga0055528_1011745 | 3300003790 | Bacteria | 3452 |
| 24 | Ga0055530_10000004 | 3300003791 | Bacteria | 231465 |
| 25 | Ga0055540_1000017 | 3300003792 | Bacteria | 231465 |
| 26 | Ga0055543_1000777 | 3300004625 | Bacteria | 15874 |
| 27 | Ga0065165_1000723 | 3300005262 | Bacteria | 46190 |
| 28 | Ga0065165_1001842 | 3300005262 | Bacteria | 20684 |
| 29 | Ga0065714_10002490 | 3300005288 | Bacteria | 15870 |
| 30 | Ga0065714_10004800 | 3300005288 | Bacteria | 5759 |
| 31 | Ga0065714_10018420 | 3300005288 | Bacteria | 1694 |
| 32 | Ga0065704_10070219 | 3300005289 | Bacteria | 67905 |
| 33 | Ga0070670_100002465 | 3300005331 | Bacteria | 15267 |
| 34 | Ga0070670_100013267 | 3300005331 | Bacteria | 7060 |
| 35 | Ga0070661_100000016 | 3300005344 | Bacteria | 153545 |
| 36 | Ga0070661_100024933 | 3300005344 | Bacteria | 4293 |
| 37 | Ga0070674_100093808 | 3300005356 | Bacteria | 2172 |
| 38 | Ga0070659_100036315 | 3300005366 | Bacteria | 3841 |
| 39 | Ga0070659_100102547 | 3300005366 | Bacteria | 2303 |
| 40 | Ga0070714_100151392 | 3300005435 | Bacteria | 2091 |
| 41 | Ga0070700_100122754 | 3300005441 | Bacteria | 1743 |
| 42 | Ga0070662_100233040 | 3300005457 | Bacteria | 1473 |
| 43 | Ga0070665_100265540 | 3300005548 | Bacteria | 1718 |
| 44 | Ga0068855_100034781 | 3300005563 | Bacteria | 6005 |
| 45 | Ga0070664_100000013 | 3300005564 | Bacteria | 153909 |
| 46 | Ga0070664_100232213 | 3300005564 | Bacteria | 1654 |
| 47 | Ga0068866_10054404 | 3300005718 | Bacteria | 2051 |
| 48 | Ga0068871_100334105 | 3300006358 | Bacteria | 1337 |
| 49 | Ga0068865_100104507 | 3300006881 | Bacteria | 2079 |
| 50 | Ga0079104_1000006 | 3300006946 | Bacteria | 396255 |
| 51 | Ga0105251_10055736 | 3300009011 | Bacteria | 1873 |
| 52 | Ga0105244_10001587 | 3300009036 | Bacteria | 18066 |
| 53 | Ga0105244_10034780 | 3300009036 | Bacteria | 2650 |
| 54 | Ga0105245_10133908 | 3300009098 | Bacteria | 2327 |
| 55 | Ga0105243_10000045 | 3300009148 | Bacteria | 156620 |
| 56 | Ga0105243_10050043 | 3300009148 | Bacteria | 3299 |
| 57 | Ga0105241_10117288 | 3300009174 | Bacteria | 2139 |
| 58 | Ga0105242_10001142 | 3300009176 | Bacteria | 20946 |
| 59 | Ga0105242_10019519 | 3300009176 | Bacteria | 5312 |
| 60 | Ga0105237_10000090 | 3300009545 | Bacteria | 123394 |
| 61 | Ga0105239_10483052 | 3300010375 | Bacteria | 1407 |
| 62 | Ga0157373_10030773 | 3300013100 | Bacteria | 3862 |
| 63 | Ga0157369_10002211 | 3300013105 | Bacteria | 23426 |
| 64 | Ga0157374_10129932 | 3300013296 | Bacteria | 2437 |
| 65 | Ga0157378_10040450 | 3300013297 | Bacteria | 4134 |
| 66 | Ga0157378_10630356 | 3300013297 | Bacteria | 1086 |
| 67 | Ga0163162_10000148 | 3300013306 | Bacteria | 64886 |
| 68 | Ga0157375_10000575 | 3300013308 | Bacteria | 32917 |
| 69 | Ga0157375_10086245 | 3300013308 | Bacteria | 3190 |
| 70 | Ga0157375_10571341 | 3300013308 | Bacteria | 1291 |
| 71 | Ga0182006_1000305 | 3300015261 | Bacteria | 42860 |
| 72 | Ga0163161_10002442 | 3300017792 | Bacteria | 13273 |
| 73 | Ga0163161_10225502 | 3300017792 | Bacteria | 1453 |
| 74 | Ga0209436_100243 | 3300025208 | Bacteria | 25107 |
| 75 | Ga0209436_100739 | 3300025208 | Bacteria | 13638 |
| 76 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 77 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 78 | Ga0207425_1000089 | 3300025245 | Bacteria | 91267 |
| 79 | Ga0209677_101317 | 3300025253 | Bacteria | 10971 |
| 80 | Ga0209148_1000320 | 3300025254 | Bacteria | 66815 |
| 81 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 82 | Ga0209129_1003360 | 3300025258 | Bacteria | 7039 |
| 83 | Ga0209565_1001261 | 3300025263 | Bacteria | 11772 |
| 84 | Ga0209565_1002264 | 3300025263 | Bacteria | 7129 |
| 85 | Ga0209673_1004003 | 3300025273 | Bacteria | 8182 |
| 86 | Ga0209130_1000407 | 3300025284 | Bacteria | 47012 |
| 87 | Ga0209130_1000994 | 3300025284 | Bacteria | 22084 |
| 88 | Ga0209130_1001239 | 3300025284 | Bacteria | 17922 |
| 89 | Ga0209675_1001997 | 3300025291 | Bacteria | 10948 |
| 90 | Ga0209675_1006810 | 3300025291 | Bacteria | 4506 |
| 91 | Ga0209676_1001053 | 3300025292 | Bacteria | 31708 |
| 92 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 93 | Ga0209564_1000178 | 3300025295 | Bacteria | 151982 |
| 94 | Ga0209564_1009436 | 3300025295 | Bacteria | 4643 |
| 95 | Ga0209758_1000116 | 3300025297 | Bacteria | 198356 |
| 96 | Ga0209050_1000037 | 3300025298 | Bacteria | 415612 |
| 97 | Ga0209050_1000480 | 3300025298 | Bacteria | 70176 |
| 98 | Ga0209050_1024807 | 3300025298 | Bacteria | 2060 |
| 99 | Ga0209256_1000297 | 3300025299 | Bacteria | 86973 |
| 100 | Ga0209256_1000515 | 3300025299 | Bacteria | 56806 |
| 101 | Ga0209256_1000635 | 3300025299 | Bacteria | 47967 |
| 102 | Ga0207426_1002747 | 3300025302 | Bacteria | 10653 |
| 103 | Ga0209051_1000040 | 3300025303 | Bacteria | 315055 |
| 104 | Ga0209051_1016724 | 3300025303 | Bacteria | 3303 |
| 105 | Ga0209257_1000293 | 3300025304 | Bacteria | 110422 |
| 106 | Ga0209257_1016016 | 3300025304 | Bacteria | 3064 |
| 107 | Ga0207696_1000006 | 3300025711 | Bacteria | 616498 |
| 108 | Ga0207696_1005533 | 3300025711 | Bacteria | 5225 |
| 109 | Ga0207655_1000109 | 3300025728 | Bacteria | 172040 |
| 110 | Ga0207655_1000176 | 3300025728 | Bacteria | 115120 |
| 111 | Ga0207655_1016977 | 3300025728 | Bacteria | 3950 |
| 112 | Ga0207713_1002598 | 3300025735 | Bacteria | 13027 |
| 113 | Ga0207705_10356400 | 3300025909 | Bacteria | 1128 |
| 114 | Ga0207654_10023215 | 3300025911 | Bacteria | 3319 |
| 115 | Ga0207671_10000118 | 3300025914 | Bacteria | 121904 |
| 116 | Ga0207657_10026879 | 3300025919 | Bacteria | 5278 |
| 117 | Ga0207649_10000046 | 3300025920 | Bacteria | 112669 |
| 118 | Ga0207681_10111118 | 3300025923 | Bacteria | 1994 |
| 119 | Ga0207650_10000192 | 3300025925 | Bacteria | 70742 |
| 120 | Ga0207650_10000208 | 3300025925 | Bacteria | 67183 |
| 121 | Ga0207687_10260619 | 3300025927 | Bacteria | 1382 |
| 122 | Ga0207690_10131622 | 3300025932 | Bacteria | 1831 |
| 123 | Ga0207706_10035699 | 3300025933 | Bacteria | 4419 |
| 124 | Ga0207686_10002105 | 3300025934 | Bacteria | 10966 |
| 125 | Ga0207709_10000011 | 3300025935 | Bacteria | 552881 |
| 126 | Ga0207709_10039221 | 3300025935 | Bacteria | 2828 |
| 127 | Ga0207669_10200396 | 3300025937 | Bacteria | 1448 |
| 128 | Ga0207679_10000033 | 3300025945 | Bacteria | 155875 |
| 129 | Ga0207667_10010303 | 3300025949 | Bacteria | 10936 |
| 130 | Ga0207708_10155162 | 3300026075 | Bacteria | 1805 |
| 131 | Ga0209281_1000011 | 3300027111 | Bacteria | 695292 |
| 132 | Ga0209371_1000477 | 3300027312 | Bacteria | 39251 |
| 133 | Ga0268266_10217377 | 3300028379 | Bacteria | 1755 |
| 134 | Ga0268256_1000405 | 3300030500 | Bacteria | 39251 |
| 135 | Ga0307408_100000074 | 3300031548 | Bacteria | 111955 |
| 136 | Ga0307408_100000098 | 3300031548 | Bacteria | 95689 |
| 137 | Ga0307408_100000870 | 3300031548 | Bacteria | 23712 |
| 138 | Ga0307408_100001591 | 3300031548 | Bacteria | 16759 |
| 139 | Ga0307408_100090033 | 3300031548 | Bacteria | 2314 |
| 140 | Ga0307408_100224212 | 3300031548 | Bacteria | 1535 |
| 141 | Ga0316576_10034599 | 3300031727 | Bacteria | 3601 |
| 142 | Ga0316576_10157845 | 3300031727 | Bacteria | 1710 |
| 143 | Ga0316578_10125354 | 3300031728 | Bacteria | 1544 |
| 144 | Ga0307405_10000130 | 3300031731 | Bacteria | 29904 |
| 145 | Ga0307405_10001329 | 3300031731 | Bacteria | 10357 |
| 146 | Ga0307405_10015105 | 3300031731 | Bacteria | 4171 |
| 147 | Ga0307413_10000948 | 3300031824 | Bacteria | 10386 |
| 148 | Ga0307406_10029060 | 3300031901 | Bacteria | 3344 |
| 149 | Ga0307412_10000661 | 3300031911 | Bacteria | 20028 |
| 150 | Ga0307412_10002366 | 3300031911 | Bacteria | 10462 |
| 151 | Ga0307412_10032428 | 3300031911 | Bacteria | 3310 |
| 152 | Ga0307412_10113771 | 3300031911 | Bacteria | 1936 |
| 153 | Ga0307412_10189525 | 3300031911 | Bacteria | 1553 |
| 154 | Ga0307416_100367546 | 3300032002 | Bacteria | 1463 |
| 155 | Ga0307414_10000407 | 3300032004 | Bacteria | 23346 |
| 156 | Ga0307414_10028770 | 3300032004 | Bacteria | 3608 |
| 157 | Ga0307411_10245087 | 3300032005 | Bacteria | 1405 |
| 158 | Ga0395899_0012567 | 3300037312 | Bacteria | 6489 |
| 159 | Ga0395899_0016298 | 3300037312 | Bacteria | 5664 |
| 160 | Ga0395899_0047842 | 3300037312 | Bacteria | 3183 |
| 161 | Ga0395899_0159332 | 3300037312 | Bacteria | 1595 |
| 162 | Ga0395900_0001489 | 3300037418 | Bacteria | 27861 |
| 163 | Ga0395900_0047209 | 3300037418 | Bacteria | 4434 |
| 164 | Ga0395900_0050199 | 3300037418 | Bacteria | 4297 |
| 165 | Ga0395900_0226854 | 3300037418 | Bacteria | 1880 |
| 166 | Ga0395900_0413072 | 3300037418 | Bacteria | 1311 |
| 167 | Ga0395898_0007100 | 3300037466 | Bacteria | 11895 |
| 168 | Ga0395898_0099288 | 3300037466 | Bacteria | 2796 |
| 169 | Ga0395905_0079517 | 3300037471 | Bacteria | 3073 |
| 170 | Ga0395905_0082558 | 3300037471 | Bacteria | 3011 |
| 171 | Ga0395905_0178494 | 3300037471 | Bacteria | 1993 |
| 172 | Ga0395905_0350813 | 3300037471 | Bacteria | 1367 |
| 173 | Ga0395901_0000491 | 3300038443 | Bacteria | 45939 |
| 174 | Ga0395901_0010628 | 3300038443 | Bacteria | 9326 |
| 175 | Ga0395901_0039708 | 3300038443 | Bacteria | 4871 |
| 176 | Ga0395901_0106989 | 3300038443 | Bacteria | 2935 |
| 177 | Ga0395901_0113204 | 3300038443 | Bacteria | 2849 |
| 178 | Ga0439466_0001938 | 3300041411 | Bacteria | 8124 |
| 179 | Ga0439466_0012758 | 3300041411 | Bacteria | 3087 |
| 180 | Ga0439448_0039649 | 3300042005 | Bacteria | 1519 |
| 181 | Ga0439455_0016756 | 3300042012 | Bacteria | 1699 |
| 182 | Ga0439458_0018071 | 3300042157 | Bacteria | 1613 |
| 183 | Ga0466972_0044681 | 3300044658 | Bacteria | 2148 |
| 184 | Ga0466972_0080880 | 3300044658 | Bacteria | 1547 |
| 185 | Ga0466972_0103530 | 3300044658 | Bacteria | 1346 |
| 186 | Ga0466965_0005810 | 3300044683 | Bacteria | 5567 |
| 187 | Ga0466966_0005398 | 3300044684 | Bacteria | 8399 |
| 188 | Ga0466966_0021850 | 3300044684 | Bacteria | 4200 |
| 189 | Ga0466961_0108168 | 3300044693 | Bacteria | 1750 |
| 190 | Ga0466964_0002326 | 3300044706 | Bacteria | 6740 |
| 191 | Ga0466964_0003695 | 3300044706 | Bacteria | 5604 |
| 192 | Ga0466964_0047805 | 3300044706 | Bacteria | 1747 |
| 193 | Ga0466968_0007634 | 3300044735 | Bacteria | 4118 |
| 194 | Ga0466957_0000089 | 3300044842 | Bacteria | 36497 |
| 195 | Ga0466957_0002847 | 3300044842 | Bacteria | 9356 |
| 196 | Ga0466957_0100190 | 3300044842 | Bacteria | 1825 |
| 197 | Ga0466959_0199835 | 3300045049 | Bacteria | 1392 |
| 198 | Ga0451576_0000165 | 3300045051 | Bacteria | 168085 |
| 199 | Ga0451576_0001042 | 3300045051 | Bacteria | 51034 |
| 200 | Ga0466958_0070545 | 3300045836 | Bacteria | 2138 |
| 201 | Ga0466958_0157524 | 3300045836 | Bacteria | 1433 |
| 202 | Ga0466967_0028783 | 3300045976 | Bacteria | 4643 |
| 203 | Ga0466967_0077670 | 3300045976 | Bacteria | 2989 |
| 204 | Ga0495617_000070 | 3300046452 | Bacteria | 84436 |
| 205 | Ga0495617_011150 | 3300046452 | Bacteria | 3072 |
| 206 | Ga0495627_000201 | 3300046453 | Bacteria | 65296 |
| 207 | Ga0495627_002489 | 3300046453 | Bacteria | 8800 |
| 208 | Ga0495627_051625 | 3300046453 | Bacteria | 1235 |
| 209 | Ga0495603_0011297 | 3300046455 | Bacteria | 5410 |
| 210 | Ga0495603_0021673 | 3300046455 | Bacteria | 3891 |
| 211 | Ga0495590_0000060 | 3300046457 | Bacteria | 89639 |
| 212 | Ga0495590_0000238 | 3300046457 | Bacteria | 30191 |
| 213 | Ga0495590_0003557 | 3300046457 | Bacteria | 6343 |
| 214 | Ga0495591_000190 | 3300046458 | Bacteria | 63717 |
| 215 | Ga0495629_0186745 | 3300046459 | Bacteria | 1435 |
| 216 | Ga0495638_0002326 | 3300046460 | Bacteria | 15651 |
| 217 | Ga0495638_0049512 | 3300046460 | Bacteria | 2627 |
| 218 | Ga0495653_0001958 | 3300046463 | Bacteria | 16215 |
| 219 | Ga0495650_0000048 | 3300046471 | Bacteria | 334427 |
| 220 | Ga0495650_0000611 | 3300046471 | Bacteria | 48647 |
| 221 | Ga0495650_0003786 | 3300046471 | Bacteria | 10777 |
| 222 | Ga0495650_0019540 | 3300046471 | Bacteria | 3329 |
| 223 | Ga0495580_0053634 | 3300046472 | Bacteria | 2844 |
| 224 | Ga0495582_0008200 | 3300046473 | Bacteria | 5766 |
| 225 | Ga0495582_0014737 | 3300046473 | Bacteria | 4296 |
| 226 | Ga0495582_0084025 | 3300046473 | Bacteria | 1769 |
| 227 | Ga0495605_0000053 | 3300046474 | Bacteria | 158757 |
| 228 | Ga0495605_0000154 | 3300046474 | Bacteria | 88757 |
| 229 | Ga0495605_0000161 | 3300046474 | Bacteria | 86062 |
| 230 | Ga0495605_0000967 | 3300046474 | Bacteria | 19540 |
| 231 | Ga0495605_0001972 | 3300046474 | Bacteria | 13011 |
| 232 | Ga0495605_0005317 | 3300046474 | Bacteria | 7506 |
| 233 | Ga0495605_0005436 | 3300046474 | Bacteria | 7418 |
| 234 | Ga0495605_0019147 | 3300046474 | Bacteria | 3662 |
| 235 | Ga0495605_0026472 | 3300046474 | Bacteria | 3015 |
| 236 | Ga0495605_0033721 | 3300046474 | Bacteria | 2597 |
| 237 | Ga0495605_0062108 | 3300046474 | Bacteria | 1785 |
| 238 | Ga0495605_0065042 | 3300046474 | Bacteria | 1735 |
| 239 | Ga0495584_0000059 | 3300046491 | Bacteria | 79769 |
| 240 | Ga0495584_0000275 | 3300046491 | Bacteria | 36555 |
| 241 | Ga0495584_0000639 | 3300046491 | Bacteria | 23311 |
| 242 | Ga0495584_0001361 | 3300046491 | Bacteria | 14770 |
| 243 | Ga0495584_0001892 | 3300046491 | Bacteria | 12075 |
| 244 | Ga0495584_0009418 | 3300046491 | Bacteria | 5032 |
| 245 | Ga0495584_0042229 | 3300046491 | Bacteria | 2301 |
| 246 | Ga0495584_0053131 | 3300046491 | Bacteria | 2039 |
| 247 | Ga0495584_0082188 | 3300046491 | Bacteria | 1621 |
| 248 | Ga0495585_0000084 | 3300046492 | Bacteria | 98839 |
| 249 | Ga0495585_0000122 | 3300046492 | Bacteria | 84570 |
| 250 | Ga0495585_0000215 | 3300046492 | Bacteria | 60187 |
| 251 | Ga0495585_0000522 | 3300046492 | Bacteria | 36273 |
| 252 | Ga0495585_0003664 | 3300046492 | Bacteria | 10268 |
| 253 | Ga0495585_0003757 | 3300046492 | Bacteria | 10136 |
| 254 | Ga0495585_0007654 | 3300046492 | Bacteria | 6591 |
| 255 | Ga0495585_0010373 | 3300046492 | Bacteria | 5548 |
| 256 | Ga0495585_0074123 | 3300046492 | Bacteria | 1852 |
| 257 | Ga0495594_0000361 | 3300046499 | Bacteria | 22852 |
| 258 | Ga0495594_0006599 | 3300046499 | Bacteria | 5969 |
| 259 | Ga0495594_0033362 | 3300046499 | Bacteria | 2798 |
| 260 | Ga0495596_0000100 | 3300046500 | Bacteria | 60871 |
| 261 | Ga0495596_0003842 | 3300046500 | Bacteria | 7462 |
| 262 | Ga0495596_0004940 | 3300046500 | Bacteria | 6394 |
| 263 | Ga0495596_0007852 | 3300046500 | Bacteria | 4782 |
| 264 | Ga0495596_0007913 | 3300046500 | Bacteria | 4759 |
| 265 | Ga0495596_0008970 | 3300046500 | Bacteria | 4419 |
| 266 | Ga0495596_0011671 | 3300046500 | Bacteria | 3779 |
| 267 | Ga0495596_0029930 | 3300046500 | Bacteria | 2181 |
| 268 | Ga0495596_0033483 | 3300046500 | Bacteria | 2044 |
| 269 | Ga0495596_0096394 | 3300046500 | Bacteria | 1148 |
| 270 | Ga0495607_0000025 | 3300046501 | Bacteria | 159379 |
| 271 | Ga0495607_0000619 | 3300046501 | Bacteria | 34447 |
| 272 | Ga0495607_0003541 | 3300046501 | Bacteria | 11891 |
| 273 | Ga0495607_0004523 | 3300046501 | Bacteria | 10207 |
| 274 | Ga0495607_0007434 | 3300046501 | Bacteria | 7580 |
| 275 | Ga0495607_0011264 | 3300046501 | Bacteria | 5964 |
| 276 | Ga0495607_0042797 | 3300046501 | Bacteria | 2682 |
| 277 | Ga0495607_0056839 | 3300046501 | Bacteria | 2244 |
| 278 | Ga0495607_0064116 | 3300046501 | Bacteria | 2076 |
| 279 | Ga0495583_0000230 | 3300046506 | Bacteria | 93092 |
| 280 | Ga0495583_0000754 | 3300046506 | Bacteria | 41124 |
| 281 | Ga0495583_0000791 | 3300046506 | Bacteria | 39222 |
| 282 | Ga0495583_0004131 | 3300046506 | Bacteria | 10639 |
| 283 | Ga0495583_0014243 | 3300046506 | Bacteria | 4396 |
| 284 | Ga0495583_0019079 | 3300046506 | Bacteria | 3589 |
| 285 | Ga0495583_0021077 | 3300046506 | Bacteria | 3358 |
| 286 | Ga0495583_0068847 | 3300046506 | Bacteria | 1559 |
| 287 | Ga0495606_0001284 | 3300046507 | Bacteria | 34796 |
| 288 | Ga0495606_0011259 | 3300046507 | Bacteria | 7319 |
| 289 | Ga0495606_0013503 | 3300046507 | Bacteria | 6443 |
| 290 | Ga0495606_0039492 | 3300046507 | Bacteria | 3179 |
| 291 | Ga0495606_0073990 | 3300046507 | Bacteria | 2135 |
| 292 | Ga0495610_0000069 | 3300046512 | Bacteria | 121713 |
| 293 | Ga0495610_0005183 | 3300046512 | Bacteria | 9336 |
| 294 | Ga0495616_0000406 | 3300046513 | Bacteria | 33248 |
| 295 | Ga0495616_0001911 | 3300046513 | Bacteria | 14044 |
| 296 | Ga0495616_0002040 | 3300046513 | Bacteria | 13567 |
| 297 | Ga0495616_0004109 | 3300046513 | Bacteria | 9230 |
| 298 | Ga0495616_0004378 | 3300046513 | Bacteria | 8908 |
| 299 | Ga0495616_0010810 | 3300046513 | Bacteria | 5261 |
| 300 | Ga0495616_0011460 | 3300046513 | Bacteria | 5078 |
| 301 | Ga0495616_0012458 | 3300046513 | Bacteria | 4828 |
| 302 | Ga0495616_0023840 | 3300046513 | Bacteria | 3288 |
| 303 | Ga0495616_0024473 | 3300046513 | Bacteria | 3239 |
| 304 | Ga0495616_0054111 | 3300046513 | Unclassified | 1992 |
| 305 | Ga0495616_0058228 | 3300046513 | Bacteria | 1903 |
| 306 | Ga0495616_0100288 | 3300046513 | Bacteria | 1359 |
| 307 | Ga0495616_0122043 | 3300046513 | Bacteria | 1202 |
| 308 | Ga0495630_0048200 | 3300046517 | Bacteria | 3188 |
| 309 | Ga0495631_0000240 | 3300046518 | Bacteria | 37805 |
| 310 | Ga0495631_0000319 | 3300046518 | Bacteria | 33378 |
| 311 | Ga0495631_0002882 | 3300046518 | Bacteria | 9536 |
| 312 | Ga0495631_0006761 | 3300046518 | Bacteria | 5886 |
| 313 | Ga0495631_0010660 | 3300046518 | Bacteria | 4544 |
| 314 | Ga0495631_0019499 | 3300046518 | Bacteria | 3179 |
| 315 | Ga0495631_0020913 | 3300046518 | Bacteria | 3051 |
| 316 | Ga0495631_0033086 | 3300046518 | Bacteria | 2324 |
| 317 | Ga0495631_0043374 | 3300046518 | Bacteria | 1984 |
| 318 | Ga0495631_0078242 | 3300046518 | Bacteria | 1427 |
| 319 | Ga0495632_0000147 | 3300046519 | Bacteria | 72673 |
| 320 | Ga0495632_0000451 | 3300046519 | Bacteria | 39172 |
| 321 | Ga0495632_0000514 | 3300046519 | Bacteria | 36429 |
| 322 | Ga0495632_0001898 | 3300046519 | Bacteria | 16724 |
| 323 | Ga0495632_0002919 | 3300046519 | Bacteria | 12544 |
| 324 | Ga0495632_0013819 | 3300046519 | Bacteria | 4590 |
| 325 | Ga0495632_0041398 | 3300046519 | Bacteria | 2315 |
| 326 | Ga0495632_0076418 | 3300046519 | Bacteria | 1601 |
| 327 | Ga0495632_0110609 | 3300046519 | Bacteria | 1290 |
| 328 | Ga0495637_0000004 | 3300046520 | Bacteria | 589740 |
| 329 | Ga0495643_0000787 | 3300046522 | Bacteria | 35192 |
| 330 | Ga0495643_0001650 | 3300046522 | Bacteria | 19636 |
| 331 | Ga0495643_0010199 | 3300046522 | Bacteria | 5790 |
| 332 | Ga0495643_0021153 | 3300046522 | Bacteria | 3738 |
| 333 | Ga0495643_0077403 | 3300046522 | Bacteria | 1738 |
| 334 | Ga0495644_0003474 | 3300046523 | Bacteria | 6234 |
| 335 | Ga0495644_0013743 | 3300046523 | Bacteria | 3104 |
| 336 | Ga0495644_0014908 | 3300046523 | Bacteria | 2976 |
| 337 | Ga0495644_0024433 | 3300046523 | Bacteria | 2298 |
| 338 | Ga0495644_0037233 | 3300046523 | Bacteria | 1835 |
| 339 | Ga0495644_0060588 | 3300046523 | Bacteria | 1422 |
| 340 | Ga0495648_0000118 | 3300046524 | Bacteria | 95878 |
| 341 | Ga0495648_0002143 | 3300046524 | Bacteria | 18595 |
| 342 | Ga0495648_0003243 | 3300046524 | Bacteria | 14420 |
| 343 | Ga0495648_0006869 | 3300046524 | Bacteria | 9188 |
| 344 | Ga0495648_0042560 | 3300046524 | Bacteria | 2856 |
| 345 | Ga0495648_0049850 | 3300046524 | Bacteria | 2563 |
| 346 | Ga0495648_0104202 | 3300046524 | Bacteria | 1558 |
| 347 | Ga0495666_0005546 | 3300046526 | Bacteria | 6356 |
| 348 | Ga0495642_0000060 | 3300046528 | Bacteria | 65690 |
| 349 | Ga0495642_0000648 | 3300046528 | Bacteria | 17461 |
| 350 | Ga0495642_0002840 | 3300046528 | Bacteria | 6912 |
| 351 | Ga0495642_0003712 | 3300046528 | Bacteria | 5989 |
| 352 | Ga0495642_0004279 | 3300046528 | Bacteria | 5549 |
| 353 | Ga0495642_0018163 | 3300046528 | Bacteria | 2751 |
| 354 | Ga0495642_0041892 | 3300046528 | Bacteria | 1863 |
| 355 | Ga0495652_0023959 | 3300046529 | Bacteria | 5406 |
| 356 | Ga0495654_0000276 | 3300046530 | Bacteria | 46492 |
| 357 | Ga0495654_0023159 | 3300046530 | Bacteria | 3218 |
| 358 | Ga0495654_0028871 | 3300046530 | Bacteria | 2833 |
| 359 | Ga0495654_0032648 | 3300046530 | Bacteria | 2638 |
| 360 | Ga0495654_0089741 | 3300046530 | Bacteria | 1428 |
| 361 | Ga0495640_0113041 | 3300046533 | Bacteria | 1772 |
| 362 | Ga0495586_0010512 | 3300046535 | Bacteria | 4923 |
| 363 | Ga0495586_0022138 | 3300046535 | Bacteria | 3391 |
| 364 | Ga0495587_0050978 | 3300046536 | Bacteria | 2448 |
| 365 | Ga0495609_0000059 | 3300046538 | Bacteria | 142403 |
| 366 | Ga0495609_0000987 | 3300046538 | Bacteria | 20321 |
| 367 | Ga0495609_0007272 | 3300046538 | Bacteria | 5545 |
| 368 | Ga0495609_0009818 | 3300046538 | Bacteria | 4615 |
| 369 | Ga0495609_0012095 | 3300046538 | Bacteria | 4097 |
| 370 | Ga0495609_0027721 | 3300046538 | Bacteria | 2587 |
| 371 | Ga0495609_0034283 | 3300046538 | Bacteria | 2301 |
| 372 | Ga0495609_0041149 | 3300046538 | Bacteria | 2078 |
| 373 | Ga0495609_0092209 | 3300046538 | Bacteria | 1317 |
| 374 | Ga0495609_0130147 | 3300046538 | Bacteria | 1078 |
| 375 | Ga0495597_0000274 | 3300046542 | Bacteria | 46959 |
| 376 | Ga0495597_0000554 | 3300046542 | Bacteria | 31077 |
| 377 | Ga0495597_0002485 | 3300046542 | Bacteria | 11632 |
| 378 | Ga0495597_0003899 | 3300046542 | Bacteria | 8426 |
| 379 | Ga0495597_0013281 | 3300046542 | Bacteria | 3950 |
| 380 | Ga0495597_0051840 | 3300046542 | Bacteria | 1808 |
| 381 | Ga0495645_0122449 | 3300046543 | Bacteria | 1830 |
| 382 | Ga0495645_0227224 | 3300046543 | Bacteria | 1252 |
| 383 | Ga0495622_0011514 | 3300046557 | Bacteria | 4087 |
| 384 | Ga0495622_0025367 | 3300046557 | Bacteria | 2769 |
| 385 | Ga0495633_0002512 | 3300046558 | Bacteria | 12904 |
| 386 | Ga0495633_0003520 | 3300046558 | Bacteria | 10379 |
| 387 | Ga0495633_0004820 | 3300046558 | Bacteria | 8461 |
| 388 | Ga0495633_0007858 | 3300046558 | Bacteria | 6086 |
| 389 | Ga0495633_0008942 | 3300046558 | Bacteria | 5581 |
| 390 | Ga0495633_0011043 | 3300046558 | Bacteria | 4900 |
| 391 | Ga0495633_0022885 | 3300046558 | Bacteria | 3100 |
| 392 | Ga0495633_0053585 | 3300046558 | Bacteria | 1899 |
| 393 | Ga0495633_0092277 | 3300046558 | Bacteria | 1407 |
| 394 | Ga0495633_0100057 | 3300046558 | Bacteria | 1346 |
| 395 | Ga0495656_0006196 | 3300046615 | Bacteria | 4185 |
| 396 | Ga0495656_0038285 | 3300046615 | Bacteria | 1985 |
| 397 | Ga0495668_0000682 | 3300046616 | Bacteria | 40861 |
| 398 | Ga0495668_0001339 | 3300046616 | Bacteria | 24223 |
| 399 | Ga0495668_0001688 | 3300046616 | Bacteria | 20428 |
| 400 | Ga0495668_0002654 | 3300046616 | Bacteria | 14375 |
| 401 | Ga0495668_0007057 | 3300046616 | Bacteria | 7236 |
| 402 | Ga0495668_0009569 | 3300046616 | Bacteria | 5937 |
| 403 | Ga0495668_0013029 | 3300046616 | Bacteria | 4920 |
| 404 | Ga0495668_0047226 | 3300046616 | Bacteria | 2390 |
| 405 | Ga0495668_0055215 | 3300046616 | Bacteria | 2193 |
| 406 | Ga0495611_0000328 | 3300046648 | Bacteria | 31136 |
| 407 | Ga0495611_0001420 | 3300046648 | Bacteria | 11957 |
| 408 | Ga0495611_0004896 | 3300046648 | Bacteria | 5747 |
| 409 | Ga0495611_0047884 | 3300046648 | Bacteria | 1919 |
| 410 | Ga0495611_0051924 | 3300046648 | Bacteria | 1848 |
| 411 | Ga0495625_0022206 | 3300046660 | Bacteria | 4869 |
| 412 | Ga0495625_0074242 | 3300046660 | Bacteria | 2382 |
| 413 | Ga0495625_0119353 | 3300046660 | Bacteria | 1796 |
| 414 | Ga0495635_0001764 | 3300046663 | Bacteria | 14591 |
| 415 | Ga0495661_0000259 | 3300046665 | Bacteria | 60869 |
| 416 | Ga0495661_0000647 | 3300046665 | Bacteria | 35294 |
| 417 | Ga0495661_0001779 | 3300046665 | Bacteria | 17316 |
| 418 | Ga0495661_0003205 | 3300046665 | Bacteria | 12217 |
| 419 | Ga0495661_0003234 | 3300046665 | Bacteria | 12140 |
| 420 | Ga0495661_0004153 | 3300046665 | Bacteria | 10531 |
| 421 | Ga0495661_0011989 | 3300046665 | Bacteria | 5866 |
| 422 | Ga0495661_0025013 | 3300046665 | Bacteria | 3862 |
| 423 | Ga0495661_0025858 | 3300046665 | Bacteria | 3786 |
| 424 | Ga0495661_0033720 | 3300046665 | Bacteria | 3227 |
| 425 | Ga0495661_0034226 | 3300046665 | Bacteria | 3197 |
| 426 | Ga0495661_0037314 | 3300046665 | Bacteria | 3034 |
| 427 | Ga0495661_0068561 | 3300046665 | Bacteria | 2080 |
| 428 | Ga0495588_0000137 | 3300046674 | Bacteria | 114279 |
| 429 | Ga0495588_0009704 | 3300046674 | Bacteria | 4460 |
| 430 | Ga0495588_0015420 | 3300046674 | Bacteria | 3678 |
| 431 | Ga0495588_0017529 | 3300046674 | Bacteria | 3480 |
| 432 | Ga0495588_0039793 | 3300046674 | Bacteria | 2396 |
| 433 | Ga0495588_0042623 | 3300046674 | Bacteria | 2320 |
| 434 | Ga0495588_0056454 | 3300046674 | Bacteria | 2027 |
| 435 | Ga0495623_0022033 | 3300046679 | Bacteria | 4116 |
| 436 | Ga0495646_0170156 | 3300046680 | Bacteria | 1201 |
| 437 | Ga0495669_0000120 | 3300046684 | Bacteria | 50677 |
| 438 | Ga0495669_0000516 | 3300046684 | Bacteria | 17588 |
| 439 | Ga0495669_0001191 | 3300046684 | Bacteria | 10809 |
| 440 | Ga0495669_0021706 | 3300046684 | Bacteria | 2789 |
| 441 | Ga0495669_0034181 | 3300046684 | Bacteria | 2240 |
| 442 | Ga0495669_0039512 | 3300046684 | Bacteria | 2089 |
| 443 | Ga0495613_0015597 | 3300046689 | Bacteria | 5653 |
| 444 | Ga0495613_0047884 | 3300046689 | Bacteria | 3157 |
| 445 | Ga0495670_0001524 | 3300046691 | Bacteria | 11316 |
| 446 | Ga0495670_0002554 | 3300046691 | Bacteria | 8991 |
| 447 | Ga0495670_0011218 | 3300046691 | Bacteria | 4404 |
| 448 | Ga0495670_0013153 | 3300046691 | Bacteria | 4069 |
| 449 | Ga0495670_0019668 | 3300046691 | Bacteria | 3328 |
| 450 | Ga0495670_0022759 | 3300046691 | Bacteria | 3094 |
| 451 | Ga0495670_0023486 | 3300046691 | Bacteria | 3043 |
| 452 | Ga0495671_0000275 | 3300046692 | Bacteria | 43068 |
| 453 | Ga0495671_0013692 | 3300046692 | Bacteria | 4383 |
| 454 | Ga0495671_0016774 | 3300046692 | Bacteria | 3905 |
| 455 | Ga0495649_0000122 | 3300046694 | Bacteria | 68254 |
| 456 | Ga0495649_0004107 | 3300046694 | Bacteria | 9564 |
| 457 | Ga0495649_0009673 | 3300046694 | Bacteria | 5715 |
| 458 | Ga0495649_0016860 | 3300046694 | Bacteria | 4135 |
| 459 | Ga0495649_0027927 | 3300046694 | Bacteria | 3129 |
| 460 | Ga0495649_0053090 | 3300046694 | Bacteria | 2195 |
| 461 | Ga0495649_0078715 | 3300046694 | Bacteria | 1763 |
| 462 | Ga0495649_0110268 | 3300046694 | Bacteria | 1459 |
| 463 | Ga0495589_0000052 | 3300046794 | Bacteria | 111467 |
| 464 | Ga0495589_0000185 | 3300046794 | Bacteria | 55116 |
| 465 | Ga0495589_0001210 | 3300046794 | Bacteria | 15349 |
| 466 | Ga0495589_0002207 | 3300046794 | Bacteria | 10961 |
| 467 | Ga0495589_0006148 | 3300046794 | Bacteria | 6341 |
| 468 | Ga0495589_0012254 | 3300046794 | Bacteria | 4447 |
| 469 | Ga0495589_0016225 | 3300046794 | Bacteria | 3827 |
| 470 | Ga0495589_0020361 | 3300046794 | Bacteria | 3392 |
| 471 | Ga0495589_0029142 | 3300046794 | Bacteria | 2782 |
| 472 | Ga0495589_0043304 | 3300046794 | Bacteria | 2241 |
| 473 | Ga0495660_0000154 | 3300046810 | Bacteria | 74753 |
| 474 | Ga0495660_0005463 | 3300046810 | Bacteria | 7612 |
| 475 | Ga0495660_0006813 | 3300046810 | Bacteria | 6737 |
| 476 | Ga0495660_0007198 | 3300046810 | Bacteria | 6551 |
| 477 | Ga0495660_0008450 | 3300046810 | Bacteria | 6029 |
| 478 | Ga0495660_0010475 | 3300046810 | Bacteria | 5391 |
| 479 | Ga0495581_0008782 | 3300047315 | Bacteria | 5849 |
| 480 | Ga0495604_0020837 | 3300047317 | Bacteria | 5234 |
| 481 | Ga0495672_0000237 | 3300047320 | Bacteria | 78194 |
| 482 | Ga0495672_0000579 | 3300047320 | Bacteria | 41410 |
| 483 | Ga0495672_0000603 | 3300047320 | Bacteria | 40496 |
| 484 | Ga0495672_0002539 | 3300047320 | Bacteria | 16649 |
| 485 | Ga0495672_0021462 | 3300047320 | Bacteria | 4212 |
| 486 | Ga0495672_0050383 | 3300047320 | Bacteria | 2458 |
| 487 | Ga0495672_0085137 | 3300047320 | Bacteria | 1752 |
| 488 | Ga0495672_0099608 | 3300047320 | Bacteria | 1579 |
| 489 | Ga0495676_0000243 | 3300047321 | Bacteria | 43967 |
| 490 | Ga0495680_0016123 | 3300047322 | Bacteria | 6424 |
| 491 | Ga0495683_0000079 | 3300047323 | Bacteria | 96333 |
| 492 | Ga0495683_0000296 | 3300047323 | Bacteria | 42776 |
| 493 | Ga0495683_0006650 | 3300047323 | Bacteria | 6301 |
| 494 | Ga0495683_0014047 | 3300047323 | Bacteria | 4171 |
| 495 | Ga0495683_0017410 | 3300047323 | Bacteria | 3725 |
| 496 | Ga0495683_0055516 | 3300047323 | Bacteria | 1971 |
| 497 | Ga0495683_0067172 | 3300047323 | Bacteria | 1765 |
| 498 | Ga0495687_000087 | 3300047443 | Bacteria | 142540 |
| 499 | Ga0495687_000226 | 3300047443 | Bacteria | 79404 |
| 500 | Ga0495687_000263 | 3300047443 | Bacteria | 70773 |
| 501 | Ga0495687_000275 | 3300047443 | Bacteria | 68138 |
| 502 | Ga0495687_000695 | 3300047443 | Bacteria | 37969 |
| 503 | Ga0495687_000831 | 3300047443 | Bacteria | 32963 |
| 504 | Ga0495675_0008913 | 3300047444 | Bacteria | 6234 |
| 505 | Ga0495677_0000033 | 3300047445 | Bacteria | 83783 |
| 506 | Ga0495677_0000359 | 3300047445 | Bacteria | 19726 |
| 507 | Ga0495677_0000747 | 3300047445 | Bacteria | 13135 |
| 508 | Ga0495677_0001425 | 3300047445 | Bacteria | 9585 |
| 509 | Ga0495677_0002594 | 3300047445 | Bacteria | 7069 |
| 510 | Ga0495677_0002820 | 3300047445 | Bacteria | 6778 |
| 511 | Ga0495677_0003300 | 3300047445 | Bacteria | 6285 |
| 512 | Ga0495677_0003383 | 3300047445 | Bacteria | 6204 |
| 513 | Ga0495677_0017460 | 3300047445 | Bacteria | 2601 |
| 514 | Ga0495677_0078925 | 3300047445 | Bacteria | 1232 |
| 515 | Ga0495679_003638 | 3300047446 | Bacteria | 7366 |
| 516 | Ga0495679_013039 | 3300047446 | Bacteria | 3136 |
| 517 | Ga0495679_022462 | 3300047446 | Bacteria | 2158 |
| 518 | Ga0495685_003984 | 3300047447 | Bacteria | 4746 |
| 519 | Ga0495685_014028 | 3300047447 | Bacteria | 2719 |
| 520 | Ga0495685_019480 | 3300047447 | Bacteria | 2332 |
| 521 | Ga0495681_0000264 | 3300047470 | Bacteria | 42342 |
| 522 | Ga0495681_0000802 | 3300047470 | Bacteria | 24208 |
| 523 | Ga0495681_0003014 | 3300047470 | Bacteria | 11839 |
| 524 | Ga0495681_0004990 | 3300047470 | Bacteria | 8951 |
| 525 | Ga0495681_0006614 | 3300047470 | Bacteria | 7578 |
| 526 | Ga0495681_0014549 | 3300047470 | Bacteria | 4500 |
| 527 | Ga0495681_0020065 | 3300047470 | Bacteria | 3634 |
| 528 | Ga0495681_0028954 | 3300047470 | Bacteria | 2840 |
| 529 | Ga0495681_0034859 | 3300047470 | Bacteria | 2503 |
| 530 | Ga0495681_0051870 | 3300047470 | Bacteria | 1927 |
| 531 | Ga0495686_0000364 | 3300047472 | Bacteria | 73360 |
| 532 | Ga0495686_0005467 | 3300047472 | Bacteria | 10012 |
| 533 | Ga0495686_0016124 | 3300047472 | Bacteria | 5077 |
| 534 | Ga0495686_0037623 | 3300047472 | Bacteria | 3099 |
| 535 | Ga0495686_0045480 | 3300047472 | Bacteria | 2777 |
| 536 | Ga0495593_0005405 | 3300047673 | Bacteria | 7550 |
| 537 | Ga0495593_0009480 | 3300047673 | Bacteria | 5646 |
| 538 | Ga0495593_0139674 | 3300047673 | Bacteria | 1227 |
| 539 | Ga0495602_0011455 | 3300048088 | Bacteria | 9169 |
| 540 | Ga0495614_0004888 | 3300048089 | Bacteria | 6045 |
| 541 | Ga0495614_0025426 | 3300048089 | Bacteria | 2553 |
| 542 | Ga0495626_0000085 | 3300048091 | Bacteria | 125255 |
| 543 | Ga0495626_0000316 | 3300048091 | Bacteria | 50961 |
| 544 | Ga0495626_0000867 | 3300048091 | Bacteria | 26890 |
| 545 | Ga0495626_0002571 | 3300048091 | Bacteria | 12432 |
| 546 | Ga0495626_0002887 | 3300048091 | Bacteria | 11458 |
| 547 | Ga0495626_0006583 | 3300048091 | Bacteria | 6587 |
| 548 | Ga0495626_0012051 | 3300048091 | Bacteria | 4549 |
| 549 | Ga0495626_0014425 | 3300048091 | Bacteria | 4074 |
| 550 | Ga0495626_0016046 | 3300048091 | Bacteria | 3816 |
| 551 | Ga0495626_0024371 | 3300048091 | Bacteria | 2967 |
| 552 | Ga0495626_0024876 | 3300048091 | Bacteria | 2932 |
| 553 | Ga0495626_0025620 | 3300048091 | Bacteria | 2882 |
| 554 | Ga0495626_0033526 | 3300048091 | Bacteria | 2460 |
| 555 | Ga0495626_0052637 | 3300048091 | Bacteria | 1876 |
| 556 | Ga0495626_0077701 | 3300048091 | Bacteria | 1479 |
| 557 | Ga0496100_0129009 | 3300048903 | Bacteria | 1778 |
| 558 | Ga0496100_0293962 | 3300048903 | Bacteria | 1214 |
| 559 | Ga0496101_0009394 | 3300048904 | Bacteria | 6427 |
| 560 | Ga0496101_0310392 | 3300048904 | Bacteria | 1236 |
| 561 | Ga0496102_0000606 | 3300048905 | Bacteria | 37428 |
| 562 | Ga0496102_0015543 | 3300048905 | Bacteria | 6632 |
| 563 | Ga0496106_0040575 | 3300048909 | Bacteria | 3486 |
| 564 | Ga0496107_0031031 | 3300048910 | Bacteria | 3811 |
| 565 | Ga0496107_0269398 | 3300048910 | Bacteria | 1267 |
| 566 | Ga0496109_0024501 | 3300048912 | Bacteria | 5365 |
| 567 | Ga0496110_0000181 | 3300048913 | Bacteria | 39279 |
| 568 | Ga0496110_0191962 | 3300048913 | Bacteria | 1855 |
| 569 | Ga0496111_0119356 | 3300048914 | Bacteria | 1948 |
| 570 | Ga0496112_0150227 | 3300048915 | Bacteria | 2297 |
| 571 | Ga0496113_0028141 | 3300048916 | Bacteria | 4039 |
| 572 | Ga0496115_0070927 | 3300048918 | Bacteria | 2825 |
| 573 | Ga0496115_0289642 | 3300048918 | Bacteria | 1343 |
| 574 | Ga0496117_0000461 | 3300048920 | Bacteria | 68034 |
| 575 | Ga0496117_0001482 | 3300048920 | Bacteria | 33689 |
| 576 | Ga0496118_0000106 | 3300048921 | Bacteria | 155884 |
| 577 | Ga0496118_0001585 | 3300048921 | Bacteria | 33713 |
| 578 | Ga0496121_0000871 | 3300048924 | Bacteria | 54544 |
| 579 | Ga0496121_0002025 | 3300048924 | Bacteria | 32154 |
| 580 | Ga0496121_0107692 | 3300048924 | Bacteria | 2134 |
| 581 | Ga0496122_0001143 | 3300048925 | Bacteria | 45515 |
| 582 | Ga0496122_0001696 | 3300048925 | Bacteria | 34177 |
| 583 | Ga0496122_0004800 | 3300048925 | Bacteria | 16517 |
| 584 | Ga0496122_0007880 | 3300048925 | Bacteria | 11691 |
| 585 | Ga0496122_0011463 | 3300048925 | Bacteria | 8973 |
| 586 | Ga0496123_0000797 | 3300048926 | Bacteria | 50962 |
| 587 | Ga0496123_0011762 | 3300048926 | Bacteria | 7540 |
| 588 | Ga0496123_0023703 | 3300048926 | Bacteria | 4690 |
| 589 | Ga0496123_0057722 | 3300048926 | Bacteria | 2524 |
| 590 | Ga0496124_0019871 | 3300048927 | Bacteria | 6231 |
| 591 | Ga0496124_0029923 | 3300048927 | Bacteria | 4844 |
| 592 | Ga0496124_0049172 | 3300048927 | Bacteria | 3598 |
| 593 | Ga0496124_0144289 | 3300048927 | Bacteria | 1875 |
| 594 | Ga0496125_0000038 | 3300048928 | Bacteria | 328120 |
| 595 | Ga0496125_0000619 | 3300048928 | Bacteria | 60020 |
| 596 | Ga0496125_0001480 | 3300048928 | Bacteria | 33930 |
| 597 | Ga0496125_0011947 | 3300048928 | Bacteria | 8648 |
| 598 | Ga0496125_0023411 | 3300048928 | Bacteria | 5701 |
| 599 | Ga0496126_0032096 | 3300048929 | Bacteria | 4953 |
| 600 | Ga0495678_000170 | 3300049459 | Bacteria | 75931 |
| 601 | Ga0495678_000482 | 3300049459 | Bacteria | 39648 |
| 602 | Ga0495678_000529 | 3300049459 | Bacteria | 37097 |
| 603 | Ga0495678_000854 | 3300049459 | Bacteria | 27183 |
| 604 | Ga0495678_033993 | 3300049459 | Bacteria | 2101 |
| 605 | Ga0495682_0000907 | 3300049460 | Bacteria | 18135 |
| 606 | Ga0495682_0010748 | 3300049460 | Bacteria | 3535 |
| 607 | Ga0495682_0012489 | 3300049460 | Bacteria | 3255 |
| 608 | Ga0495682_0014536 | 3300049460 | Bacteria | 2984 |
| 609 | Ga0501034_0092032 | 3300049571 | Bacteria | 3030 |
| 610 | Ga0501042_0244802 | 3300049578 | Bacteria | 1294 |
| 611 | Ga0501222_000076 | 3300049662 | Bacteria | 27930 |
| 612 | Ga0501080_0337016 | 3300049742 | Bacteria | 1363 |
| 613 | Ga0501035_0000937 | 3300049822 | Bacteria | 30807 |
| 614 | Ga0501226_000464 | 3300049853 | Bacteria | 5705 |
| 615 | Ga0500616_0021874 | 3300053153 | Bacteria | 3577 |
| 616 | Ga0587083_0001550 | 3300059505 | Bacteria | 2622 |
| 617 | Ga0587068_001715 | 3300059641 | Bacteria | 2525 |
| 618 | Ga0587072_004261 | 3300059643 | Bacteria | 2067 |
| 619 | Ga0466962_0081232 | 3300061719 | Bacteria | 1550 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048091 | Ga0495626_0052637 | Ga0495626_0052637_17_835 | 261 |
| 2 | 3300047320 | Ga0495672_0021462 | Ga0495672_0021462_3370_4197 | 275 |
| 3 | 3300048910 | Ga0496107_0269398 | Ga0496107_0269398_29_907 | 280 |
| 4 | 3300048091 | Ga0495626_0024371 | Ga0495626_0024371_2109_2957 | 282 |
| 5 | 2162886011 | MRS1b_contig_6168241 | MRS1b_0740.00000050 | 305 |
| 6 | 3300046660 | Ga0495625_0119353 | Ga0495625_0119353_18_959 | 313 |
| 7 | iso_pu_bacteria | 2882806704 | 2882807180 | 319 |
| 8 | 3300031727 | Ga0316576_10034599 | Ga0316576_100345993 | 321 |
| 9 | 3300031727 | Ga0316576_10157845 | Ga0316576_101578451 | 321 |
| 10 | 3300031728 | Ga0316578_10125354 | Ga0316578_101253542 | 321 |
| 11 | 3300045051 | Ga0451576_0001042 | Ga0451576_0001042_34937_35947 | 322 |
| 12 | 3300046522 | Ga0495643_0000787 | Ga0495643_0000787_29631_30638 | 322 |
| 13 | 3300046538 | Ga0495609_0130147 | Ga0495609_0130147_57_1067 | 322 |
| 14 | 3300048091 | Ga0495626_0014425 | Ga0495626_0014425_514_1521 | 322 |
| 15 | iso_pu_bacteria | 639633007 | 639788844 | 322 |
| 16 | 3300031731 | Ga0307405_10001329 | Ga0307405_1000132911 | 323 |
| 17 | 3300031911 | Ga0307412_10032428 | Ga0307412_100324283 | 323 |
| 18 | 3300045051 | Ga0451576_0000165 | Ga0451576_0000165_76033_77043 | 323 |
| 19 | 3300049571 | Ga0501034_0092032 | Ga0501034_0092032_1218_2228 | 323 |
| 20 | 3300049578 | Ga0501042_0244802 | Ga0501042_0244802_161_1171 | 323 |
| 21 | iso_pu_bacteria | 2599185169 | 2599412741 | 323 |
| 22 | iso_pu_bacteria | 2600255254 | 2601525759 | 323 |
| 23 | iso_pu_bacteria | 2600255255 | 2601528055 | 323 |
| 24 | iso_pu_bacteria | 2600255280 | 2601614889 | 323 |
| 25 | iso_pu_bacteria | 2600255281 | 2601620186 | 323 |
| 26 | iso_pu_bacteria | 2600255287 | 2601645970 | 323 |
| 27 | iso_pu_bacteria | 2600255288 | 2601648588 | 323 |
| 28 | iso_pu_bacteria | 2600255289 | 2601652944 | 323 |
| 29 | iso_pu_bacteria | 2600255290 | 2601658939 | 323 |
| 30 | iso_pu_bacteria | 2600255291 | 2601666040 | 323 |
| 31 | iso_pu_bacteria | 2600255298 | 2601698927 | 323 |
| 32 | iso_pu_bacteria | 2600255299 | 2601703909 | 323 |
| 33 | iso_pu_bacteria | 2600255300 | 2601705595 | 323 |
| 34 | iso_pu_bacteria | 2600255301 | 2601711184 | 323 |
| 35 | iso_pu_bacteria | 2600255302 | 2601716198 | 323 |
| 36 | iso_pu_bacteria | 2600255303 | 2601723843 | 323 |
| 37 | iso_pu_bacteria | 2600255304 | 2601726604 | 323 |
| 38 | iso_pu_bacteria | 2600255305 | 2601731144 | 323 |
| 39 | iso_pu_bacteria | 2600255306 | 2601736160 | 323 |
| 40 | iso_pu_bacteria | 2600255307 | 2601743511 | 323 |
| 41 | iso_pu_bacteria | 2600255309 | 2601754131 | 323 |
| 42 | iso_pu_bacteria | 2600255392 | 2602021243 | 323 |
| 43 | iso_pu_bacteria | 2602042052 | 2603658904 | 323 |
| 44 | iso_pu_bacteria | 2602042053 | 2603663692 | 323 |
| 45 | iso_pu_bacteria | 2602042103 | 2603838542 | 323 |
| 46 | iso_pu_bacteria | 2602042104 | 2603844204 | 323 |
| 47 | iso_pu_bacteria | 2602042105 | 2603848693 | 323 |
| 48 | iso_pu_bacteria | 2602042106 | 2603853766 | 323 |
| 49 | iso_pu_bacteria | 2602042110 | 2603871818 | 323 |
| 50 | iso_pu_bacteria | 2602042111 | 2603879285 | 323 |
| 51 | iso_pu_bacteria | 2603880178 | 2606049006 | 323 |
| 52 | iso_pu_bacteria | 2603880184 | 2606068118 | 323 |
| 53 | iso_pu_bacteria | 2603880202 | 2606146684 | 323 |
| 54 | iso_pu_bacteria | 2603880211 | 2606176411 | 323 |
| 55 | iso_pu_bacteria | 2643221554 | 2643787250 | 323 |
| 56 | iso_pu_bacteria | 2643221556 | 2643801957 | 323 |
| 57 | iso_pu_bacteria | 2643221638 | 2644215676 | 323 |
| 58 | iso_pu_bacteria | 2643221684 | 2644473890 | 323 |
| 59 | iso_pu_bacteria | 2675903046 | 2676409656 | 323 |
| 60 | iso_pu_bacteria | 2808606418 | 2809145179 | 323 |
| 61 | iso_pu_bacteria | 2857558681 | 2857559825 | 323 |
| 62 | iso_pu_bacteria | 2919476304 | 2919478653 | 323 |
| 63 | iso_pu_bacteria | 2984559226 | 2984563242 | 323 |
| 64 | iso_pu_bacteria | 2984595703 | 2984595978 | 323 |
| 65 | iso_pu_bacteria | 8047673197 | 8047674037 | 323 |
| 66 | 3300005262 | Ga0065165_1000723 | Ga0065165_10007237 | 324 |
| 67 | 3300046471 | Ga0495650_0019540 | Ga0495650_0019540_40_1050 | 324 |
| 68 | 3300005435 | Ga0070714_100151392 | Ga0070714_1001513922 | 325 |
| 69 | 3300025728 | Ga0207655_1016977 | Ga0207655_10169773 | 325 |
| 70 | 3300053153 | Ga0500616_0021874 | Ga0500616_0021874_27_1046 | 325 |
| 71 | 3300049742 | Ga0501080_0337016 | Ga0501080_0337016_60_1040 | 326 |
| 72 | iso_pu_bacteria | 2599185289 | 2599884316 | 326 |
| 73 | iso_pu_bacteria | 2599185291 | 2599896505 | 326 |
| 74 | iso_pu_bacteria | 2599185315 | 2600016114 | 326 |
| 75 | iso_pu_bacteria | 2599185317 | 2600030811 | 326 |
| 76 | iso_pu_bacteria | 2599185321 | 2600051320 | 326 |
| 77 | iso_pu_bacteria | 2600254930 | 2600360616 | 326 |
| 78 | iso_pu_bacteria | 2651869719 | 2652543378 | 326 |
| 79 | iso_pu_bacteria | 2667528170 | 2671089200 | 326 |
| 80 | iso_pu_bacteria | 2675903515 | 2678263300 | 326 |
| 81 | iso_pu_bacteria | 2744054620 | 2745009631 | 326 |
| 82 | iso_pu_bacteria | 2825651385 | 2825652531 | 326 |
| 83 | iso_pu_bacteria | 2842854478 | 2842855295 | 326 |
| 84 | iso_pu_bacteria | 2913036834 | 2913041628 | 326 |
| 85 | iso_pu_bacteria | 2929144301 | 2929146776 | 326 |
| 86 | iso_pu_bacteria | 8056143049 | 8056146566 | 326 |
| 87 | 3300002739 | JGI25158J39367_1000851 | JGI25158J39367_10008514 | 327 |
| 88 | 3300002773 | JGI25152J39213_1013788 | JGI25152J39213_10137882 | 327 |
| 89 | 3300002774 | JGI25150J39212_1000554 | JGI25150J39212_10005549 | 327 |
| 90 | 3300002774 | JGI25150J39212_1000999 | JGI25150J39212_10009994 | 327 |
| 91 | 3300002987 | JGI25159J45721_1003101 | JGI25159J45721_10031013 | 327 |
| 92 | 3300002987 | JGI25159J45721_1005160 | JGI25159J45721_10051602 | 327 |
| 93 | 3300003215 | JGI25153J46596_10013131 | JGI25153J46596_100131312 | 327 |
| 94 | 3300003374 | JGI25161J50226_1000776 | JGI25161J50226_10007769 | 327 |
| 95 | 3300003374 | JGI25161J50226_1008967 | JGI25161J50226_10089671 | 327 |
| 96 | 3300003575 | Ga0007409J51694_1008320 | Ga0007409J51694_10083204 | 327 |
| 97 | 3300003575 | Ga0007409J51694_1008322 | Ga0007409J51694_10083222 | 327 |
| 98 | 3300003759 | Ga0055525_1000001 | Ga0055525_1000001272 | 327 |
| 99 | 3300003771 | Ga0055526_1000198 | Ga0055526_100019823 | 327 |
| 100 | 3300003771 | Ga0055526_1002566 | Ga0055526_10025669 | 327 |
| 101 | 3300003771 | Ga0055526_1003773 | Ga0055526_10037737 | 327 |
| 102 | 3300003773 | Ga0055537_1001803 | Ga0055537_10018032 | 327 |
| 103 | 3300003775 | Ga0055524_1001038 | Ga0055524_100103811 | 327 |
| 104 | 3300003775 | Ga0055524_1002298 | Ga0055524_10022986 | 327 |
| 105 | 3300003775 | Ga0055524_1009932 | Ga0055524_10099325 | 327 |
| 106 | 3300003784 | Ga0055534_1006496 | Ga0055534_10064961 | 327 |
| 107 | 3300003790 | Ga0055528_1011745 | Ga0055528_10117453 | 327 |
| 108 | 3300004625 | Ga0055543_1000777 | Ga0055543_10007776 | 327 |
| 109 | 3300005262 | Ga0065165_1001842 | Ga0065165_10018424 | 327 |
| 110 | 3300005344 | Ga0070661_100024933 | Ga0070661_1000249332 | 327 |
| 111 | 3300005366 | Ga0070659_100036315 | Ga0070659_1000363154 | 327 |
| 112 | 3300005366 | Ga0070659_100102547 | Ga0070659_1001025473 | 327 |
| 113 | 3300005457 | Ga0070662_100233040 | Ga0070662_1002330401 | 327 |
| 114 | 3300005563 | Ga0068855_100034781 | Ga0068855_1000347813 | 327 |
| 115 | 3300005564 | Ga0070664_100232213 | Ga0070664_1002322132 | 327 |
| 116 | 3300006358 | Ga0068871_100334105 | Ga0068871_1003341052 | 327 |
| 117 | 3300006881 | Ga0068865_100104507 | Ga0068865_1001045072 | 327 |
| 118 | 3300009011 | Ga0105251_10055736 | Ga0105251_100557363 | 327 |
| 119 | 3300009036 | Ga0105244_10034780 | Ga0105244_100347803 | 327 |
| 120 | 3300009098 | Ga0105245_10133908 | Ga0105245_101339082 | 327 |
| 121 | 3300009148 | Ga0105243_10050043 | Ga0105243_100500433 | 327 |
| 122 | 3300009174 | Ga0105241_10117288 | Ga0105241_101172882 | 327 |
| 123 | 3300009176 | Ga0105242_10019519 | Ga0105242_100195194 | 327 |
| 124 | 3300010375 | Ga0105239_10483052 | Ga0105239_104830522 | 327 |
| 125 | 3300013296 | Ga0157374_10129932 | Ga0157374_101299322 | 327 |
| 126 | 3300013297 | Ga0157378_10630356 | Ga0157378_106303561 | 327 |
| 127 | 3300025208 | Ga0209436_100243 | Ga0209436_10024310 | 327 |
| 128 | 3300025208 | Ga0209436_100739 | Ga0209436_1007394 | 327 |
| 129 | 3300025230 | Ga0209563_100007 | Ga0209563_100007825 | 327 |
| 130 | 3300025245 | Ga0207425_1000001 | Ga0207425_10000011627 | 327 |
| 131 | 3300025245 | Ga0207425_1000089 | Ga0207425_100008974 | 327 |
| 132 | 3300025253 | Ga0209677_101317 | Ga0209677_1013175 | 327 |
| 133 | 3300025254 | Ga0209148_1000320 | Ga0209148_100032037 | 327 |
| 134 | 3300025258 | Ga0209129_1000001 | Ga0209129_1000001804 | 327 |
| 135 | 3300025258 | Ga0209129_1003360 | Ga0209129_10033606 | 327 |
| 136 | 3300025263 | Ga0209565_1001261 | Ga0209565_100126110 | 327 |
| 137 | 3300025263 | Ga0209565_1002264 | Ga0209565_10022645 | 327 |
| 138 | 3300025273 | Ga0209673_1004003 | Ga0209673_10040033 | 327 |
| 139 | 3300025284 | Ga0209130_1000407 | Ga0209130_100040710 | 327 |
| 140 | 3300025284 | Ga0209130_1000994 | Ga0209130_10009948 | 327 |
| 141 | 3300025284 | Ga0209130_1001239 | Ga0209130_10012398 | 327 |
| 142 | 3300025291 | Ga0209675_1001997 | Ga0209675_10019979 | 327 |
| 143 | 3300025291 | Ga0209675_1006810 | Ga0209675_10068102 | 327 |
| 144 | 3300025295 | Ga0209564_1000009 | Ga0209564_1000009451 | 327 |
| 145 | 3300025295 | Ga0209564_1000178 | Ga0209564_1000178122 | 327 |
| 146 | 3300025295 | Ga0209564_1009436 | Ga0209564_10094362 | 327 |
| 147 | 3300025297 | Ga0209758_1000116 | Ga0209758_100011665 | 327 |
| 148 | 3300025298 | Ga0209050_1000480 | Ga0209050_100048010 | 327 |
| 149 | 3300025298 | Ga0209050_1024807 | Ga0209050_10248073 | 327 |
| 150 | 3300025299 | Ga0209256_1000297 | Ga0209256_100029768 | 327 |
| 151 | 3300025299 | Ga0209256_1000515 | Ga0209256_100051516 | 327 |
| 152 | 3300025299 | Ga0209256_1000635 | Ga0209256_100063510 | 327 |
| 153 | 3300025302 | Ga0207426_1002747 | Ga0207426_10027474 | 327 |
| 154 | 3300025303 | Ga0209051_1016724 | Ga0209051_10167242 | 327 |
| 155 | 3300025304 | Ga0209257_1000293 | Ga0209257_100029371 | 327 |
| 156 | 3300025909 | Ga0207705_10356400 | Ga0207705_103564001 | 327 |
| 157 | 3300025911 | Ga0207654_10023215 | Ga0207654_100232154 | 327 |
| 158 | 3300025919 | Ga0207657_10026879 | Ga0207657_100268796 | 327 |
| 159 | 3300025927 | Ga0207687_10260619 | Ga0207687_102606191 | 327 |
| 160 | 3300025932 | Ga0207690_10131622 | Ga0207690_101316222 | 327 |
| 161 | 3300025933 | Ga0207706_10035699 | Ga0207706_100356995 | 327 |
| 162 | 3300025934 | Ga0207686_10002105 | Ga0207686_100021056 | 327 |
| 163 | 3300025935 | Ga0207709_10039221 | Ga0207709_100392213 | 327 |
| 164 | 3300025949 | Ga0207667_10010303 | Ga0207667_1001030312 | 327 |
| 165 | 3300027312 | Ga0209371_1000477 | Ga0209371_100047728 | 327 |
| 166 | 3300030500 | Ga0268256_1000405 | Ga0268256_100040528 | 327 |
| 167 | 3300031548 | Ga0307408_100000098 | Ga0307408_10000009815 | 327 |
| 168 | 3300031548 | Ga0307408_100000870 | Ga0307408_10000087014 | 327 |
| 169 | 3300031548 | Ga0307408_100224212 | Ga0307408_1002242122 | 327 |
| 170 | 3300037312 | Ga0395899_0012567 | Ga0395899_0012567_4250_5275 | 327 |
| 171 | 3300037312 | Ga0395899_0016298 | Ga0395899_0016298_2705_3763 | 327 |
| 172 | 3300037312 | Ga0395899_0047842 | Ga0395899_0047842_86_1111 | 327 |
| 173 | 3300037312 | Ga0395899_0159332 | Ga0395899_0159332_399_1424 | 327 |
| 174 | 3300037418 | Ga0395900_0001489 | Ga0395900_0001489_3861_4886 | 327 |
| 175 | 3300037418 | Ga0395900_0047209 | Ga0395900_0047209_1238_2263 | 327 |
| 176 | 3300037418 | Ga0395900_0050199 | Ga0395900_0050199_215_1240 | 327 |
| 177 | 3300037418 | Ga0395900_0226854 | Ga0395900_0226854_134_1159 | 327 |
| 178 | 3300037418 | Ga0395900_0413072 | Ga0395900_0413072_239_1264 | 327 |
| 179 | 3300037466 | Ga0395898_0007100 | Ga0395898_0007100_8243_9268 | 327 |
| 180 | 3300037466 | Ga0395898_0099288 | Ga0395898_0099288_1093_2118 | 327 |
| 181 | 3300037471 | Ga0395905_0079517 | Ga0395905_0079517_1975_3000 | 327 |
| 182 | 3300037471 | Ga0395905_0082558 | Ga0395905_0082558_264_1289 | 327 |
| 183 | 3300037471 | Ga0395905_0178494 | Ga0395905_0178494_484_1509 | 327 |
| 184 | 3300037471 | Ga0395905_0350813 | Ga0395905_0350813_146_1171 | 327 |
| 185 | 3300038443 | Ga0395901_0000491 | Ga0395901_0000491_3997_5022 | 327 |
| 186 | 3300038443 | Ga0395901_0010628 | Ga0395901_0010628_7452_8477 | 327 |
| 187 | 3300038443 | Ga0395901_0039708 | Ga0395901_0039708_2434_3459 | 327 |
| 188 | 3300038443 | Ga0395901_0106989 | Ga0395901_0106989_727_1752 | 327 |
| 189 | 3300038443 | Ga0395901_0113204 | Ga0395901_0113204_1554_2612 | 327 |
| 190 | 3300042005 | Ga0439448_0039649 | Ga0439448_0039649_229_1254 | 327 |
| 191 | 3300042012 | Ga0439455_0016756 | Ga0439455_0016756_219_1238 | 327 |
| 192 | 3300042157 | Ga0439458_0018071 | Ga0439458_0018071_526_1551 | 327 |
| 193 | 3300044658 | Ga0466972_0044681 | Ga0466972_0044681_133_1191 | 327 |
| 194 | 3300044658 | Ga0466972_0080880 | Ga0466972_0080880_471_1496 | 327 |
| 195 | 3300044658 | Ga0466972_0103530 | Ga0466972_0103530_193_1218 | 327 |
| 196 | 3300044683 | Ga0466965_0005810 | Ga0466965_0005810_840_1865 | 327 |
| 197 | 3300044684 | Ga0466966_0005398 | Ga0466966_0005398_1138_2163 | 327 |
| 198 | 3300044684 | Ga0466966_0021850 | Ga0466966_0021850_3093_4118 | 327 |
| 199 | 3300044693 | Ga0466961_0108168 | Ga0466961_0108168_90_1148 | 327 |
| 200 | 3300044706 | Ga0466964_0002326 | Ga0466964_0002326_4055_5080 | 327 |
| 201 | 3300044706 | Ga0466964_0003695 | Ga0466964_0003695_510_1535 | 327 |
| 202 | 3300044706 | Ga0466964_0047805 | Ga0466964_0047805_58_1083 | 327 |
| 203 | 3300044735 | Ga0466968_0007634 | Ga0466968_0007634_608_1633 | 327 |
| 204 | 3300044842 | Ga0466957_0000089 | Ga0466957_0000089_32786_33811 | 327 |
| 205 | 3300044842 | Ga0466957_0002847 | Ga0466957_0002847_7348_8373 | 327 |
| 206 | 3300044842 | Ga0466957_0100190 | Ga0466957_0100190_228_1253 | 327 |
| 207 | 3300045049 | Ga0466959_0199835 | Ga0466959_0199835_44_1069 | 327 |
| 208 | 3300045836 | Ga0466958_0070545 | Ga0466958_0070545_812_1837 | 327 |
| 209 | 3300045836 | Ga0466958_0157524 | Ga0466958_0157524_288_1313 | 327 |
| 210 | 3300045976 | Ga0466967_0028783 | Ga0466967_0028783_1029_2054 | 327 |
| 211 | 3300045976 | Ga0466967_0077670 | Ga0466967_0077670_682_1707 | 327 |
| 212 | 3300046452 | Ga0495617_000070 | Ga0495617_000070_26798_27865 | 327 |
| 213 | 3300046452 | Ga0495617_011150 | Ga0495617_011150_563_1588 | 327 |
| 214 | 3300046453 | Ga0495627_000201 | Ga0495627_000201_58104_59171 | 327 |
| 215 | 3300046453 | Ga0495627_002489 | Ga0495627_002489_2135_3160 | 327 |
| 216 | 3300046455 | Ga0495603_0011297 | Ga0495603_0011297_3557_4582 | 327 |
| 217 | 3300046457 | Ga0495590_0000060 | Ga0495590_0000060_68276_69319 | 327 |
| 218 | 3300046457 | Ga0495590_0003557 | Ga0495590_0003557_5193_6224 | 327 |
| 219 | 3300046458 | Ga0495591_000190 | Ga0495591_000190_17210_18253 | 327 |
| 220 | 3300046460 | Ga0495638_0002326 | Ga0495638_0002326_8357_9418 | 327 |
| 221 | 3300046460 | Ga0495638_0049512 | Ga0495638_0049512_1029_2060 | 327 |
| 222 | 3300046471 | Ga0495650_0000611 | Ga0495650_0000611_3946_4971 | 327 |
| 223 | 3300046473 | Ga0495582_0084025 | Ga0495582_0084025_549_1574 | 327 |
| 224 | 3300046474 | Ga0495605_0000154 | Ga0495605_0000154_23298_24323 | 327 |
| 225 | 3300046474 | Ga0495605_0000161 | Ga0495605_0000161_26607_27674 | 327 |
| 226 | 3300046474 | Ga0495605_0000967 | Ga0495605_0000967_408_1439 | 327 |
| 227 | 3300046474 | Ga0495605_0001972 | Ga0495605_0001972_9306_10289 | 327 |
| 228 | 3300046474 | Ga0495605_0005317 | Ga0495605_0005317_5710_6735 | 327 |
| 229 | 3300046474 | Ga0495605_0005436 | Ga0495605_0005436_252_1271 | 327 |
| 230 | 3300046474 | Ga0495605_0019147 | Ga0495605_0019147_2264_3289 | 327 |
| 231 | 3300046474 | Ga0495605_0026472 | Ga0495605_0026472_1487_2530 | 327 |
| 232 | 3300046474 | Ga0495605_0065042 | Ga0495605_0065042_157_1218 | 327 |
| 233 | 3300046491 | Ga0495584_0000059 | Ga0495584_0000059_9708_10733 | 327 |
| 234 | 3300046491 | Ga0495584_0000275 | Ga0495584_0000275_4118_5161 | 327 |
| 235 | 3300046491 | Ga0495584_0000639 | Ga0495584_0000639_17599_18582 | 327 |
| 236 | 3300046491 | Ga0495584_0001361 | Ga0495584_0001361_10114_11139 | 327 |
| 237 | 3300046491 | Ga0495584_0001892 | Ga0495584_0001892_3576_4601 | 327 |
| 238 | 3300046491 | Ga0495584_0009418 | Ga0495584_0009418_2447_3466 | 327 |
| 239 | 3300046491 | Ga0495584_0082188 | Ga0495584_0082188_359_1420 | 327 |
| 240 | 3300046492 | Ga0495585_0000084 | Ga0495585_0000084_87290_88315 | 327 |
| 241 | 3300046492 | Ga0495585_0000122 | Ga0495585_0000122_32237_33262 | 327 |
| 242 | 3300046492 | Ga0495585_0000215 | Ga0495585_0000215_51087_52112 | 327 |
| 243 | 3300046492 | Ga0495585_0000522 | Ga0495585_0000522_10144_11169 | 327 |
| 244 | 3300046492 | Ga0495585_0003664 | Ga0495585_0003664_5198_6235 | 327 |
| 245 | 3300046492 | Ga0495585_0003757 | Ga0495585_0003757_4523_5548 | 327 |
| 246 | 3300046492 | Ga0495585_0007654 | Ga0495585_0007654_3111_4154 | 327 |
| 247 | 3300046492 | Ga0495585_0010373 | Ga0495585_0010373_2810_3829 | 327 |
| 248 | 3300046492 | Ga0495585_0074123 | Ga0495585_0074123_511_1536 | 327 |
| 249 | 3300046499 | Ga0495594_0000361 | Ga0495594_0000361_4758_5783 | 327 |
| 250 | 3300046500 | Ga0495596_0000100 | Ga0495596_0000100_8129_9190 | 327 |
| 251 | 3300046500 | Ga0495596_0003842 | Ga0495596_0003842_2606_3673 | 327 |
| 252 | 3300046500 | Ga0495596_0007852 | Ga0495596_0007852_1324_2343 | 327 |
| 253 | 3300046500 | Ga0495596_0007913 | Ga0495596_0007913_415_1440 | 327 |
| 254 | 3300046500 | Ga0495596_0008970 | Ga0495596_0008970_1347_2384 | 327 |
| 255 | 3300046500 | Ga0495596_0011671 | Ga0495596_0011671_230_1255 | 327 |
| 256 | 3300046500 | Ga0495596_0029930 | Ga0495596_0029930_1110_2147 | 327 |
| 257 | 3300046500 | Ga0495596_0033483 | Ga0495596_0033483_374_1393 | 327 |
| 258 | 3300046500 | Ga0495596_0096394 | Ga0495596_0096394_31_1056 | 327 |
| 259 | 3300046501 | Ga0495607_0000025 | Ga0495607_0000025_60414_61397 | 327 |
| 260 | 3300046501 | Ga0495607_0000619 | Ga0495607_0000619_31059_32084 | 327 |
| 261 | 3300046501 | Ga0495607_0003541 | Ga0495607_0003541_6348_7391 | 327 |
| 262 | 3300046501 | Ga0495607_0004523 | Ga0495607_0004523_2208_3275 | 327 |
| 263 | 3300046501 | Ga0495607_0007434 | Ga0495607_0007434_6185_7207 | 327 |
| 264 | 3300046501 | Ga0495607_0011264 | Ga0495607_0011264_2623_3648 | 327 |
| 265 | 3300046501 | Ga0495607_0042797 | Ga0495607_0042797_623_1684 | 327 |
| 266 | 3300046501 | Ga0495607_0056839 | Ga0495607_0056839_553_1572 | 327 |
| 267 | 3300046501 | Ga0495607_0064116 | Ga0495607_0064116_959_1978 | 327 |
| 268 | 3300046506 | Ga0495583_0000230 | Ga0495583_0000230_24474_25499 | 327 |
| 269 | 3300046506 | Ga0495583_0000754 | Ga0495583_0000754_4065_5084 | 327 |
| 270 | 3300046506 | Ga0495583_0000791 | Ga0495583_0000791_4159_5202 | 327 |
| 271 | 3300046506 | Ga0495583_0004131 | Ga0495583_0004131_7180_8217 | 327 |
| 272 | 3300046506 | Ga0495583_0014243 | Ga0495583_0014243_2424_3443 | 327 |
| 273 | 3300046506 | Ga0495583_0019079 | Ga0495583_0019079_2551_3570 | 327 |
| 274 | 3300046506 | Ga0495583_0021077 | Ga0495583_0021077_2026_3051 | 327 |
| 275 | 3300046506 | Ga0495583_0068847 | Ga0495583_0068847_140_1201 | 327 |
| 276 | 3300046507 | Ga0495606_0001284 | Ga0495606_0001284_15422_16405 | 327 |
| 277 | 3300046507 | Ga0495606_0011259 | Ga0495606_0011259_135_1160 | 327 |
| 278 | 3300046507 | Ga0495606_0013503 | Ga0495606_0013503_4251_5276 | 327 |
| 279 | 3300046507 | Ga0495606_0039492 | Ga0495606_0039492_1468_2529 | 327 |
| 280 | 3300046507 | Ga0495606_0073990 | Ga0495606_0073990_355_1374 | 327 |
| 281 | 3300046512 | Ga0495610_0005183 | Ga0495610_0005183_414_1457 | 327 |
| 282 | 3300046513 | Ga0495616_0000406 | Ga0495616_0000406_31955_32980 | 327 |
| 283 | 3300046513 | Ga0495616_0001911 | Ga0495616_0001911_3615_4640 | 327 |
| 284 | 3300046513 | Ga0495616_0002040 | Ga0495616_0002040_2869_3894 | 327 |
| 285 | 3300046513 | Ga0495616_0004109 | Ga0495616_0004109_5964_6989 | 327 |
| 286 | 3300046513 | Ga0495616_0004378 | Ga0495616_0004378_1695_2714 | 327 |
| 287 | 3300046513 | Ga0495616_0010810 | Ga0495616_0010810_3482_4507 | 327 |
| 288 | 3300046513 | Ga0495616_0011460 | Ga0495616_0011460_830_1849 | 327 |
| 289 | 3300046513 | Ga0495616_0012458 | Ga0495616_0012458_3398_4417 | 327 |
| 290 | 3300046513 | Ga0495616_0023840 | Ga0495616_0023840_1710_2729 | 327 |
| 291 | 3300046513 | Ga0495616_0024473 | Ga0495616_0024473_1939_2982 | 327 |
| 292 | 3300046513 | Ga0495616_0054111 | Ga0495616_0054111_563_1546 | 327 |
| 293 | 3300046513 | Ga0495616_0100288 | Ga0495616_0100288_31_1053 | 327 |
| 294 | 3300046513 | Ga0495616_0122043 | Ga0495616_0122043_95_1120 | 327 |
| 295 | 3300046518 | Ga0495631_0000319 | Ga0495631_0000319_2558_3577 | 327 |
| 296 | 3300046518 | Ga0495631_0002882 | Ga0495631_0002882_678_1697 | 327 |
| 297 | 3300046518 | Ga0495631_0006761 | Ga0495631_0006761_4318_5361 | 327 |
| 298 | 3300046518 | Ga0495631_0010660 | Ga0495631_0010660_2858_3895 | 327 |
| 299 | 3300046518 | Ga0495631_0019499 | Ga0495631_0019499_279_1304 | 327 |
| 300 | 3300046518 | Ga0495631_0020913 | Ga0495631_0020913_470_1495 | 327 |
| 301 | 3300046518 | Ga0495631_0033086 | Ga0495631_0033086_1047_2114 | 327 |
| 302 | 3300046518 | Ga0495631_0043374 | Ga0495631_0043374_135_1196 | 327 |
| 303 | 3300046519 | Ga0495632_0000147 | Ga0495632_0000147_65763_66815 | 327 |
| 304 | 3300046519 | Ga0495632_0000451 | Ga0495632_0000451_3734_4771 | 327 |
| 305 | 3300046519 | Ga0495632_0000514 | Ga0495632_0000514_3524_4549 | 327 |
| 306 | 3300046519 | Ga0495632_0001898 | Ga0495632_0001898_11300_12322 | 327 |
| 307 | 3300046519 | Ga0495632_0002919 | Ga0495632_0002919_7429_8448 | 327 |
| 308 | 3300046519 | Ga0495632_0013819 | Ga0495632_0013819_1652_2713 | 327 |
| 309 | 3300046519 | Ga0495632_0041398 | Ga0495632_0041398_1206_2231 | 327 |
| 310 | 3300046519 | Ga0495632_0076418 | Ga0495632_0076418_414_1457 | 327 |
| 311 | 3300046519 | Ga0495632_0110609 | Ga0495632_0110609_128_1147 | 327 |
| 312 | 3300046520 | Ga0495637_0000004 | Ga0495637_0000004_335894_336937 | 327 |
| 313 | 3300046522 | Ga0495643_0001650 | Ga0495643_0001650_10862_11887 | 327 |
| 314 | 3300046522 | Ga0495643_0010199 | Ga0495643_0010199_1932_2963 | 327 |
| 315 | 3300046522 | Ga0495643_0021153 | Ga0495643_0021153_2011_3030 | 327 |
| 316 | 3300046522 | Ga0495643_0077403 | Ga0495643_0077403_579_1604 | 327 |
| 317 | 3300046523 | Ga0495644_0003474 | Ga0495644_0003474_5006_6031 | 327 |
| 318 | 3300046523 | Ga0495644_0013743 | Ga0495644_0013743_580_1599 | 327 |
| 319 | 3300046523 | Ga0495644_0014908 | Ga0495644_0014908_1480_2499 | 327 |
| 320 | 3300046523 | Ga0495644_0037233 | Ga0495644_0037233_397_1440 | 327 |
| 321 | 3300046523 | Ga0495644_0060588 | Ga0495644_0060588_257_1276 | 327 |
| 322 | 3300046524 | Ga0495648_0000118 | Ga0495648_0000118_64275_65300 | 327 |
| 323 | 3300046524 | Ga0495648_0002143 | Ga0495648_0002143_13652_14677 | 327 |
| 324 | 3300046524 | Ga0495648_0003243 | Ga0495648_0003243_9226_10245 | 327 |
| 325 | 3300046524 | Ga0495648_0006869 | Ga0495648_0006869_4708_5775 | 327 |
| 326 | 3300046524 | Ga0495648_0042560 | Ga0495648_0042560_763_1782 | 327 |
| 327 | 3300046524 | Ga0495648_0049850 | Ga0495648_0049850_1169_2194 | 327 |
| 328 | 3300046524 | Ga0495648_0104202 | Ga0495648_0104202_447_1472 | 327 |
| 329 | 3300046528 | Ga0495642_0000060 | Ga0495642_0000060_59009_60076 | 327 |
| 330 | 3300046528 | Ga0495642_0000648 | Ga0495642_0000648_12554_13579 | 327 |
| 331 | 3300046528 | Ga0495642_0002840 | Ga0495642_0002840_4774_5817 | 327 |
| 332 | 3300046528 | Ga0495642_0003712 | Ga0495642_0003712_4012_5037 | 327 |
| 333 | 3300046528 | Ga0495642_0004279 | Ga0495642_0004279_2467_3528 | 327 |
| 334 | 3300046528 | Ga0495642_0018163 | Ga0495642_0018163_699_1724 | 327 |
| 335 | 3300046530 | Ga0495654_0023159 | Ga0495654_0023159_1348_2373 | 327 |
| 336 | 3300046530 | Ga0495654_0028871 | Ga0495654_0028871_1585_2652 | 327 |
| 337 | 3300046530 | Ga0495654_0032648 | Ga0495654_0032648_493_1518 | 327 |
| 338 | 3300046530 | Ga0495654_0089741 | Ga0495654_0089741_376_1395 | 327 |
| 339 | 3300046536 | Ga0495587_0050978 | Ga0495587_0050978_913_1938 | 327 |
| 340 | 3300046538 | Ga0495609_0000059 | Ga0495609_0000059_31620_32645 | 327 |
| 341 | 3300046538 | Ga0495609_0000987 | Ga0495609_0000987_15191_16216 | 327 |
| 342 | 3300046538 | Ga0495609_0007272 | Ga0495609_0007272_1552_2577 | 327 |
| 343 | 3300046538 | Ga0495609_0009818 | Ga0495609_0009818_1525_2544 | 327 |
| 344 | 3300046538 | Ga0495609_0012095 | Ga0495609_0012095_2648_3670 | 327 |
| 345 | 3300046538 | Ga0495609_0034283 | Ga0495609_0034283_202_1263 | 327 |
| 346 | 3300046538 | Ga0495609_0041149 | Ga0495609_0041149_224_1249 | 327 |
| 347 | 3300046538 | Ga0495609_0092209 | Ga0495609_0092209_144_1187 | 327 |
| 348 | 3300046542 | Ga0495597_0000274 | Ga0495597_0000274_22081_23100 | 327 |
| 349 | 3300046542 | Ga0495597_0000554 | Ga0495597_0000554_4159_5196 | 327 |
| 350 | 3300046542 | Ga0495597_0002485 | Ga0495597_0002485_5323_6360 | 327 |
| 351 | 3300046542 | Ga0495597_0003899 | Ga0495597_0003899_932_1957 | 327 |
| 352 | 3300046542 | Ga0495597_0013281 | Ga0495597_0013281_2489_3520 | 327 |
| 353 | 3300046542 | Ga0495597_0051840 | Ga0495597_0051840_562_1581 | 327 |
| 354 | 3300046543 | Ga0495645_0122449 | Ga0495645_0122449_568_1593 | 327 |
| 355 | 3300046543 | Ga0495645_0227224 | Ga0495645_0227224_93_1118 | 327 |
| 356 | 3300046557 | Ga0495622_0025367 | Ga0495622_0025367_1033_2100 | 327 |
| 357 | 3300046558 | Ga0495633_0002512 | Ga0495633_0002512_5199_6242 | 327 |
| 358 | 3300046558 | Ga0495633_0003520 | Ga0495633_0003520_5411_6436 | 327 |
| 359 | 3300046558 | Ga0495633_0004820 | Ga0495633_0004820_2673_3695 | 327 |
| 360 | 3300046558 | Ga0495633_0007858 | Ga0495633_0007858_2168_3193 | 327 |
| 361 | 3300046558 | Ga0495633_0008942 | Ga0495633_0008942_809_1834 | 327 |
| 362 | 3300046558 | Ga0495633_0011043 | Ga0495633_0011043_775_1800 | 327 |
| 363 | 3300046558 | Ga0495633_0022885 | Ga0495633_0022885_276_1313 | 327 |
| 364 | 3300046558 | Ga0495633_0053585 | Ga0495633_0053585_349_1374 | 327 |
| 365 | 3300046558 | Ga0495633_0092277 | Ga0495633_0092277_286_1311 | 327 |
| 366 | 3300046558 | Ga0495633_0100057 | Ga0495633_0100057_160_1179 | 327 |
| 367 | 3300046615 | Ga0495656_0006196 | Ga0495656_0006196_1998_3065 | 327 |
| 368 | 3300046615 | Ga0495656_0038285 | Ga0495656_0038285_119_1144 | 327 |
| 369 | 3300046616 | Ga0495668_0000682 | Ga0495668_0000682_36643_37710 | 327 |
| 370 | 3300046616 | Ga0495668_0001339 | Ga0495668_0001339_22152_23177 | 327 |
| 371 | 3300046616 | Ga0495668_0001688 | Ga0495668_0001688_3175_4206 | 327 |
| 372 | 3300046616 | Ga0495668_0002654 | Ga0495668_0002654_11766_12791 | 327 |
| 373 | 3300046616 | Ga0495668_0007057 | Ga0495668_0007057_486_1511 | 327 |
| 374 | 3300046616 | Ga0495668_0009569 | Ga0495668_0009569_2120_3163 | 327 |
| 375 | 3300046616 | Ga0495668_0013029 | Ga0495668_0013029_1816_2841 | 327 |
| 376 | 3300046616 | Ga0495668_0047226 | Ga0495668_0047226_359_1420 | 327 |
| 377 | 3300046616 | Ga0495668_0055215 | Ga0495668_0055215_302_1321 | 327 |
| 378 | 3300046648 | Ga0495611_0000328 | Ga0495611_0000328_4076_5119 | 327 |
| 379 | 3300046648 | Ga0495611_0001420 | Ga0495611_0001420_4452_5489 | 327 |
| 380 | 3300046648 | Ga0495611_0004896 | Ga0495611_0004896_1903_2922 | 327 |
| 381 | 3300046648 | Ga0495611_0047884 | Ga0495611_0047884_18_1043 | 327 |
| 382 | 3300046648 | Ga0495611_0051924 | Ga0495611_0051924_687_1748 | 327 |
| 383 | 3300046660 | Ga0495625_0022206 | Ga0495625_0022206_2733_3764 | 327 |
| 384 | 3300046660 | Ga0495625_0074242 | Ga0495625_0074242_546_1607 | 327 |
| 385 | 3300046665 | Ga0495661_0000259 | Ga0495661_0000259_23606_24631 | 327 |
| 386 | 3300046665 | Ga0495661_0000647 | Ga0495661_0000647_3676_4701 | 327 |
| 387 | 3300046665 | Ga0495661_0001779 | Ga0495661_0001779_2309_3334 | 327 |
| 388 | 3300046665 | Ga0495661_0003205 | Ga0495661_0003205_4485_5552 | 327 |
| 389 | 3300046665 | Ga0495661_0003234 | Ga0495661_0003234_7459_8481 | 327 |
| 390 | 3300046665 | Ga0495661_0004153 | Ga0495661_0004153_5255_6280 | 327 |
| 391 | 3300046665 | Ga0495661_0011989 | Ga0495661_0011989_4061_5104 | 327 |
| 392 | 3300046665 | Ga0495661_0025013 | Ga0495661_0025013_1239_2264 | 327 |
| 393 | 3300046665 | Ga0495661_0025858 | Ga0495661_0025858_2532_3557 | 327 |
| 394 | 3300046665 | Ga0495661_0033720 | Ga0495661_0033720_481_1506 | 327 |
| 395 | 3300046665 | Ga0495661_0034226 | Ga0495661_0034226_99_1118 | 327 |
| 396 | 3300046665 | Ga0495661_0037314 | Ga0495661_0037314_411_1430 | 327 |
| 397 | 3300046665 | Ga0495661_0068561 | Ga0495661_0068561_254_1279 | 327 |
| 398 | 3300046674 | Ga0495588_0000137 | Ga0495588_0000137_34884_35909 | 327 |
| 399 | 3300046674 | Ga0495588_0015420 | Ga0495588_0015420_1667_2692 | 327 |
| 400 | 3300046674 | Ga0495588_0042623 | Ga0495588_0042623_718_1737 | 327 |
| 401 | 3300046674 | Ga0495588_0056454 | Ga0495588_0056454_442_1509 | 327 |
| 402 | 3300046680 | Ga0495646_0170156 | Ga0495646_0170156_110_1135 | 327 |
| 403 | 3300046684 | Ga0495669_0000516 | Ga0495669_0000516_16295_17320 | 327 |
| 404 | 3300046684 | Ga0495669_0001191 | Ga0495669_0001191_5734_6771 | 327 |
| 405 | 3300046684 | Ga0495669_0021706 | Ga0495669_0021706_387_1412 | 327 |
| 406 | 3300046684 | Ga0495669_0034181 | Ga0495669_0034181_331_1350 | 327 |
| 407 | 3300046684 | Ga0495669_0039512 | Ga0495669_0039512_202_1269 | 327 |
| 408 | 3300046691 | Ga0495670_0001524 | Ga0495670_0001524_6270_7295 | 327 |
| 409 | 3300046691 | Ga0495670_0002554 | Ga0495670_0002554_4629_5654 | 327 |
| 410 | 3300046691 | Ga0495670_0011218 | Ga0495670_0011218_1557_2582 | 327 |
| 411 | 3300046691 | Ga0495670_0019668 | Ga0495670_0019668_1635_2654 | 327 |
| 412 | 3300046691 | Ga0495670_0022759 | Ga0495670_0022759_616_1653 | 327 |
| 413 | 3300046691 | Ga0495670_0023486 | Ga0495670_0023486_735_1760 | 327 |
| 414 | 3300046692 | Ga0495671_0000275 | Ga0495671_0000275_38218_39285 | 327 |
| 415 | 3300046692 | Ga0495671_0013692 | Ga0495671_0013692_2456_3493 | 327 |
| 416 | 3300046692 | Ga0495671_0016774 | Ga0495671_0016774_1858_2889 | 327 |
| 417 | 3300046694 | Ga0495649_0000122 | Ga0495649_0000122_4075_5118 | 327 |
| 418 | 3300046694 | Ga0495649_0004107 | Ga0495649_0004107_5455_6486 | 327 |
| 419 | 3300046694 | Ga0495649_0009673 | Ga0495649_0009673_2388_3413 | 327 |
| 420 | 3300046694 | Ga0495649_0016860 | Ga0495649_0016860_1101_2138 | 327 |
| 421 | 3300046694 | Ga0495649_0027927 | Ga0495649_0027927_757_1740 | 327 |
| 422 | 3300046694 | Ga0495649_0053090 | Ga0495649_0053090_1028_2047 | 327 |
| 423 | 3300046694 | Ga0495649_0078715 | Ga0495649_0078715_315_1346 | 327 |
| 424 | 3300046794 | Ga0495589_0000052 | Ga0495589_0000052_102822_103847 | 327 |
| 425 | 3300046794 | Ga0495589_0000185 | Ga0495589_0000185_46143_47168 | 327 |
| 426 | 3300046794 | Ga0495589_0001210 | Ga0495589_0001210_11830_12849 | 327 |
| 427 | 3300046794 | Ga0495589_0002207 | Ga0495589_0002207_3701_4768 | 327 |
| 428 | 3300046794 | Ga0495589_0006148 | Ga0495589_0006148_3467_4486 | 327 |
| 429 | 3300046794 | Ga0495589_0012254 | Ga0495589_0012254_2278_3303 | 327 |
| 430 | 3300046794 | Ga0495589_0016225 | Ga0495589_0016225_2481_3506 | 327 |
| 431 | 3300046794 | Ga0495589_0020361 | Ga0495589_0020361_1734_2777 | 327 |
| 432 | 3300046794 | Ga0495589_0029142 | Ga0495589_0029142_703_1764 | 327 |
| 433 | 3300046794 | Ga0495589_0043304 | Ga0495589_0043304_1187_2212 | 327 |
| 434 | 3300046810 | Ga0495660_0000154 | Ga0495660_0000154_64673_65698 | 327 |
| 435 | 3300046810 | Ga0495660_0005463 | Ga0495660_0005463_3959_4996 | 327 |
| 436 | 3300046810 | Ga0495660_0006813 | Ga0495660_0006813_2284_3327 | 327 |
| 437 | 3300046810 | Ga0495660_0007198 | Ga0495660_0007198_110_1147 | 327 |
| 438 | 3300046810 | Ga0495660_0008450 | Ga0495660_0008450_1171_2190 | 327 |
| 439 | 3300046810 | Ga0495660_0010475 | Ga0495660_0010475_3954_4973 | 327 |
| 440 | 3300047320 | Ga0495672_0000237 | Ga0495672_0000237_49928_50971 | 327 |
| 441 | 3300047320 | Ga0495672_0000579 | Ga0495672_0000579_3843_4868 | 327 |
| 442 | 3300047320 | Ga0495672_0000603 | Ga0495672_0000603_4808_5833 | 327 |
| 443 | 3300047320 | Ga0495672_0002539 | Ga0495672_0002539_12193_13218 | 327 |
| 444 | 3300047320 | Ga0495672_0050383 | Ga0495672_0050383_1229_2254 | 327 |
| 445 | 3300047320 | Ga0495672_0099608 | Ga0495672_0099608_476_1495 | 327 |
| 446 | 3300047323 | Ga0495683_0000079 | Ga0495683_0000079_41971_42996 | 327 |
| 447 | 3300047323 | Ga0495683_0000296 | Ga0495683_0000296_34412_35455 | 327 |
| 448 | 3300047323 | Ga0495683_0006650 | Ga0495683_0006650_4936_5997 | 327 |
| 449 | 3300047323 | Ga0495683_0014047 | Ga0495683_0014047_2482_3501 | 327 |
| 450 | 3300047323 | Ga0495683_0017410 | Ga0495683_0017410_882_1907 | 327 |
| 451 | 3300047323 | Ga0495683_0055516 | Ga0495683_0055516_864_1883 | 327 |
| 452 | 3300047323 | Ga0495683_0067172 | Ga0495683_0067172_580_1599 | 327 |
| 453 | 3300047443 | Ga0495687_000087 | Ga0495687_000087_109759_110784 | 327 |
| 454 | 3300047443 | Ga0495687_000226 | Ga0495687_000226_3695_4720 | 327 |
| 455 | 3300047443 | Ga0495687_000263 | Ga0495687_000263_65860_66885 | 327 |
| 456 | 3300047443 | Ga0495687_000275 | Ga0495687_000275_26853_27878 | 327 |
| 457 | 3300047443 | Ga0495687_000695 | Ga0495687_000695_20627_21646 | 327 |
| 458 | 3300047443 | Ga0495687_000831 | Ga0495687_000831_3242_4279 | 327 |
| 459 | 3300047445 | Ga0495677_0000033 | Ga0495677_0000033_51332_52357 | 327 |
| 460 | 3300047445 | Ga0495677_0000359 | Ga0495677_0000359_12338_13381 | 327 |
| 461 | 3300047445 | Ga0495677_0000747 | Ga0495677_0000747_3825_4850 | 327 |
| 462 | 3300047445 | Ga0495677_0001425 | Ga0495677_0001425_6244_7269 | 327 |
| 463 | 3300047445 | Ga0495677_0002594 | Ga0495677_0002594_497_1519 | 327 |
| 464 | 3300047445 | Ga0495677_0002820 | Ga0495677_0002820_1092_2159 | 327 |
| 465 | 3300047445 | Ga0495677_0003300 | Ga0495677_0003300_3532_4563 | 327 |
| 466 | 3300047445 | Ga0495677_0003383 | Ga0495677_0003383_3433_4458 | 327 |
| 467 | 3300047445 | Ga0495677_0017460 | Ga0495677_0017460_989_2050 | 327 |
| 468 | 3300047445 | Ga0495677_0078925 | Ga0495677_0078925_127_1152 | 327 |
| 469 | 3300047446 | Ga0495679_003638 | Ga0495679_003638_1130_2161 | 327 |
| 470 | 3300047446 | Ga0495679_013039 | Ga0495679_013039_1731_2774 | 327 |
| 471 | 3300047446 | Ga0495679_022462 | Ga0495679_022462_176_1201 | 327 |
| 472 | 3300047447 | Ga0495685_003984 | Ga0495685_003984_1863_2882 | 327 |
| 473 | 3300047447 | Ga0495685_014028 | Ga0495685_014028_240_1259 | 327 |
| 474 | 3300047447 | Ga0495685_019480 | Ga0495685_019480_1211_2272 | 327 |
| 475 | 3300047470 | Ga0495681_0000264 | Ga0495681_0000264_4524_5549 | 327 |
| 476 | 3300047470 | Ga0495681_0000802 | Ga0495681_0000802_10403_11386 | 327 |
| 477 | 3300047470 | Ga0495681_0003014 | Ga0495681_0003014_3655_4680 | 327 |
| 478 | 3300047470 | Ga0495681_0004990 | Ga0495681_0004990_6076_7101 | 327 |
| 479 | 3300047470 | Ga0495681_0006614 | Ga0495681_0006614_3471_4508 | 327 |
| 480 | 3300047470 | Ga0495681_0014549 | Ga0495681_0014549_3268_4311 | 327 |
| 481 | 3300047470 | Ga0495681_0020065 | Ga0495681_0020065_2505_3536 | 327 |
| 482 | 3300047470 | Ga0495681_0028954 | Ga0495681_0028954_790_1809 | 327 |
| 483 | 3300047470 | Ga0495681_0051870 | Ga0495681_0051870_395_1462 | 327 |
| 484 | 3300047472 | Ga0495686_0000364 | Ga0495686_0000364_27255_28280 | 327 |
| 485 | 3300047472 | Ga0495686_0005467 | Ga0495686_0005467_6208_7233 | 327 |
| 486 | 3300047472 | Ga0495686_0016124 | Ga0495686_0016124_2596_3639 | 327 |
| 487 | 3300047472 | Ga0495686_0037623 | Ga0495686_0037623_657_1682 | 327 |
| 488 | 3300047472 | Ga0495686_0045480 | Ga0495686_0045480_1471_2538 | 327 |
| 489 | 3300047673 | Ga0495593_0009480 | Ga0495593_0009480_3123_4148 | 327 |
| 490 | 3300048091 | Ga0495626_0000085 | Ga0495626_0000085_114685_115710 | 327 |
| 491 | 3300048091 | Ga0495626_0000316 | Ga0495626_0000316_26901_27926 | 327 |
| 492 | 3300048091 | Ga0495626_0000867 | Ga0495626_0000867_2814_3836 | 327 |
| 493 | 3300048091 | Ga0495626_0002571 | Ga0495626_0002571_9728_10753 | 327 |
| 494 | 3300048091 | Ga0495626_0002887 | Ga0495626_0002887_3130_4173 | 327 |
| 495 | 3300048091 | Ga0495626_0006583 | Ga0495626_0006583_5416_6435 | 327 |
| 496 | 3300048091 | Ga0495626_0012051 | Ga0495626_0012051_2594_3613 | 327 |
| 497 | 3300048091 | Ga0495626_0016046 | Ga0495626_0016046_911_1948 | 327 |
| 498 | 3300048091 | Ga0495626_0024876 | Ga0495626_0024876_564_1601 | 327 |
| 499 | 3300048091 | Ga0495626_0025620 | Ga0495626_0025620_1229_2260 | 327 |
| 500 | 3300048091 | Ga0495626_0033526 | Ga0495626_0033526_1382_2401 | 327 |
| 501 | 3300048903 | Ga0496100_0129009 | Ga0496100_0129009_430_1455 | 327 |
| 502 | 3300048903 | Ga0496100_0293962 | Ga0496100_0293962_99_1124 | 327 |
| 503 | 3300048904 | Ga0496101_0009394 | Ga0496101_0009394_3588_4613 | 327 |
| 504 | 3300048904 | Ga0496101_0310392 | Ga0496101_0310392_147_1172 | 327 |
| 505 | 3300048905 | Ga0496102_0000606 | Ga0496102_0000606_25998_27023 | 327 |
| 506 | 3300048905 | Ga0496102_0015543 | Ga0496102_0015543_4590_5648 | 327 |
| 507 | 3300048909 | Ga0496106_0040575 | Ga0496106_0040575_686_1711 | 327 |
| 508 | 3300048910 | Ga0496107_0031031 | Ga0496107_0031031_2355_3380 | 327 |
| 509 | 3300048912 | Ga0496109_0024501 | Ga0496109_0024501_1649_2674 | 327 |
| 510 | 3300048913 | Ga0496110_0000181 | Ga0496110_0000181_5135_6172 | 327 |
| 511 | 3300048913 | Ga0496110_0191962 | Ga0496110_0191962_629_1654 | 327 |
| 512 | 3300048914 | Ga0496111_0119356 | Ga0496111_0119356_610_1635 | 327 |
| 513 | 3300048915 | Ga0496112_0150227 | Ga0496112_0150227_125_1183 | 327 |
| 514 | 3300048916 | Ga0496113_0028141 | Ga0496113_0028141_1425_2450 | 327 |
| 515 | 3300048918 | Ga0496115_0070927 | Ga0496115_0070927_642_1667 | 327 |
| 516 | 3300048918 | Ga0496115_0289642 | Ga0496115_0289642_300_1325 | 327 |
| 517 | 3300048925 | Ga0496122_0001696 | Ga0496122_0001696_29677_30702 | 327 |
| 518 | 3300048925 | Ga0496122_0007880 | Ga0496122_0007880_7100_8158 | 327 |
| 519 | 3300048925 | Ga0496122_0011463 | Ga0496122_0011463_3680_4738 | 327 |
| 520 | 3300048926 | Ga0496123_0000797 | Ga0496123_0000797_20258_21283 | 327 |
| 521 | 3300048926 | Ga0496123_0011762 | Ga0496123_0011762_1617_2675 | 327 |
| 522 | 3300048926 | Ga0496123_0023703 | Ga0496123_0023703_1438_2496 | 327 |
| 523 | 3300048927 | Ga0496124_0019871 | Ga0496124_0019871_1395_2420 | 327 |
| 524 | 3300048927 | Ga0496124_0029923 | Ga0496124_0029923_1173_2198 | 327 |
| 525 | 3300048927 | Ga0496124_0049172 | Ga0496124_0049172_190_1248 | 327 |
| 526 | 3300048927 | Ga0496124_0144289 | Ga0496124_0144289_761_1786 | 327 |
| 527 | 3300048928 | Ga0496125_0011947 | Ga0496125_0011947_5075_6100 | 327 |
| 528 | 3300049459 | Ga0495678_000170 | Ga0495678_000170_49320_50363 | 327 |
| 529 | 3300049459 | Ga0495678_000482 | Ga0495678_000482_3548_4567 | 327 |
| 530 | 3300049459 | Ga0495678_000529 | Ga0495678_000529_2630_3649 | 327 |
| 531 | 3300049459 | Ga0495678_000854 | Ga0495678_000854_23571_24608 | 327 |
| 532 | 3300049459 | Ga0495678_033993 | Ga0495678_033993_690_1709 | 327 |
| 533 | 3300049460 | Ga0495682_0000907 | Ga0495682_0000907_3831_4850 | 327 |
| 534 | 3300049460 | Ga0495682_0010748 | Ga0495682_0010748_1050_2075 | 327 |
| 535 | 3300049460 | Ga0495682_0012489 | Ga0495682_0012489_38_1057 | 327 |
| 536 | 3300049460 | Ga0495682_0014536 | Ga0495682_0014536_1056_2099 | 327 |
| 537 | 3300049822 | Ga0501035_0000937 | Ga0501035_0000937_27641_28666 | 327 |
| 538 | 3300059505 | Ga0587083_0001550 | Ga0587083_0001550_323_1348 | 327 |
| 539 | 3300059641 | Ga0587068_001715 | Ga0587068_001715_354_1379 | 327 |
| 540 | 3300059643 | Ga0587072_004261 | Ga0587072_004261_146_1171 | 327 |
| 541 | 3300061719 | Ga0466962_0081232 | Ga0466962_0081232_245_1270 | 327 |
| 542 | 3300047321 | Ga0495676_0000243 | Ga0495676_0000243_6173_7192 | 328 |
| 543 | 3300005356 | Ga0070674_100093808 | Ga0070674_1000938081 | 329 |
| 544 | 3300005441 | Ga0070700_100122754 | Ga0070700_1001227541 | 329 |
| 545 | 3300005548 | Ga0070665_100265540 | Ga0070665_1002655402 | 329 |
| 546 | 3300005718 | Ga0068866_10054404 | Ga0068866_100544041 | 329 |
| 547 | 3300013297 | Ga0157378_10040450 | Ga0157378_100404502 | 329 |
| 548 | 3300013308 | Ga0157375_10086245 | Ga0157375_100862452 | 329 |
| 549 | 3300025923 | Ga0207681_10111118 | Ga0207681_101111182 | 329 |
| 550 | 3300025937 | Ga0207669_10200396 | Ga0207669_102003962 | 329 |
| 551 | 3300026075 | Ga0207708_10155162 | Ga0207708_101551622 | 329 |
| 552 | 3300028379 | Ga0268266_10217377 | Ga0268266_102173772 | 329 |
| 553 | 3300046471 | Ga0495650_0000048 | Ga0495650_0000048_143536_144570 | 329 |
| 554 | 3300046471 | Ga0495650_0003786 | Ga0495650_0003786_7241_8275 | 329 |
| 555 | 2162886007 | SwRhRL2b_contig_3016416 | SwRhRL2b_0260.00007640 | 330 |
| 556 | 3300003791 | Ga0055530_10000004 | Ga0055530_10000004130 | 330 |
| 557 | 3300003792 | Ga0055540_1000017 | Ga0055540_100001772 | 330 |
| 558 | 3300005288 | Ga0065714_10002490 | Ga0065714_1000249015 | 330 |
| 559 | 3300005288 | Ga0065714_10004800 | Ga0065714_100048003 | 330 |
| 560 | 3300005288 | Ga0065714_10018420 | Ga0065714_100184202 | 330 |
| 561 | 3300005289 | Ga0065704_10070219 | Ga0065704_1007021922 | 330 |
| 562 | 3300005331 | Ga0070670_100002465 | Ga0070670_1000024656 | 330 |
| 563 | 3300005331 | Ga0070670_100013267 | Ga0070670_1000132676 | 330 |
| 564 | 3300005344 | Ga0070661_100000016 | Ga0070661_10000001673 | 330 |
| 565 | 3300005564 | Ga0070664_100000013 | Ga0070664_10000001375 | 330 |
| 566 | 3300006946 | Ga0079104_1000006 | Ga0079104_1000006218 | 330 |
| 567 | 3300009036 | Ga0105244_10001587 | Ga0105244_1000158713 | 330 |
| 568 | 3300009148 | Ga0105243_10000045 | Ga0105243_1000004567 | 330 |
| 569 | 3300009176 | Ga0105242_10001142 | Ga0105242_100011426 | 330 |
| 570 | 3300009545 | Ga0105237_10000090 | Ga0105237_1000009012 | 330 |
| 571 | 3300013100 | Ga0157373_10030773 | Ga0157373_100307734 | 330 |
| 572 | 3300013105 | Ga0157369_10002211 | Ga0157369_100022118 | 330 |
| 573 | 3300013306 | Ga0163162_10000148 | Ga0163162_1000014811 | 330 |
| 574 | 3300013308 | Ga0157375_10000575 | Ga0157375_1000057521 | 330 |
| 575 | 3300013308 | Ga0157375_10571341 | Ga0157375_105713412 | 330 |
| 576 | 3300015261 | Ga0182006_1000305 | Ga0182006_100030519 | 330 |
| 577 | 3300017792 | Ga0163161_10002442 | Ga0163161_1000244211 | 330 |
| 578 | 3300017792 | Ga0163161_10225502 | Ga0163161_102255022 | 330 |
| 579 | 3300025292 | Ga0209676_1001053 | Ga0209676_10010537 | 330 |
| 580 | 3300025298 | Ga0209050_1000037 | Ga0209050_1000037129 | 330 |
| 581 | 3300025303 | Ga0209051_1000040 | Ga0209051_1000040130 | 330 |
| 582 | 3300025304 | Ga0209257_1016016 | Ga0209257_10160163 | 330 |
| 583 | 3300025711 | Ga0207696_1000006 | Ga0207696_1000006169 | 330 |
| 584 | 3300025711 | Ga0207696_1005533 | Ga0207696_10055334 | 330 |
| 585 | 3300025728 | Ga0207655_1000109 | Ga0207655_100010984 | 330 |
| 586 | 3300025728 | Ga0207655_1000176 | Ga0207655_100017699 | 330 |
| 587 | 3300025735 | Ga0207713_1002598 | Ga0207713_10025982 | 330 |
| 588 | 3300025914 | Ga0207671_10000118 | Ga0207671_1000011860 | 330 |
| 589 | 3300025920 | Ga0207649_10000046 | Ga0207649_1000004636 | 330 |
| 590 | 3300025925 | Ga0207650_10000192 | Ga0207650_1000019270 | 330 |
| 591 | 3300025925 | Ga0207650_10000208 | Ga0207650_100002086 | 330 |
| 592 | 3300025935 | Ga0207709_10000011 | Ga0207709_10000011400 | 330 |
| 593 | 3300025945 | Ga0207679_10000033 | Ga0207679_1000003369 | 330 |
| 594 | 3300027111 | Ga0209281_1000011 | Ga0209281_1000011406 | 330 |
| 595 | 3300031548 | Ga0307408_100000074 | Ga0307408_10000007478 | 330 |
| 596 | 3300031548 | Ga0307408_100001591 | Ga0307408_1000015914 | 330 |
| 597 | 3300031548 | Ga0307408_100090033 | Ga0307408_1000900332 | 330 |
| 598 | 3300031731 | Ga0307405_10000130 | Ga0307405_1000013017 | 330 |
| 599 | 3300031731 | Ga0307405_10015105 | Ga0307405_100151054 | 330 |
| 600 | 3300031824 | Ga0307413_10000948 | Ga0307413_100009488 | 330 |
| 601 | 3300031901 | Ga0307406_10029060 | Ga0307406_100290602 | 330 |
| 602 | 3300031911 | Ga0307412_10000661 | Ga0307412_1000066114 | 330 |
| 603 | 3300031911 | Ga0307412_10002366 | Ga0307412_100023668 | 330 |
| 604 | 3300031911 | Ga0307412_10113771 | Ga0307412_101137712 | 330 |
| 605 | 3300031911 | Ga0307412_10189525 | Ga0307412_101895252 | 330 |
| 606 | 3300032002 | Ga0307416_100367546 | Ga0307416_1003675462 | 330 |
| 607 | 3300032004 | Ga0307414_10000407 | Ga0307414_1000040711 | 330 |
| 608 | 3300032004 | Ga0307414_10028770 | Ga0307414_100287702 | 330 |
| 609 | 3300032005 | Ga0307411_10245087 | Ga0307411_102450872 | 330 |
| 610 | 3300041411 | Ga0439466_0001938 | Ga0439466_0001938_818_1810 | 330 |
| 611 | 3300041411 | Ga0439466_0012758 | Ga0439466_0012758_1617_2609 | 330 |
| 612 | 3300046453 | Ga0495627_051625 | Ga0495627_051625_18_1049 | 330 |
| 613 | 3300046455 | Ga0495603_0021673 | Ga0495603_0021673_2650_3681 | 330 |
| 614 | 3300046457 | Ga0495590_0000238 | Ga0495590_0000238_19275_20312 | 330 |
| 615 | 3300046459 | Ga0495629_0186745 | Ga0495629_0186745_194_1225 | 330 |
| 616 | 3300046463 | Ga0495653_0001958 | Ga0495653_0001958_14477_15514 | 330 |
| 617 | 3300046472 | Ga0495580_0053634 | Ga0495580_0053634_1187_2224 | 330 |
| 618 | 3300046473 | Ga0495582_0008200 | Ga0495582_0008200_1563_2600 | 330 |
| 619 | 3300046473 | Ga0495582_0014737 | Ga0495582_0014737_2337_3368 | 330 |
| 620 | 3300046474 | Ga0495605_0000053 | Ga0495605_0000053_134030_135022 | 330 |
| 621 | 3300046474 | Ga0495605_0033721 | Ga0495605_0033721_808_1800 | 330 |
| 622 | 3300046474 | Ga0495605_0062108 | Ga0495605_0062108_364_1395 | 330 |
| 623 | 3300046491 | Ga0495584_0042229 | Ga0495584_0042229_311_1342 | 330 |
| 624 | 3300046491 | Ga0495584_0053131 | Ga0495584_0053131_16_1053 | 330 |
| 625 | 3300046499 | Ga0495594_0006599 | Ga0495594_0006599_2829_3860 | 330 |
| 626 | 3300046499 | Ga0495594_0033362 | Ga0495594_0033362_1392_2429 | 330 |
| 627 | 3300046500 | Ga0495596_0004940 | Ga0495596_0004940_1792_2829 | 330 |
| 628 | 3300046512 | Ga0495610_0000069 | Ga0495610_0000069_64445_65437 | 330 |
| 629 | 3300046513 | Ga0495616_0058228 | Ga0495616_0058228_216_1208 | 330 |
| 630 | 3300046517 | Ga0495630_0048200 | Ga0495630_0048200_1578_2615 | 330 |
| 631 | 3300046518 | Ga0495631_0000240 | Ga0495631_0000240_4006_4998 | 330 |
| 632 | 3300046518 | Ga0495631_0078242 | Ga0495631_0078242_364_1395 | 330 |
| 633 | 3300046523 | Ga0495644_0024433 | Ga0495644_0024433_211_1242 | 330 |
| 634 | 3300046526 | Ga0495666_0005546 | Ga0495666_0005546_557_1594 | 330 |
| 635 | 3300046528 | Ga0495642_0041892 | Ga0495642_0041892_472_1503 | 330 |
| 636 | 3300046529 | Ga0495652_0023959 | Ga0495652_0023959_4128_5165 | 330 |
| 637 | 3300046530 | Ga0495654_0000276 | Ga0495654_0000276_19945_20937 | 330 |
| 638 | 3300046533 | Ga0495640_0113041 | Ga0495640_0113041_651_1688 | 330 |
| 639 | 3300046535 | Ga0495586_0010512 | Ga0495586_0010512_3063_4094 | 330 |
| 640 | 3300046535 | Ga0495586_0022138 | Ga0495586_0022138_1100_2137 | 330 |
| 641 | 3300046538 | Ga0495609_0027721 | Ga0495609_0027721_892_1923 | 330 |
| 642 | 3300046557 | Ga0495622_0011514 | Ga0495622_0011514_929_1960 | 330 |
| 643 | 3300046663 | Ga0495635_0001764 | Ga0495635_0001764_2963_3994 | 330 |
| 644 | 3300046674 | Ga0495588_0009704 | Ga0495588_0009704_1189_2220 | 330 |
| 645 | 3300046674 | Ga0495588_0017529 | Ga0495588_0017529_1057_2088 | 330 |
| 646 | 3300046674 | Ga0495588_0039793 | Ga0495588_0039793_1163_2200 | 330 |
| 647 | 3300046679 | Ga0495623_0022033 | Ga0495623_0022033_2635_3672 | 330 |
| 648 | 3300046684 | Ga0495669_0000120 | Ga0495669_0000120_44310_45347 | 330 |
| 649 | 3300046689 | Ga0495613_0015597 | Ga0495613_0015597_1615_2646 | 330 |
| 650 | 3300046689 | Ga0495613_0047884 | Ga0495613_0047884_1735_2766 | 330 |
| 651 | 3300046691 | Ga0495670_0013153 | Ga0495670_0013153_929_1960 | 330 |
| 652 | 3300046694 | Ga0495649_0110268 | Ga0495649_0110268_286_1323 | 330 |
| 653 | 3300047315 | Ga0495581_0008782 | Ga0495581_0008782_2117_3148 | 330 |
| 654 | 3300047317 | Ga0495604_0020837 | Ga0495604_0020837_1214_2245 | 330 |
| 655 | 3300047320 | Ga0495672_0085137 | Ga0495672_0085137_366_1358 | 330 |
| 656 | 3300047322 | Ga0495680_0016123 | Ga0495680_0016123_2493_3524 | 330 |
| 657 | 3300047444 | Ga0495675_0008913 | Ga0495675_0008913_2471_3502 | 330 |
| 658 | 3300047470 | Ga0495681_0034859 | Ga0495681_0034859_1409_2440 | 330 |
| 659 | 3300047673 | Ga0495593_0005405 | Ga0495593_0005405_3235_4266 | 330 |
| 660 | 3300047673 | Ga0495593_0139674 | Ga0495593_0139674_14_1051 | 330 |
| 661 | 3300048088 | Ga0495602_0011455 | Ga0495602_0011455_2284_3321 | 330 |
| 662 | 3300048089 | Ga0495614_0004888 | Ga0495614_0004888_3774_4805 | 330 |
| 663 | 3300048089 | Ga0495614_0025426 | Ga0495614_0025426_466_1497 | 330 |
| 664 | 3300048091 | Ga0495626_0077701 | Ga0495626_0077701_77_1114 | 330 |
| 665 | 3300048920 | Ga0496117_0000461 | Ga0496117_0000461_12205_13197 | 330 |
| 666 | 3300048920 | Ga0496117_0001482 | Ga0496117_0001482_9814_10806 | 330 |
| 667 | 3300048921 | Ga0496118_0000106 | Ga0496118_0000106_96865_97857 | 330 |
| 668 | 3300048921 | Ga0496118_0001585 | Ga0496118_0001585_9819_10811 | 330 |
| 669 | 3300048924 | Ga0496121_0000871 | Ga0496121_0000871_28969_29961 | 330 |
| 670 | 3300048924 | Ga0496121_0002025 | Ga0496121_0002025_21348_22340 | 330 |
| 671 | 3300048924 | Ga0496121_0107692 | Ga0496121_0107692_139_1131 | 330 |
| 672 | 3300048925 | Ga0496122_0001143 | Ga0496122_0001143_24571_25563 | 330 |
| 673 | 3300048925 | Ga0496122_0004800 | Ga0496122_0004800_4304_5296 | 330 |
| 674 | 3300048926 | Ga0496123_0057722 | Ga0496123_0057722_1176_2168 | 330 |
| 675 | 3300048928 | Ga0496125_0000038 | Ga0496125_0000038_171984_172976 | 330 |
| 676 | 3300048928 | Ga0496125_0000619 | Ga0496125_0000619_33151_34143 | 330 |
| 677 | 3300048928 | Ga0496125_0001480 | Ga0496125_0001480_23013_24005 | 330 |
| 678 | 3300048928 | Ga0496125_0023411 | Ga0496125_0023411_2548_3540 | 330 |
| 679 | 3300048929 | Ga0496126_0032096 | Ga0496126_0032096_1858_2850 | 330 |
| 680 | 3300049662 | Ga0501222_000076 | Ga0501222_000076_16464_17456 | 330 |
| 681 | 3300049853 | Ga0501226_000464 | Ga0501226_000464_4050_5042 | 330 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lzk-assembly1.cif.gz_B | the crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021 | 0.9787 | 1 | 327 |
| 3lzk-assembly1.cif.gz_B | the crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021 | 0.967 | 1 | 327 |
| 8gst-assembly2.cif.gz_D | crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (pyruvate bound-form) | 0.8382 | 1 | 325 |
| 1nr9-assembly1.cif.gz_B | crystal structure of escherichia coli 1262 (apc5008), putative isomerase | 0.8232 | 68 | 323 |
| 6v77-assembly1.cif.gz_B | crystal structure of a putative hpce protein from mycobacterium smegmatis | 0.8217 | 1 | 325 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lzkB00 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.953 | 2 | 327 | 3.90.850.10 |
| 3lzkB00 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9416 | 2 | 327 | 3.90.850.10 |
| af_O86346_1_303_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.8725 | 1 | 326 | 3.90.850.10 |
| af_O86346_1_303_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.8703 | 1 | 326 | 3.90.850.10 |
| af_Q9VU50_128_337_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.8606 | 76 | 324 | 3.90.850.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-I4N1P0-F1-model_v4 | Hydrolase | 0.9936 | 1 | 327 |
GO:0016787
|
| AF-A0A7W9WT32-F1-model_v4 | Fumarylacetoacetate (FAA) hydrolase (EC 3.7.1.2) | 0.9934 | 1 | 325 |
GO:0004334
|
| AF-A0A482PCP2-F1-model_v4 | Fumarylacetoacetate hydrolase | 0.991 | 1 | 326 |
GO:0016787
|
| AF-A0A208XHG1-F1-model_v4 | Fumarylacetoacetate hydrolase | 0.991 | 1 | 325 |
GO:0016787
|
| AF-A0A7X6FD65-F1-model_v4 | Fumarylacetoacetate (FAA) hydrolase (EC 3.7.1.2) | 0.9907 | 1 | 325 |
GO:0004334
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar