F474855

General Info

Members Datasets Scaffolds Average Seq Length
681 289 619 339

Family's Representative Sequence

Representative Sequence 3300046452|Ga0495617_000070|Ga0495617_000070_26798_27865
Length 355
Sequence LIFNGSNIETPRSIMKLASLKTGGRDGTLVVVSRDLVTCQPVPAIARTLQAALDDWDHVAPQLHQIYELLNQGMAADAVSFLEEECASPLPRAYQWADGSAYINHVELVRKARGAQVPPSFYTDPLMYQGGSDSFVGPRDPIAVQSEEWGVDLEAEVAVVTGDVPMGASPEQAARAIRLVMLVNDVSLRNLIPKELEKGFGFFQSKPASAFSPVAVTPDELGDAWRDSKLGLPLQVTLNGEPFGRPNAGDDMTFSFAQLVAHAAKTRELAAGSIIGSGTVSNKQGDLHGSSIANGGVGYCCLAELRMYETIEQGAPQTPFLRYGDTVRIEMLDAAGASIFGAIDQEVAHYQGRKA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
4 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
5 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
6 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
7 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
8 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
9 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
10 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
11 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
12 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
13 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
14 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
15 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
16 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
17 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
18 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
19 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
20 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
21 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
22 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
23 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
24 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
25 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
26 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
27 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
28 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
29 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
30 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
31 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
32 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
33 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
34 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
35 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
36 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
37 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
38 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
39 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
40 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
41 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
42 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
43 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
44 2643221556 Massilia sp. Root1485 Isolate Unclassified
45 2643221638 Duganella sp. Root336D2 Isolate Unclassified
46 2643221684 Massilia sp. Root133 Isolate Unclassified
47 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
48 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
49 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
50 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
51 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
52 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
53 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
54 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
55 2857558681 Duganella sp. R-74565 Isolate Unclassified
56 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
57 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
58 2919476304 Duganella sp. 3397 Isolate Unclassified
59 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
60 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
61 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
62 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
63 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
64 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
65 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
66 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
67 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
68 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
69 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
70 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
71 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
72 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
73 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
74 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
75 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
76 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
77 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
78 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
79 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
80 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
81 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
82 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
83 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
84 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
85 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
86 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
87 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
112 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
114 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
117 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
149 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
154 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
170 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
183 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
186 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
194 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
195 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
198 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
199 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
200 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
201 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
202 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
205 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
206 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
207 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
208 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
211 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
218 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
224 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
230 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
231 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
234 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
237 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
244 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
247 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
248 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
249 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
250 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
251 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
254 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
267 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
270 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
271 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
272 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
275 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
276 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
282 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
283 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
287 639633007 Azoarcus olearius BH72 Isolate Unclassified
288 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
289 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.16
Metatranscriptomes 0.73
Isolates 9.1

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 8.52
Nodule 0.29
Rhizoplane 8.66
Rhizosphere 76.8
Stem 0
Stem Tuber 0
Unclassified 5.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3016416 2162886007 Bacteria 21736
2 MRS1b_contig_6168241 2162886011 Bacteria 1629
3 JGI25158J39367_1000851 3300002739 Bacteria 5837
4 JGI25152J39213_1013788 3300002773 Bacteria 1667
5 JGI25150J39212_1000554 3300002774 Bacteria 15048
6 JGI25150J39212_1000999 3300002774 Bacteria 8827
7 JGI25159J45721_1003101 3300002987 Bacteria 5999
8 JGI25159J45721_1005160 3300002987 Bacteria 4138
9 JGI25153J46596_10013131 3300003215 Bacteria 3521
10 JGI25161J50226_1000776 3300003374 Bacteria 12129
11 JGI25161J50226_1008967 3300003374 Bacteria 1478
12 Ga0007409J51694_1008320 3300003575 Bacteria 3036
13 Ga0007409J51694_1008322 3300003575 Bacteria 2250
14 Ga0055525_1000001 3300003759 Bacteria 1016948
15 Ga0055526_1000198 3300003771 Bacteria 51889
16 Ga0055526_1002566 3300003771 Bacteria 12180
17 Ga0055526_1003773 3300003771 Bacteria 9447
18 Ga0055537_1001803 3300003773 Bacteria 7796
19 Ga0055524_1001038 3300003775 Bacteria 17138
20 Ga0055524_1002298 3300003775 Bacteria 9962
21 Ga0055524_1009932 3300003775 Bacteria 3826
22 Ga0055534_1006496 3300003784 Bacteria 2934
23 Ga0055528_1011745 3300003790 Bacteria 3452
24 Ga0055530_10000004 3300003791 Bacteria 231465
25 Ga0055540_1000017 3300003792 Bacteria 231465
26 Ga0055543_1000777 3300004625 Bacteria 15874
27 Ga0065165_1000723 3300005262 Bacteria 46190
28 Ga0065165_1001842 3300005262 Bacteria 20684
29 Ga0065714_10002490 3300005288 Bacteria 15870
30 Ga0065714_10004800 3300005288 Bacteria 5759
31 Ga0065714_10018420 3300005288 Bacteria 1694
32 Ga0065704_10070219 3300005289 Bacteria 67905
33 Ga0070670_100002465 3300005331 Bacteria 15267
34 Ga0070670_100013267 3300005331 Bacteria 7060
35 Ga0070661_100000016 3300005344 Bacteria 153545
36 Ga0070661_100024933 3300005344 Bacteria 4293
37 Ga0070674_100093808 3300005356 Bacteria 2172
38 Ga0070659_100036315 3300005366 Bacteria 3841
39 Ga0070659_100102547 3300005366 Bacteria 2303
40 Ga0070714_100151392 3300005435 Bacteria 2091
41 Ga0070700_100122754 3300005441 Bacteria 1743
42 Ga0070662_100233040 3300005457 Bacteria 1473
43 Ga0070665_100265540 3300005548 Bacteria 1718
44 Ga0068855_100034781 3300005563 Bacteria 6005
45 Ga0070664_100000013 3300005564 Bacteria 153909
46 Ga0070664_100232213 3300005564 Bacteria 1654
47 Ga0068866_10054404 3300005718 Bacteria 2051
48 Ga0068871_100334105 3300006358 Bacteria 1337
49 Ga0068865_100104507 3300006881 Bacteria 2079
50 Ga0079104_1000006 3300006946 Bacteria 396255
51 Ga0105251_10055736 3300009011 Bacteria 1873
52 Ga0105244_10001587 3300009036 Bacteria 18066
53 Ga0105244_10034780 3300009036 Bacteria 2650
54 Ga0105245_10133908 3300009098 Bacteria 2327
55 Ga0105243_10000045 3300009148 Bacteria 156620
56 Ga0105243_10050043 3300009148 Bacteria 3299
57 Ga0105241_10117288 3300009174 Bacteria 2139
58 Ga0105242_10001142 3300009176 Bacteria 20946
59 Ga0105242_10019519 3300009176 Bacteria 5312
60 Ga0105237_10000090 3300009545 Bacteria 123394
61 Ga0105239_10483052 3300010375 Bacteria 1407
62 Ga0157373_10030773 3300013100 Bacteria 3862
63 Ga0157369_10002211 3300013105 Bacteria 23426
64 Ga0157374_10129932 3300013296 Bacteria 2437
65 Ga0157378_10040450 3300013297 Bacteria 4134
66 Ga0157378_10630356 3300013297 Bacteria 1086
67 Ga0163162_10000148 3300013306 Bacteria 64886
68 Ga0157375_10000575 3300013308 Bacteria 32917
69 Ga0157375_10086245 3300013308 Bacteria 3190
70 Ga0157375_10571341 3300013308 Bacteria 1291
71 Ga0182006_1000305 3300015261 Bacteria 42860
72 Ga0163161_10002442 3300017792 Bacteria 13273
73 Ga0163161_10225502 3300017792 Bacteria 1453
74 Ga0209436_100243 3300025208 Bacteria 25107
75 Ga0209436_100739 3300025208 Bacteria 13638
76 Ga0209563_100007 3300025230 Bacteria 1579402
77 Ga0207425_1000001 3300025245 Bacteria 2525432
78 Ga0207425_1000089 3300025245 Bacteria 91267
79 Ga0209677_101317 3300025253 Bacteria 10971
80 Ga0209148_1000320 3300025254 Bacteria 66815
81 Ga0209129_1000001 3300025258 Bacteria 1452436
82 Ga0209129_1003360 3300025258 Bacteria 7039
83 Ga0209565_1001261 3300025263 Bacteria 11772
84 Ga0209565_1002264 3300025263 Bacteria 7129
85 Ga0209673_1004003 3300025273 Bacteria 8182
86 Ga0209130_1000407 3300025284 Bacteria 47012
87 Ga0209130_1000994 3300025284 Bacteria 22084
88 Ga0209130_1001239 3300025284 Bacteria 17922
89 Ga0209675_1001997 3300025291 Bacteria 10948
90 Ga0209675_1006810 3300025291 Bacteria 4506
91 Ga0209676_1001053 3300025292 Bacteria 31708
92 Ga0209564_1000009 3300025295 Bacteria 950196
93 Ga0209564_1000178 3300025295 Bacteria 151982
94 Ga0209564_1009436 3300025295 Bacteria 4643
95 Ga0209758_1000116 3300025297 Bacteria 198356
96 Ga0209050_1000037 3300025298 Bacteria 415612
97 Ga0209050_1000480 3300025298 Bacteria 70176
98 Ga0209050_1024807 3300025298 Bacteria 2060
99 Ga0209256_1000297 3300025299 Bacteria 86973
100 Ga0209256_1000515 3300025299 Bacteria 56806
101 Ga0209256_1000635 3300025299 Bacteria 47967
102 Ga0207426_1002747 3300025302 Bacteria 10653
103 Ga0209051_1000040 3300025303 Bacteria 315055
104 Ga0209051_1016724 3300025303 Bacteria 3303
105 Ga0209257_1000293 3300025304 Bacteria 110422
106 Ga0209257_1016016 3300025304 Bacteria 3064
107 Ga0207696_1000006 3300025711 Bacteria 616498
108 Ga0207696_1005533 3300025711 Bacteria 5225
109 Ga0207655_1000109 3300025728 Bacteria 172040
110 Ga0207655_1000176 3300025728 Bacteria 115120
111 Ga0207655_1016977 3300025728 Bacteria 3950
112 Ga0207713_1002598 3300025735 Bacteria 13027
113 Ga0207705_10356400 3300025909 Bacteria 1128
114 Ga0207654_10023215 3300025911 Bacteria 3319
115 Ga0207671_10000118 3300025914 Bacteria 121904
116 Ga0207657_10026879 3300025919 Bacteria 5278
117 Ga0207649_10000046 3300025920 Bacteria 112669
118 Ga0207681_10111118 3300025923 Bacteria 1994
119 Ga0207650_10000192 3300025925 Bacteria 70742
120 Ga0207650_10000208 3300025925 Bacteria 67183
121 Ga0207687_10260619 3300025927 Bacteria 1382
122 Ga0207690_10131622 3300025932 Bacteria 1831
123 Ga0207706_10035699 3300025933 Bacteria 4419
124 Ga0207686_10002105 3300025934 Bacteria 10966
125 Ga0207709_10000011 3300025935 Bacteria 552881
126 Ga0207709_10039221 3300025935 Bacteria 2828
127 Ga0207669_10200396 3300025937 Bacteria 1448
128 Ga0207679_10000033 3300025945 Bacteria 155875
129 Ga0207667_10010303 3300025949 Bacteria 10936
130 Ga0207708_10155162 3300026075 Bacteria 1805
131 Ga0209281_1000011 3300027111 Bacteria 695292
132 Ga0209371_1000477 3300027312 Bacteria 39251
133 Ga0268266_10217377 3300028379 Bacteria 1755
134 Ga0268256_1000405 3300030500 Bacteria 39251
135 Ga0307408_100000074 3300031548 Bacteria 111955
136 Ga0307408_100000098 3300031548 Bacteria 95689
137 Ga0307408_100000870 3300031548 Bacteria 23712
138 Ga0307408_100001591 3300031548 Bacteria 16759
139 Ga0307408_100090033 3300031548 Bacteria 2314
140 Ga0307408_100224212 3300031548 Bacteria 1535
141 Ga0316576_10034599 3300031727 Bacteria 3601
142 Ga0316576_10157845 3300031727 Bacteria 1710
143 Ga0316578_10125354 3300031728 Bacteria 1544
144 Ga0307405_10000130 3300031731 Bacteria 29904
145 Ga0307405_10001329 3300031731 Bacteria 10357
146 Ga0307405_10015105 3300031731 Bacteria 4171
147 Ga0307413_10000948 3300031824 Bacteria 10386
148 Ga0307406_10029060 3300031901 Bacteria 3344
149 Ga0307412_10000661 3300031911 Bacteria 20028
150 Ga0307412_10002366 3300031911 Bacteria 10462
151 Ga0307412_10032428 3300031911 Bacteria 3310
152 Ga0307412_10113771 3300031911 Bacteria 1936
153 Ga0307412_10189525 3300031911 Bacteria 1553
154 Ga0307416_100367546 3300032002 Bacteria 1463
155 Ga0307414_10000407 3300032004 Bacteria 23346
156 Ga0307414_10028770 3300032004 Bacteria 3608
157 Ga0307411_10245087 3300032005 Bacteria 1405
158 Ga0395899_0012567 3300037312 Bacteria 6489
159 Ga0395899_0016298 3300037312 Bacteria 5664
160 Ga0395899_0047842 3300037312 Bacteria 3183
161 Ga0395899_0159332 3300037312 Bacteria 1595
162 Ga0395900_0001489 3300037418 Bacteria 27861
163 Ga0395900_0047209 3300037418 Bacteria 4434
164 Ga0395900_0050199 3300037418 Bacteria 4297
165 Ga0395900_0226854 3300037418 Bacteria 1880
166 Ga0395900_0413072 3300037418 Bacteria 1311
167 Ga0395898_0007100 3300037466 Bacteria 11895
168 Ga0395898_0099288 3300037466 Bacteria 2796
169 Ga0395905_0079517 3300037471 Bacteria 3073
170 Ga0395905_0082558 3300037471 Bacteria 3011
171 Ga0395905_0178494 3300037471 Bacteria 1993
172 Ga0395905_0350813 3300037471 Bacteria 1367
173 Ga0395901_0000491 3300038443 Bacteria 45939
174 Ga0395901_0010628 3300038443 Bacteria 9326
175 Ga0395901_0039708 3300038443 Bacteria 4871
176 Ga0395901_0106989 3300038443 Bacteria 2935
177 Ga0395901_0113204 3300038443 Bacteria 2849
178 Ga0439466_0001938 3300041411 Bacteria 8124
179 Ga0439466_0012758 3300041411 Bacteria 3087
180 Ga0439448_0039649 3300042005 Bacteria 1519
181 Ga0439455_0016756 3300042012 Bacteria 1699
182 Ga0439458_0018071 3300042157 Bacteria 1613
183 Ga0466972_0044681 3300044658 Bacteria 2148
184 Ga0466972_0080880 3300044658 Bacteria 1547
185 Ga0466972_0103530 3300044658 Bacteria 1346
186 Ga0466965_0005810 3300044683 Bacteria 5567
187 Ga0466966_0005398 3300044684 Bacteria 8399
188 Ga0466966_0021850 3300044684 Bacteria 4200
189 Ga0466961_0108168 3300044693 Bacteria 1750
190 Ga0466964_0002326 3300044706 Bacteria 6740
191 Ga0466964_0003695 3300044706 Bacteria 5604
192 Ga0466964_0047805 3300044706 Bacteria 1747
193 Ga0466968_0007634 3300044735 Bacteria 4118
194 Ga0466957_0000089 3300044842 Bacteria 36497
195 Ga0466957_0002847 3300044842 Bacteria 9356
196 Ga0466957_0100190 3300044842 Bacteria 1825
197 Ga0466959_0199835 3300045049 Bacteria 1392
198 Ga0451576_0000165 3300045051 Bacteria 168085
199 Ga0451576_0001042 3300045051 Bacteria 51034
200 Ga0466958_0070545 3300045836 Bacteria 2138
201 Ga0466958_0157524 3300045836 Bacteria 1433
202 Ga0466967_0028783 3300045976 Bacteria 4643
203 Ga0466967_0077670 3300045976 Bacteria 2989
204 Ga0495617_000070 3300046452 Bacteria 84436
205 Ga0495617_011150 3300046452 Bacteria 3072
206 Ga0495627_000201 3300046453 Bacteria 65296
207 Ga0495627_002489 3300046453 Bacteria 8800
208 Ga0495627_051625 3300046453 Bacteria 1235
209 Ga0495603_0011297 3300046455 Bacteria 5410
210 Ga0495603_0021673 3300046455 Bacteria 3891
211 Ga0495590_0000060 3300046457 Bacteria 89639
212 Ga0495590_0000238 3300046457 Bacteria 30191
213 Ga0495590_0003557 3300046457 Bacteria 6343
214 Ga0495591_000190 3300046458 Bacteria 63717
215 Ga0495629_0186745 3300046459 Bacteria 1435
216 Ga0495638_0002326 3300046460 Bacteria 15651
217 Ga0495638_0049512 3300046460 Bacteria 2627
218 Ga0495653_0001958 3300046463 Bacteria 16215
219 Ga0495650_0000048 3300046471 Bacteria 334427
220 Ga0495650_0000611 3300046471 Bacteria 48647
221 Ga0495650_0003786 3300046471 Bacteria 10777
222 Ga0495650_0019540 3300046471 Bacteria 3329
223 Ga0495580_0053634 3300046472 Bacteria 2844
224 Ga0495582_0008200 3300046473 Bacteria 5766
225 Ga0495582_0014737 3300046473 Bacteria 4296
226 Ga0495582_0084025 3300046473 Bacteria 1769
227 Ga0495605_0000053 3300046474 Bacteria 158757
228 Ga0495605_0000154 3300046474 Bacteria 88757
229 Ga0495605_0000161 3300046474 Bacteria 86062
230 Ga0495605_0000967 3300046474 Bacteria 19540
231 Ga0495605_0001972 3300046474 Bacteria 13011
232 Ga0495605_0005317 3300046474 Bacteria 7506
233 Ga0495605_0005436 3300046474 Bacteria 7418
234 Ga0495605_0019147 3300046474 Bacteria 3662
235 Ga0495605_0026472 3300046474 Bacteria 3015
236 Ga0495605_0033721 3300046474 Bacteria 2597
237 Ga0495605_0062108 3300046474 Bacteria 1785
238 Ga0495605_0065042 3300046474 Bacteria 1735
239 Ga0495584_0000059 3300046491 Bacteria 79769
240 Ga0495584_0000275 3300046491 Bacteria 36555
241 Ga0495584_0000639 3300046491 Bacteria 23311
242 Ga0495584_0001361 3300046491 Bacteria 14770
243 Ga0495584_0001892 3300046491 Bacteria 12075
244 Ga0495584_0009418 3300046491 Bacteria 5032
245 Ga0495584_0042229 3300046491 Bacteria 2301
246 Ga0495584_0053131 3300046491 Bacteria 2039
247 Ga0495584_0082188 3300046491 Bacteria 1621
248 Ga0495585_0000084 3300046492 Bacteria 98839
249 Ga0495585_0000122 3300046492 Bacteria 84570
250 Ga0495585_0000215 3300046492 Bacteria 60187
251 Ga0495585_0000522 3300046492 Bacteria 36273
252 Ga0495585_0003664 3300046492 Bacteria 10268
253 Ga0495585_0003757 3300046492 Bacteria 10136
254 Ga0495585_0007654 3300046492 Bacteria 6591
255 Ga0495585_0010373 3300046492 Bacteria 5548
256 Ga0495585_0074123 3300046492 Bacteria 1852
257 Ga0495594_0000361 3300046499 Bacteria 22852
258 Ga0495594_0006599 3300046499 Bacteria 5969
259 Ga0495594_0033362 3300046499 Bacteria 2798
260 Ga0495596_0000100 3300046500 Bacteria 60871
261 Ga0495596_0003842 3300046500 Bacteria 7462
262 Ga0495596_0004940 3300046500 Bacteria 6394
263 Ga0495596_0007852 3300046500 Bacteria 4782
264 Ga0495596_0007913 3300046500 Bacteria 4759
265 Ga0495596_0008970 3300046500 Bacteria 4419
266 Ga0495596_0011671 3300046500 Bacteria 3779
267 Ga0495596_0029930 3300046500 Bacteria 2181
268 Ga0495596_0033483 3300046500 Bacteria 2044
269 Ga0495596_0096394 3300046500 Bacteria 1148
270 Ga0495607_0000025 3300046501 Bacteria 159379
271 Ga0495607_0000619 3300046501 Bacteria 34447
272 Ga0495607_0003541 3300046501 Bacteria 11891
273 Ga0495607_0004523 3300046501 Bacteria 10207
274 Ga0495607_0007434 3300046501 Bacteria 7580
275 Ga0495607_0011264 3300046501 Bacteria 5964
276 Ga0495607_0042797 3300046501 Bacteria 2682
277 Ga0495607_0056839 3300046501 Bacteria 2244
278 Ga0495607_0064116 3300046501 Bacteria 2076
279 Ga0495583_0000230 3300046506 Bacteria 93092
280 Ga0495583_0000754 3300046506 Bacteria 41124
281 Ga0495583_0000791 3300046506 Bacteria 39222
282 Ga0495583_0004131 3300046506 Bacteria 10639
283 Ga0495583_0014243 3300046506 Bacteria 4396
284 Ga0495583_0019079 3300046506 Bacteria 3589
285 Ga0495583_0021077 3300046506 Bacteria 3358
286 Ga0495583_0068847 3300046506 Bacteria 1559
287 Ga0495606_0001284 3300046507 Bacteria 34796
288 Ga0495606_0011259 3300046507 Bacteria 7319
289 Ga0495606_0013503 3300046507 Bacteria 6443
290 Ga0495606_0039492 3300046507 Bacteria 3179
291 Ga0495606_0073990 3300046507 Bacteria 2135
292 Ga0495610_0000069 3300046512 Bacteria 121713
293 Ga0495610_0005183 3300046512 Bacteria 9336
294 Ga0495616_0000406 3300046513 Bacteria 33248
295 Ga0495616_0001911 3300046513 Bacteria 14044
296 Ga0495616_0002040 3300046513 Bacteria 13567
297 Ga0495616_0004109 3300046513 Bacteria 9230
298 Ga0495616_0004378 3300046513 Bacteria 8908
299 Ga0495616_0010810 3300046513 Bacteria 5261
300 Ga0495616_0011460 3300046513 Bacteria 5078
301 Ga0495616_0012458 3300046513 Bacteria 4828
302 Ga0495616_0023840 3300046513 Bacteria 3288
303 Ga0495616_0024473 3300046513 Bacteria 3239
304 Ga0495616_0054111 3300046513 Unclassified 1992
305 Ga0495616_0058228 3300046513 Bacteria 1903
306 Ga0495616_0100288 3300046513 Bacteria 1359
307 Ga0495616_0122043 3300046513 Bacteria 1202
308 Ga0495630_0048200 3300046517 Bacteria 3188
309 Ga0495631_0000240 3300046518 Bacteria 37805
310 Ga0495631_0000319 3300046518 Bacteria 33378
311 Ga0495631_0002882 3300046518 Bacteria 9536
312 Ga0495631_0006761 3300046518 Bacteria 5886
313 Ga0495631_0010660 3300046518 Bacteria 4544
314 Ga0495631_0019499 3300046518 Bacteria 3179
315 Ga0495631_0020913 3300046518 Bacteria 3051
316 Ga0495631_0033086 3300046518 Bacteria 2324
317 Ga0495631_0043374 3300046518 Bacteria 1984
318 Ga0495631_0078242 3300046518 Bacteria 1427
319 Ga0495632_0000147 3300046519 Bacteria 72673
320 Ga0495632_0000451 3300046519 Bacteria 39172
321 Ga0495632_0000514 3300046519 Bacteria 36429
322 Ga0495632_0001898 3300046519 Bacteria 16724
323 Ga0495632_0002919 3300046519 Bacteria 12544
324 Ga0495632_0013819 3300046519 Bacteria 4590
325 Ga0495632_0041398 3300046519 Bacteria 2315
326 Ga0495632_0076418 3300046519 Bacteria 1601
327 Ga0495632_0110609 3300046519 Bacteria 1290
328 Ga0495637_0000004 3300046520 Bacteria 589740
329 Ga0495643_0000787 3300046522 Bacteria 35192
330 Ga0495643_0001650 3300046522 Bacteria 19636
331 Ga0495643_0010199 3300046522 Bacteria 5790
332 Ga0495643_0021153 3300046522 Bacteria 3738
333 Ga0495643_0077403 3300046522 Bacteria 1738
334 Ga0495644_0003474 3300046523 Bacteria 6234
335 Ga0495644_0013743 3300046523 Bacteria 3104
336 Ga0495644_0014908 3300046523 Bacteria 2976
337 Ga0495644_0024433 3300046523 Bacteria 2298
338 Ga0495644_0037233 3300046523 Bacteria 1835
339 Ga0495644_0060588 3300046523 Bacteria 1422
340 Ga0495648_0000118 3300046524 Bacteria 95878
341 Ga0495648_0002143 3300046524 Bacteria 18595
342 Ga0495648_0003243 3300046524 Bacteria 14420
343 Ga0495648_0006869 3300046524 Bacteria 9188
344 Ga0495648_0042560 3300046524 Bacteria 2856
345 Ga0495648_0049850 3300046524 Bacteria 2563
346 Ga0495648_0104202 3300046524 Bacteria 1558
347 Ga0495666_0005546 3300046526 Bacteria 6356
348 Ga0495642_0000060 3300046528 Bacteria 65690
349 Ga0495642_0000648 3300046528 Bacteria 17461
350 Ga0495642_0002840 3300046528 Bacteria 6912
351 Ga0495642_0003712 3300046528 Bacteria 5989
352 Ga0495642_0004279 3300046528 Bacteria 5549
353 Ga0495642_0018163 3300046528 Bacteria 2751
354 Ga0495642_0041892 3300046528 Bacteria 1863
355 Ga0495652_0023959 3300046529 Bacteria 5406
356 Ga0495654_0000276 3300046530 Bacteria 46492
357 Ga0495654_0023159 3300046530 Bacteria 3218
358 Ga0495654_0028871 3300046530 Bacteria 2833
359 Ga0495654_0032648 3300046530 Bacteria 2638
360 Ga0495654_0089741 3300046530 Bacteria 1428
361 Ga0495640_0113041 3300046533 Bacteria 1772
362 Ga0495586_0010512 3300046535 Bacteria 4923
363 Ga0495586_0022138 3300046535 Bacteria 3391
364 Ga0495587_0050978 3300046536 Bacteria 2448
365 Ga0495609_0000059 3300046538 Bacteria 142403
366 Ga0495609_0000987 3300046538 Bacteria 20321
367 Ga0495609_0007272 3300046538 Bacteria 5545
368 Ga0495609_0009818 3300046538 Bacteria 4615
369 Ga0495609_0012095 3300046538 Bacteria 4097
370 Ga0495609_0027721 3300046538 Bacteria 2587
371 Ga0495609_0034283 3300046538 Bacteria 2301
372 Ga0495609_0041149 3300046538 Bacteria 2078
373 Ga0495609_0092209 3300046538 Bacteria 1317
374 Ga0495609_0130147 3300046538 Bacteria 1078
375 Ga0495597_0000274 3300046542 Bacteria 46959
376 Ga0495597_0000554 3300046542 Bacteria 31077
377 Ga0495597_0002485 3300046542 Bacteria 11632
378 Ga0495597_0003899 3300046542 Bacteria 8426
379 Ga0495597_0013281 3300046542 Bacteria 3950
380 Ga0495597_0051840 3300046542 Bacteria 1808
381 Ga0495645_0122449 3300046543 Bacteria 1830
382 Ga0495645_0227224 3300046543 Bacteria 1252
383 Ga0495622_0011514 3300046557 Bacteria 4087
384 Ga0495622_0025367 3300046557 Bacteria 2769
385 Ga0495633_0002512 3300046558 Bacteria 12904
386 Ga0495633_0003520 3300046558 Bacteria 10379
387 Ga0495633_0004820 3300046558 Bacteria 8461
388 Ga0495633_0007858 3300046558 Bacteria 6086
389 Ga0495633_0008942 3300046558 Bacteria 5581
390 Ga0495633_0011043 3300046558 Bacteria 4900
391 Ga0495633_0022885 3300046558 Bacteria 3100
392 Ga0495633_0053585 3300046558 Bacteria 1899
393 Ga0495633_0092277 3300046558 Bacteria 1407
394 Ga0495633_0100057 3300046558 Bacteria 1346
395 Ga0495656_0006196 3300046615 Bacteria 4185
396 Ga0495656_0038285 3300046615 Bacteria 1985
397 Ga0495668_0000682 3300046616 Bacteria 40861
398 Ga0495668_0001339 3300046616 Bacteria 24223
399 Ga0495668_0001688 3300046616 Bacteria 20428
400 Ga0495668_0002654 3300046616 Bacteria 14375
401 Ga0495668_0007057 3300046616 Bacteria 7236
402 Ga0495668_0009569 3300046616 Bacteria 5937
403 Ga0495668_0013029 3300046616 Bacteria 4920
404 Ga0495668_0047226 3300046616 Bacteria 2390
405 Ga0495668_0055215 3300046616 Bacteria 2193
406 Ga0495611_0000328 3300046648 Bacteria 31136
407 Ga0495611_0001420 3300046648 Bacteria 11957
408 Ga0495611_0004896 3300046648 Bacteria 5747
409 Ga0495611_0047884 3300046648 Bacteria 1919
410 Ga0495611_0051924 3300046648 Bacteria 1848
411 Ga0495625_0022206 3300046660 Bacteria 4869
412 Ga0495625_0074242 3300046660 Bacteria 2382
413 Ga0495625_0119353 3300046660 Bacteria 1796
414 Ga0495635_0001764 3300046663 Bacteria 14591
415 Ga0495661_0000259 3300046665 Bacteria 60869
416 Ga0495661_0000647 3300046665 Bacteria 35294
417 Ga0495661_0001779 3300046665 Bacteria 17316
418 Ga0495661_0003205 3300046665 Bacteria 12217
419 Ga0495661_0003234 3300046665 Bacteria 12140
420 Ga0495661_0004153 3300046665 Bacteria 10531
421 Ga0495661_0011989 3300046665 Bacteria 5866
422 Ga0495661_0025013 3300046665 Bacteria 3862
423 Ga0495661_0025858 3300046665 Bacteria 3786
424 Ga0495661_0033720 3300046665 Bacteria 3227
425 Ga0495661_0034226 3300046665 Bacteria 3197
426 Ga0495661_0037314 3300046665 Bacteria 3034
427 Ga0495661_0068561 3300046665 Bacteria 2080
428 Ga0495588_0000137 3300046674 Bacteria 114279
429 Ga0495588_0009704 3300046674 Bacteria 4460
430 Ga0495588_0015420 3300046674 Bacteria 3678
431 Ga0495588_0017529 3300046674 Bacteria 3480
432 Ga0495588_0039793 3300046674 Bacteria 2396
433 Ga0495588_0042623 3300046674 Bacteria 2320
434 Ga0495588_0056454 3300046674 Bacteria 2027
435 Ga0495623_0022033 3300046679 Bacteria 4116
436 Ga0495646_0170156 3300046680 Bacteria 1201
437 Ga0495669_0000120 3300046684 Bacteria 50677
438 Ga0495669_0000516 3300046684 Bacteria 17588
439 Ga0495669_0001191 3300046684 Bacteria 10809
440 Ga0495669_0021706 3300046684 Bacteria 2789
441 Ga0495669_0034181 3300046684 Bacteria 2240
442 Ga0495669_0039512 3300046684 Bacteria 2089
443 Ga0495613_0015597 3300046689 Bacteria 5653
444 Ga0495613_0047884 3300046689 Bacteria 3157
445 Ga0495670_0001524 3300046691 Bacteria 11316
446 Ga0495670_0002554 3300046691 Bacteria 8991
447 Ga0495670_0011218 3300046691 Bacteria 4404
448 Ga0495670_0013153 3300046691 Bacteria 4069
449 Ga0495670_0019668 3300046691 Bacteria 3328
450 Ga0495670_0022759 3300046691 Bacteria 3094
451 Ga0495670_0023486 3300046691 Bacteria 3043
452 Ga0495671_0000275 3300046692 Bacteria 43068
453 Ga0495671_0013692 3300046692 Bacteria 4383
454 Ga0495671_0016774 3300046692 Bacteria 3905
455 Ga0495649_0000122 3300046694 Bacteria 68254
456 Ga0495649_0004107 3300046694 Bacteria 9564
457 Ga0495649_0009673 3300046694 Bacteria 5715
458 Ga0495649_0016860 3300046694 Bacteria 4135
459 Ga0495649_0027927 3300046694 Bacteria 3129
460 Ga0495649_0053090 3300046694 Bacteria 2195
461 Ga0495649_0078715 3300046694 Bacteria 1763
462 Ga0495649_0110268 3300046694 Bacteria 1459
463 Ga0495589_0000052 3300046794 Bacteria 111467
464 Ga0495589_0000185 3300046794 Bacteria 55116
465 Ga0495589_0001210 3300046794 Bacteria 15349
466 Ga0495589_0002207 3300046794 Bacteria 10961
467 Ga0495589_0006148 3300046794 Bacteria 6341
468 Ga0495589_0012254 3300046794 Bacteria 4447
469 Ga0495589_0016225 3300046794 Bacteria 3827
470 Ga0495589_0020361 3300046794 Bacteria 3392
471 Ga0495589_0029142 3300046794 Bacteria 2782
472 Ga0495589_0043304 3300046794 Bacteria 2241
473 Ga0495660_0000154 3300046810 Bacteria 74753
474 Ga0495660_0005463 3300046810 Bacteria 7612
475 Ga0495660_0006813 3300046810 Bacteria 6737
476 Ga0495660_0007198 3300046810 Bacteria 6551
477 Ga0495660_0008450 3300046810 Bacteria 6029
478 Ga0495660_0010475 3300046810 Bacteria 5391
479 Ga0495581_0008782 3300047315 Bacteria 5849
480 Ga0495604_0020837 3300047317 Bacteria 5234
481 Ga0495672_0000237 3300047320 Bacteria 78194
482 Ga0495672_0000579 3300047320 Bacteria 41410
483 Ga0495672_0000603 3300047320 Bacteria 40496
484 Ga0495672_0002539 3300047320 Bacteria 16649
485 Ga0495672_0021462 3300047320 Bacteria 4212
486 Ga0495672_0050383 3300047320 Bacteria 2458
487 Ga0495672_0085137 3300047320 Bacteria 1752
488 Ga0495672_0099608 3300047320 Bacteria 1579
489 Ga0495676_0000243 3300047321 Bacteria 43967
490 Ga0495680_0016123 3300047322 Bacteria 6424
491 Ga0495683_0000079 3300047323 Bacteria 96333
492 Ga0495683_0000296 3300047323 Bacteria 42776
493 Ga0495683_0006650 3300047323 Bacteria 6301
494 Ga0495683_0014047 3300047323 Bacteria 4171
495 Ga0495683_0017410 3300047323 Bacteria 3725
496 Ga0495683_0055516 3300047323 Bacteria 1971
497 Ga0495683_0067172 3300047323 Bacteria 1765
498 Ga0495687_000087 3300047443 Bacteria 142540
499 Ga0495687_000226 3300047443 Bacteria 79404
500 Ga0495687_000263 3300047443 Bacteria 70773
501 Ga0495687_000275 3300047443 Bacteria 68138
502 Ga0495687_000695 3300047443 Bacteria 37969
503 Ga0495687_000831 3300047443 Bacteria 32963
504 Ga0495675_0008913 3300047444 Bacteria 6234
505 Ga0495677_0000033 3300047445 Bacteria 83783
506 Ga0495677_0000359 3300047445 Bacteria 19726
507 Ga0495677_0000747 3300047445 Bacteria 13135
508 Ga0495677_0001425 3300047445 Bacteria 9585
509 Ga0495677_0002594 3300047445 Bacteria 7069
510 Ga0495677_0002820 3300047445 Bacteria 6778
511 Ga0495677_0003300 3300047445 Bacteria 6285
512 Ga0495677_0003383 3300047445 Bacteria 6204
513 Ga0495677_0017460 3300047445 Bacteria 2601
514 Ga0495677_0078925 3300047445 Bacteria 1232
515 Ga0495679_003638 3300047446 Bacteria 7366
516 Ga0495679_013039 3300047446 Bacteria 3136
517 Ga0495679_022462 3300047446 Bacteria 2158
518 Ga0495685_003984 3300047447 Bacteria 4746
519 Ga0495685_014028 3300047447 Bacteria 2719
520 Ga0495685_019480 3300047447 Bacteria 2332
521 Ga0495681_0000264 3300047470 Bacteria 42342
522 Ga0495681_0000802 3300047470 Bacteria 24208
523 Ga0495681_0003014 3300047470 Bacteria 11839
524 Ga0495681_0004990 3300047470 Bacteria 8951
525 Ga0495681_0006614 3300047470 Bacteria 7578
526 Ga0495681_0014549 3300047470 Bacteria 4500
527 Ga0495681_0020065 3300047470 Bacteria 3634
528 Ga0495681_0028954 3300047470 Bacteria 2840
529 Ga0495681_0034859 3300047470 Bacteria 2503
530 Ga0495681_0051870 3300047470 Bacteria 1927
531 Ga0495686_0000364 3300047472 Bacteria 73360
532 Ga0495686_0005467 3300047472 Bacteria 10012
533 Ga0495686_0016124 3300047472 Bacteria 5077
534 Ga0495686_0037623 3300047472 Bacteria 3099
535 Ga0495686_0045480 3300047472 Bacteria 2777
536 Ga0495593_0005405 3300047673 Bacteria 7550
537 Ga0495593_0009480 3300047673 Bacteria 5646
538 Ga0495593_0139674 3300047673 Bacteria 1227
539 Ga0495602_0011455 3300048088 Bacteria 9169
540 Ga0495614_0004888 3300048089 Bacteria 6045
541 Ga0495614_0025426 3300048089 Bacteria 2553
542 Ga0495626_0000085 3300048091 Bacteria 125255
543 Ga0495626_0000316 3300048091 Bacteria 50961
544 Ga0495626_0000867 3300048091 Bacteria 26890
545 Ga0495626_0002571 3300048091 Bacteria 12432
546 Ga0495626_0002887 3300048091 Bacteria 11458
547 Ga0495626_0006583 3300048091 Bacteria 6587
548 Ga0495626_0012051 3300048091 Bacteria 4549
549 Ga0495626_0014425 3300048091 Bacteria 4074
550 Ga0495626_0016046 3300048091 Bacteria 3816
551 Ga0495626_0024371 3300048091 Bacteria 2967
552 Ga0495626_0024876 3300048091 Bacteria 2932
553 Ga0495626_0025620 3300048091 Bacteria 2882
554 Ga0495626_0033526 3300048091 Bacteria 2460
555 Ga0495626_0052637 3300048091 Bacteria 1876
556 Ga0495626_0077701 3300048091 Bacteria 1479
557 Ga0496100_0129009 3300048903 Bacteria 1778
558 Ga0496100_0293962 3300048903 Bacteria 1214
559 Ga0496101_0009394 3300048904 Bacteria 6427
560 Ga0496101_0310392 3300048904 Bacteria 1236
561 Ga0496102_0000606 3300048905 Bacteria 37428
562 Ga0496102_0015543 3300048905 Bacteria 6632
563 Ga0496106_0040575 3300048909 Bacteria 3486
564 Ga0496107_0031031 3300048910 Bacteria 3811
565 Ga0496107_0269398 3300048910 Bacteria 1267
566 Ga0496109_0024501 3300048912 Bacteria 5365
567 Ga0496110_0000181 3300048913 Bacteria 39279
568 Ga0496110_0191962 3300048913 Bacteria 1855
569 Ga0496111_0119356 3300048914 Bacteria 1948
570 Ga0496112_0150227 3300048915 Bacteria 2297
571 Ga0496113_0028141 3300048916 Bacteria 4039
572 Ga0496115_0070927 3300048918 Bacteria 2825
573 Ga0496115_0289642 3300048918 Bacteria 1343
574 Ga0496117_0000461 3300048920 Bacteria 68034
575 Ga0496117_0001482 3300048920 Bacteria 33689
576 Ga0496118_0000106 3300048921 Bacteria 155884
577 Ga0496118_0001585 3300048921 Bacteria 33713
578 Ga0496121_0000871 3300048924 Bacteria 54544
579 Ga0496121_0002025 3300048924 Bacteria 32154
580 Ga0496121_0107692 3300048924 Bacteria 2134
581 Ga0496122_0001143 3300048925 Bacteria 45515
582 Ga0496122_0001696 3300048925 Bacteria 34177
583 Ga0496122_0004800 3300048925 Bacteria 16517
584 Ga0496122_0007880 3300048925 Bacteria 11691
585 Ga0496122_0011463 3300048925 Bacteria 8973
586 Ga0496123_0000797 3300048926 Bacteria 50962
587 Ga0496123_0011762 3300048926 Bacteria 7540
588 Ga0496123_0023703 3300048926 Bacteria 4690
589 Ga0496123_0057722 3300048926 Bacteria 2524
590 Ga0496124_0019871 3300048927 Bacteria 6231
591 Ga0496124_0029923 3300048927 Bacteria 4844
592 Ga0496124_0049172 3300048927 Bacteria 3598
593 Ga0496124_0144289 3300048927 Bacteria 1875
594 Ga0496125_0000038 3300048928 Bacteria 328120
595 Ga0496125_0000619 3300048928 Bacteria 60020
596 Ga0496125_0001480 3300048928 Bacteria 33930
597 Ga0496125_0011947 3300048928 Bacteria 8648
598 Ga0496125_0023411 3300048928 Bacteria 5701
599 Ga0496126_0032096 3300048929 Bacteria 4953
600 Ga0495678_000170 3300049459 Bacteria 75931
601 Ga0495678_000482 3300049459 Bacteria 39648
602 Ga0495678_000529 3300049459 Bacteria 37097
603 Ga0495678_000854 3300049459 Bacteria 27183
604 Ga0495678_033993 3300049459 Bacteria 2101
605 Ga0495682_0000907 3300049460 Bacteria 18135
606 Ga0495682_0010748 3300049460 Bacteria 3535
607 Ga0495682_0012489 3300049460 Bacteria 3255
608 Ga0495682_0014536 3300049460 Bacteria 2984
609 Ga0501034_0092032 3300049571 Bacteria 3030
610 Ga0501042_0244802 3300049578 Bacteria 1294
611 Ga0501222_000076 3300049662 Bacteria 27930
612 Ga0501080_0337016 3300049742 Bacteria 1363
613 Ga0501035_0000937 3300049822 Bacteria 30807
614 Ga0501226_000464 3300049853 Bacteria 5705
615 Ga0500616_0021874 3300053153 Bacteria 3577
616 Ga0587083_0001550 3300059505 Bacteria 2622
617 Ga0587068_001715 3300059641 Bacteria 2525
618 Ga0587072_004261 3300059643 Bacteria 2067
619 Ga0466962_0081232 3300061719 Bacteria 1550

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048091 Ga0495626_0052637 Ga0495626_0052637_17_835 261
2 3300047320 Ga0495672_0021462 Ga0495672_0021462_3370_4197 275
3 3300048910 Ga0496107_0269398 Ga0496107_0269398_29_907 280
4 3300048091 Ga0495626_0024371 Ga0495626_0024371_2109_2957 282
5 2162886011 MRS1b_contig_6168241 MRS1b_0740.00000050 305
6 3300046660 Ga0495625_0119353 Ga0495625_0119353_18_959 313
7 iso_pu_bacteria 2882806704 2882807180 319
8 3300031727 Ga0316576_10034599 Ga0316576_100345993 321
9 3300031727 Ga0316576_10157845 Ga0316576_101578451 321
10 3300031728 Ga0316578_10125354 Ga0316578_101253542 321
11 3300045051 Ga0451576_0001042 Ga0451576_0001042_34937_35947 322
12 3300046522 Ga0495643_0000787 Ga0495643_0000787_29631_30638 322
13 3300046538 Ga0495609_0130147 Ga0495609_0130147_57_1067 322
14 3300048091 Ga0495626_0014425 Ga0495626_0014425_514_1521 322
15 iso_pu_bacteria 639633007 639788844 322
16 3300031731 Ga0307405_10001329 Ga0307405_1000132911 323
17 3300031911 Ga0307412_10032428 Ga0307412_100324283 323
18 3300045051 Ga0451576_0000165 Ga0451576_0000165_76033_77043 323
19 3300049571 Ga0501034_0092032 Ga0501034_0092032_1218_2228 323
20 3300049578 Ga0501042_0244802 Ga0501042_0244802_161_1171 323
21 iso_pu_bacteria 2599185169 2599412741 323
22 iso_pu_bacteria 2600255254 2601525759 323
23 iso_pu_bacteria 2600255255 2601528055 323
24 iso_pu_bacteria 2600255280 2601614889 323
25 iso_pu_bacteria 2600255281 2601620186 323
26 iso_pu_bacteria 2600255287 2601645970 323
27 iso_pu_bacteria 2600255288 2601648588 323
28 iso_pu_bacteria 2600255289 2601652944 323
29 iso_pu_bacteria 2600255290 2601658939 323
30 iso_pu_bacteria 2600255291 2601666040 323
31 iso_pu_bacteria 2600255298 2601698927 323
32 iso_pu_bacteria 2600255299 2601703909 323
33 iso_pu_bacteria 2600255300 2601705595 323
34 iso_pu_bacteria 2600255301 2601711184 323
35 iso_pu_bacteria 2600255302 2601716198 323
36 iso_pu_bacteria 2600255303 2601723843 323
37 iso_pu_bacteria 2600255304 2601726604 323
38 iso_pu_bacteria 2600255305 2601731144 323
39 iso_pu_bacteria 2600255306 2601736160 323
40 iso_pu_bacteria 2600255307 2601743511 323
41 iso_pu_bacteria 2600255309 2601754131 323
42 iso_pu_bacteria 2600255392 2602021243 323
43 iso_pu_bacteria 2602042052 2603658904 323
44 iso_pu_bacteria 2602042053 2603663692 323
45 iso_pu_bacteria 2602042103 2603838542 323
46 iso_pu_bacteria 2602042104 2603844204 323
47 iso_pu_bacteria 2602042105 2603848693 323
48 iso_pu_bacteria 2602042106 2603853766 323
49 iso_pu_bacteria 2602042110 2603871818 323
50 iso_pu_bacteria 2602042111 2603879285 323
51 iso_pu_bacteria 2603880178 2606049006 323
52 iso_pu_bacteria 2603880184 2606068118 323
53 iso_pu_bacteria 2603880202 2606146684 323
54 iso_pu_bacteria 2603880211 2606176411 323
55 iso_pu_bacteria 2643221554 2643787250 323
56 iso_pu_bacteria 2643221556 2643801957 323
57 iso_pu_bacteria 2643221638 2644215676 323
58 iso_pu_bacteria 2643221684 2644473890 323
59 iso_pu_bacteria 2675903046 2676409656 323
60 iso_pu_bacteria 2808606418 2809145179 323
61 iso_pu_bacteria 2857558681 2857559825 323
62 iso_pu_bacteria 2919476304 2919478653 323
63 iso_pu_bacteria 2984559226 2984563242 323
64 iso_pu_bacteria 2984595703 2984595978 323
65 iso_pu_bacteria 8047673197 8047674037 323
66 3300005262 Ga0065165_1000723 Ga0065165_10007237 324
67 3300046471 Ga0495650_0019540 Ga0495650_0019540_40_1050 324
68 3300005435 Ga0070714_100151392 Ga0070714_1001513922 325
69 3300025728 Ga0207655_1016977 Ga0207655_10169773 325
70 3300053153 Ga0500616_0021874 Ga0500616_0021874_27_1046 325
71 3300049742 Ga0501080_0337016 Ga0501080_0337016_60_1040 326
72 iso_pu_bacteria 2599185289 2599884316 326
73 iso_pu_bacteria 2599185291 2599896505 326
74 iso_pu_bacteria 2599185315 2600016114 326
75 iso_pu_bacteria 2599185317 2600030811 326
76 iso_pu_bacteria 2599185321 2600051320 326
77 iso_pu_bacteria 2600254930 2600360616 326
78 iso_pu_bacteria 2651869719 2652543378 326
79 iso_pu_bacteria 2667528170 2671089200 326
80 iso_pu_bacteria 2675903515 2678263300 326
81 iso_pu_bacteria 2744054620 2745009631 326
82 iso_pu_bacteria 2825651385 2825652531 326
83 iso_pu_bacteria 2842854478 2842855295 326
84 iso_pu_bacteria 2913036834 2913041628 326
85 iso_pu_bacteria 2929144301 2929146776 326
86 iso_pu_bacteria 8056143049 8056146566 326
87 3300002739 JGI25158J39367_1000851 JGI25158J39367_10008514 327
88 3300002773 JGI25152J39213_1013788 JGI25152J39213_10137882 327
89 3300002774 JGI25150J39212_1000554 JGI25150J39212_10005549 327
90 3300002774 JGI25150J39212_1000999 JGI25150J39212_10009994 327
91 3300002987 JGI25159J45721_1003101 JGI25159J45721_10031013 327
92 3300002987 JGI25159J45721_1005160 JGI25159J45721_10051602 327
93 3300003215 JGI25153J46596_10013131 JGI25153J46596_100131312 327
94 3300003374 JGI25161J50226_1000776 JGI25161J50226_10007769 327
95 3300003374 JGI25161J50226_1008967 JGI25161J50226_10089671 327
96 3300003575 Ga0007409J51694_1008320 Ga0007409J51694_10083204 327
97 3300003575 Ga0007409J51694_1008322 Ga0007409J51694_10083222 327
98 3300003759 Ga0055525_1000001 Ga0055525_1000001272 327
99 3300003771 Ga0055526_1000198 Ga0055526_100019823 327
100 3300003771 Ga0055526_1002566 Ga0055526_10025669 327
101 3300003771 Ga0055526_1003773 Ga0055526_10037737 327
102 3300003773 Ga0055537_1001803 Ga0055537_10018032 327
103 3300003775 Ga0055524_1001038 Ga0055524_100103811 327
104 3300003775 Ga0055524_1002298 Ga0055524_10022986 327
105 3300003775 Ga0055524_1009932 Ga0055524_10099325 327
106 3300003784 Ga0055534_1006496 Ga0055534_10064961 327
107 3300003790 Ga0055528_1011745 Ga0055528_10117453 327
108 3300004625 Ga0055543_1000777 Ga0055543_10007776 327
109 3300005262 Ga0065165_1001842 Ga0065165_10018424 327
110 3300005344 Ga0070661_100024933 Ga0070661_1000249332 327
111 3300005366 Ga0070659_100036315 Ga0070659_1000363154 327
112 3300005366 Ga0070659_100102547 Ga0070659_1001025473 327
113 3300005457 Ga0070662_100233040 Ga0070662_1002330401 327
114 3300005563 Ga0068855_100034781 Ga0068855_1000347813 327
115 3300005564 Ga0070664_100232213 Ga0070664_1002322132 327
116 3300006358 Ga0068871_100334105 Ga0068871_1003341052 327
117 3300006881 Ga0068865_100104507 Ga0068865_1001045072 327
118 3300009011 Ga0105251_10055736 Ga0105251_100557363 327
119 3300009036 Ga0105244_10034780 Ga0105244_100347803 327
120 3300009098 Ga0105245_10133908 Ga0105245_101339082 327
121 3300009148 Ga0105243_10050043 Ga0105243_100500433 327
122 3300009174 Ga0105241_10117288 Ga0105241_101172882 327
123 3300009176 Ga0105242_10019519 Ga0105242_100195194 327
124 3300010375 Ga0105239_10483052 Ga0105239_104830522 327
125 3300013296 Ga0157374_10129932 Ga0157374_101299322 327
126 3300013297 Ga0157378_10630356 Ga0157378_106303561 327
127 3300025208 Ga0209436_100243 Ga0209436_10024310 327
128 3300025208 Ga0209436_100739 Ga0209436_1007394 327
129 3300025230 Ga0209563_100007 Ga0209563_100007825 327
130 3300025245 Ga0207425_1000001 Ga0207425_10000011627 327
131 3300025245 Ga0207425_1000089 Ga0207425_100008974 327
132 3300025253 Ga0209677_101317 Ga0209677_1013175 327
133 3300025254 Ga0209148_1000320 Ga0209148_100032037 327
134 3300025258 Ga0209129_1000001 Ga0209129_1000001804 327
135 3300025258 Ga0209129_1003360 Ga0209129_10033606 327
136 3300025263 Ga0209565_1001261 Ga0209565_100126110 327
137 3300025263 Ga0209565_1002264 Ga0209565_10022645 327
138 3300025273 Ga0209673_1004003 Ga0209673_10040033 327
139 3300025284 Ga0209130_1000407 Ga0209130_100040710 327
140 3300025284 Ga0209130_1000994 Ga0209130_10009948 327
141 3300025284 Ga0209130_1001239 Ga0209130_10012398 327
142 3300025291 Ga0209675_1001997 Ga0209675_10019979 327
143 3300025291 Ga0209675_1006810 Ga0209675_10068102 327
144 3300025295 Ga0209564_1000009 Ga0209564_1000009451 327
145 3300025295 Ga0209564_1000178 Ga0209564_1000178122 327
146 3300025295 Ga0209564_1009436 Ga0209564_10094362 327
147 3300025297 Ga0209758_1000116 Ga0209758_100011665 327
148 3300025298 Ga0209050_1000480 Ga0209050_100048010 327
149 3300025298 Ga0209050_1024807 Ga0209050_10248073 327
150 3300025299 Ga0209256_1000297 Ga0209256_100029768 327
151 3300025299 Ga0209256_1000515 Ga0209256_100051516 327
152 3300025299 Ga0209256_1000635 Ga0209256_100063510 327
153 3300025302 Ga0207426_1002747 Ga0207426_10027474 327
154 3300025303 Ga0209051_1016724 Ga0209051_10167242 327
155 3300025304 Ga0209257_1000293 Ga0209257_100029371 327
156 3300025909 Ga0207705_10356400 Ga0207705_103564001 327
157 3300025911 Ga0207654_10023215 Ga0207654_100232154 327
158 3300025919 Ga0207657_10026879 Ga0207657_100268796 327
159 3300025927 Ga0207687_10260619 Ga0207687_102606191 327
160 3300025932 Ga0207690_10131622 Ga0207690_101316222 327
161 3300025933 Ga0207706_10035699 Ga0207706_100356995 327
162 3300025934 Ga0207686_10002105 Ga0207686_100021056 327
163 3300025935 Ga0207709_10039221 Ga0207709_100392213 327
164 3300025949 Ga0207667_10010303 Ga0207667_1001030312 327
165 3300027312 Ga0209371_1000477 Ga0209371_100047728 327
166 3300030500 Ga0268256_1000405 Ga0268256_100040528 327
167 3300031548 Ga0307408_100000098 Ga0307408_10000009815 327
168 3300031548 Ga0307408_100000870 Ga0307408_10000087014 327
169 3300031548 Ga0307408_100224212 Ga0307408_1002242122 327
170 3300037312 Ga0395899_0012567 Ga0395899_0012567_4250_5275 327
171 3300037312 Ga0395899_0016298 Ga0395899_0016298_2705_3763 327
172 3300037312 Ga0395899_0047842 Ga0395899_0047842_86_1111 327
173 3300037312 Ga0395899_0159332 Ga0395899_0159332_399_1424 327
174 3300037418 Ga0395900_0001489 Ga0395900_0001489_3861_4886 327
175 3300037418 Ga0395900_0047209 Ga0395900_0047209_1238_2263 327
176 3300037418 Ga0395900_0050199 Ga0395900_0050199_215_1240 327
177 3300037418 Ga0395900_0226854 Ga0395900_0226854_134_1159 327
178 3300037418 Ga0395900_0413072 Ga0395900_0413072_239_1264 327
179 3300037466 Ga0395898_0007100 Ga0395898_0007100_8243_9268 327
180 3300037466 Ga0395898_0099288 Ga0395898_0099288_1093_2118 327
181 3300037471 Ga0395905_0079517 Ga0395905_0079517_1975_3000 327
182 3300037471 Ga0395905_0082558 Ga0395905_0082558_264_1289 327
183 3300037471 Ga0395905_0178494 Ga0395905_0178494_484_1509 327
184 3300037471 Ga0395905_0350813 Ga0395905_0350813_146_1171 327
185 3300038443 Ga0395901_0000491 Ga0395901_0000491_3997_5022 327
186 3300038443 Ga0395901_0010628 Ga0395901_0010628_7452_8477 327
187 3300038443 Ga0395901_0039708 Ga0395901_0039708_2434_3459 327
188 3300038443 Ga0395901_0106989 Ga0395901_0106989_727_1752 327
189 3300038443 Ga0395901_0113204 Ga0395901_0113204_1554_2612 327
190 3300042005 Ga0439448_0039649 Ga0439448_0039649_229_1254 327
191 3300042012 Ga0439455_0016756 Ga0439455_0016756_219_1238 327
192 3300042157 Ga0439458_0018071 Ga0439458_0018071_526_1551 327
193 3300044658 Ga0466972_0044681 Ga0466972_0044681_133_1191 327
194 3300044658 Ga0466972_0080880 Ga0466972_0080880_471_1496 327
195 3300044658 Ga0466972_0103530 Ga0466972_0103530_193_1218 327
196 3300044683 Ga0466965_0005810 Ga0466965_0005810_840_1865 327
197 3300044684 Ga0466966_0005398 Ga0466966_0005398_1138_2163 327
198 3300044684 Ga0466966_0021850 Ga0466966_0021850_3093_4118 327
199 3300044693 Ga0466961_0108168 Ga0466961_0108168_90_1148 327
200 3300044706 Ga0466964_0002326 Ga0466964_0002326_4055_5080 327
201 3300044706 Ga0466964_0003695 Ga0466964_0003695_510_1535 327
202 3300044706 Ga0466964_0047805 Ga0466964_0047805_58_1083 327
203 3300044735 Ga0466968_0007634 Ga0466968_0007634_608_1633 327
204 3300044842 Ga0466957_0000089 Ga0466957_0000089_32786_33811 327
205 3300044842 Ga0466957_0002847 Ga0466957_0002847_7348_8373 327
206 3300044842 Ga0466957_0100190 Ga0466957_0100190_228_1253 327
207 3300045049 Ga0466959_0199835 Ga0466959_0199835_44_1069 327
208 3300045836 Ga0466958_0070545 Ga0466958_0070545_812_1837 327
209 3300045836 Ga0466958_0157524 Ga0466958_0157524_288_1313 327
210 3300045976 Ga0466967_0028783 Ga0466967_0028783_1029_2054 327
211 3300045976 Ga0466967_0077670 Ga0466967_0077670_682_1707 327
212 3300046452 Ga0495617_000070 Ga0495617_000070_26798_27865 327
213 3300046452 Ga0495617_011150 Ga0495617_011150_563_1588 327
214 3300046453 Ga0495627_000201 Ga0495627_000201_58104_59171 327
215 3300046453 Ga0495627_002489 Ga0495627_002489_2135_3160 327
216 3300046455 Ga0495603_0011297 Ga0495603_0011297_3557_4582 327
217 3300046457 Ga0495590_0000060 Ga0495590_0000060_68276_69319 327
218 3300046457 Ga0495590_0003557 Ga0495590_0003557_5193_6224 327
219 3300046458 Ga0495591_000190 Ga0495591_000190_17210_18253 327
220 3300046460 Ga0495638_0002326 Ga0495638_0002326_8357_9418 327
221 3300046460 Ga0495638_0049512 Ga0495638_0049512_1029_2060 327
222 3300046471 Ga0495650_0000611 Ga0495650_0000611_3946_4971 327
223 3300046473 Ga0495582_0084025 Ga0495582_0084025_549_1574 327
224 3300046474 Ga0495605_0000154 Ga0495605_0000154_23298_24323 327
225 3300046474 Ga0495605_0000161 Ga0495605_0000161_26607_27674 327
226 3300046474 Ga0495605_0000967 Ga0495605_0000967_408_1439 327
227 3300046474 Ga0495605_0001972 Ga0495605_0001972_9306_10289 327
228 3300046474 Ga0495605_0005317 Ga0495605_0005317_5710_6735 327
229 3300046474 Ga0495605_0005436 Ga0495605_0005436_252_1271 327
230 3300046474 Ga0495605_0019147 Ga0495605_0019147_2264_3289 327
231 3300046474 Ga0495605_0026472 Ga0495605_0026472_1487_2530 327
232 3300046474 Ga0495605_0065042 Ga0495605_0065042_157_1218 327
233 3300046491 Ga0495584_0000059 Ga0495584_0000059_9708_10733 327
234 3300046491 Ga0495584_0000275 Ga0495584_0000275_4118_5161 327
235 3300046491 Ga0495584_0000639 Ga0495584_0000639_17599_18582 327
236 3300046491 Ga0495584_0001361 Ga0495584_0001361_10114_11139 327
237 3300046491 Ga0495584_0001892 Ga0495584_0001892_3576_4601 327
238 3300046491 Ga0495584_0009418 Ga0495584_0009418_2447_3466 327
239 3300046491 Ga0495584_0082188 Ga0495584_0082188_359_1420 327
240 3300046492 Ga0495585_0000084 Ga0495585_0000084_87290_88315 327
241 3300046492 Ga0495585_0000122 Ga0495585_0000122_32237_33262 327
242 3300046492 Ga0495585_0000215 Ga0495585_0000215_51087_52112 327
243 3300046492 Ga0495585_0000522 Ga0495585_0000522_10144_11169 327
244 3300046492 Ga0495585_0003664 Ga0495585_0003664_5198_6235 327
245 3300046492 Ga0495585_0003757 Ga0495585_0003757_4523_5548 327
246 3300046492 Ga0495585_0007654 Ga0495585_0007654_3111_4154 327
247 3300046492 Ga0495585_0010373 Ga0495585_0010373_2810_3829 327
248 3300046492 Ga0495585_0074123 Ga0495585_0074123_511_1536 327
249 3300046499 Ga0495594_0000361 Ga0495594_0000361_4758_5783 327
250 3300046500 Ga0495596_0000100 Ga0495596_0000100_8129_9190 327
251 3300046500 Ga0495596_0003842 Ga0495596_0003842_2606_3673 327
252 3300046500 Ga0495596_0007852 Ga0495596_0007852_1324_2343 327
253 3300046500 Ga0495596_0007913 Ga0495596_0007913_415_1440 327
254 3300046500 Ga0495596_0008970 Ga0495596_0008970_1347_2384 327
255 3300046500 Ga0495596_0011671 Ga0495596_0011671_230_1255 327
256 3300046500 Ga0495596_0029930 Ga0495596_0029930_1110_2147 327
257 3300046500 Ga0495596_0033483 Ga0495596_0033483_374_1393 327
258 3300046500 Ga0495596_0096394 Ga0495596_0096394_31_1056 327
259 3300046501 Ga0495607_0000025 Ga0495607_0000025_60414_61397 327
260 3300046501 Ga0495607_0000619 Ga0495607_0000619_31059_32084 327
261 3300046501 Ga0495607_0003541 Ga0495607_0003541_6348_7391 327
262 3300046501 Ga0495607_0004523 Ga0495607_0004523_2208_3275 327
263 3300046501 Ga0495607_0007434 Ga0495607_0007434_6185_7207 327
264 3300046501 Ga0495607_0011264 Ga0495607_0011264_2623_3648 327
265 3300046501 Ga0495607_0042797 Ga0495607_0042797_623_1684 327
266 3300046501 Ga0495607_0056839 Ga0495607_0056839_553_1572 327
267 3300046501 Ga0495607_0064116 Ga0495607_0064116_959_1978 327
268 3300046506 Ga0495583_0000230 Ga0495583_0000230_24474_25499 327
269 3300046506 Ga0495583_0000754 Ga0495583_0000754_4065_5084 327
270 3300046506 Ga0495583_0000791 Ga0495583_0000791_4159_5202 327
271 3300046506 Ga0495583_0004131 Ga0495583_0004131_7180_8217 327
272 3300046506 Ga0495583_0014243 Ga0495583_0014243_2424_3443 327
273 3300046506 Ga0495583_0019079 Ga0495583_0019079_2551_3570 327
274 3300046506 Ga0495583_0021077 Ga0495583_0021077_2026_3051 327
275 3300046506 Ga0495583_0068847 Ga0495583_0068847_140_1201 327
276 3300046507 Ga0495606_0001284 Ga0495606_0001284_15422_16405 327
277 3300046507 Ga0495606_0011259 Ga0495606_0011259_135_1160 327
278 3300046507 Ga0495606_0013503 Ga0495606_0013503_4251_5276 327
279 3300046507 Ga0495606_0039492 Ga0495606_0039492_1468_2529 327
280 3300046507 Ga0495606_0073990 Ga0495606_0073990_355_1374 327
281 3300046512 Ga0495610_0005183 Ga0495610_0005183_414_1457 327
282 3300046513 Ga0495616_0000406 Ga0495616_0000406_31955_32980 327
283 3300046513 Ga0495616_0001911 Ga0495616_0001911_3615_4640 327
284 3300046513 Ga0495616_0002040 Ga0495616_0002040_2869_3894 327
285 3300046513 Ga0495616_0004109 Ga0495616_0004109_5964_6989 327
286 3300046513 Ga0495616_0004378 Ga0495616_0004378_1695_2714 327
287 3300046513 Ga0495616_0010810 Ga0495616_0010810_3482_4507 327
288 3300046513 Ga0495616_0011460 Ga0495616_0011460_830_1849 327
289 3300046513 Ga0495616_0012458 Ga0495616_0012458_3398_4417 327
290 3300046513 Ga0495616_0023840 Ga0495616_0023840_1710_2729 327
291 3300046513 Ga0495616_0024473 Ga0495616_0024473_1939_2982 327
292 3300046513 Ga0495616_0054111 Ga0495616_0054111_563_1546 327
293 3300046513 Ga0495616_0100288 Ga0495616_0100288_31_1053 327
294 3300046513 Ga0495616_0122043 Ga0495616_0122043_95_1120 327
295 3300046518 Ga0495631_0000319 Ga0495631_0000319_2558_3577 327
296 3300046518 Ga0495631_0002882 Ga0495631_0002882_678_1697 327
297 3300046518 Ga0495631_0006761 Ga0495631_0006761_4318_5361 327
298 3300046518 Ga0495631_0010660 Ga0495631_0010660_2858_3895 327
299 3300046518 Ga0495631_0019499 Ga0495631_0019499_279_1304 327
300 3300046518 Ga0495631_0020913 Ga0495631_0020913_470_1495 327
301 3300046518 Ga0495631_0033086 Ga0495631_0033086_1047_2114 327
302 3300046518 Ga0495631_0043374 Ga0495631_0043374_135_1196 327
303 3300046519 Ga0495632_0000147 Ga0495632_0000147_65763_66815 327
304 3300046519 Ga0495632_0000451 Ga0495632_0000451_3734_4771 327
305 3300046519 Ga0495632_0000514 Ga0495632_0000514_3524_4549 327
306 3300046519 Ga0495632_0001898 Ga0495632_0001898_11300_12322 327
307 3300046519 Ga0495632_0002919 Ga0495632_0002919_7429_8448 327
308 3300046519 Ga0495632_0013819 Ga0495632_0013819_1652_2713 327
309 3300046519 Ga0495632_0041398 Ga0495632_0041398_1206_2231 327
310 3300046519 Ga0495632_0076418 Ga0495632_0076418_414_1457 327
311 3300046519 Ga0495632_0110609 Ga0495632_0110609_128_1147 327
312 3300046520 Ga0495637_0000004 Ga0495637_0000004_335894_336937 327
313 3300046522 Ga0495643_0001650 Ga0495643_0001650_10862_11887 327
314 3300046522 Ga0495643_0010199 Ga0495643_0010199_1932_2963 327
315 3300046522 Ga0495643_0021153 Ga0495643_0021153_2011_3030 327
316 3300046522 Ga0495643_0077403 Ga0495643_0077403_579_1604 327
317 3300046523 Ga0495644_0003474 Ga0495644_0003474_5006_6031 327
318 3300046523 Ga0495644_0013743 Ga0495644_0013743_580_1599 327
319 3300046523 Ga0495644_0014908 Ga0495644_0014908_1480_2499 327
320 3300046523 Ga0495644_0037233 Ga0495644_0037233_397_1440 327
321 3300046523 Ga0495644_0060588 Ga0495644_0060588_257_1276 327
322 3300046524 Ga0495648_0000118 Ga0495648_0000118_64275_65300 327
323 3300046524 Ga0495648_0002143 Ga0495648_0002143_13652_14677 327
324 3300046524 Ga0495648_0003243 Ga0495648_0003243_9226_10245 327
325 3300046524 Ga0495648_0006869 Ga0495648_0006869_4708_5775 327
326 3300046524 Ga0495648_0042560 Ga0495648_0042560_763_1782 327
327 3300046524 Ga0495648_0049850 Ga0495648_0049850_1169_2194 327
328 3300046524 Ga0495648_0104202 Ga0495648_0104202_447_1472 327
329 3300046528 Ga0495642_0000060 Ga0495642_0000060_59009_60076 327
330 3300046528 Ga0495642_0000648 Ga0495642_0000648_12554_13579 327
331 3300046528 Ga0495642_0002840 Ga0495642_0002840_4774_5817 327
332 3300046528 Ga0495642_0003712 Ga0495642_0003712_4012_5037 327
333 3300046528 Ga0495642_0004279 Ga0495642_0004279_2467_3528 327
334 3300046528 Ga0495642_0018163 Ga0495642_0018163_699_1724 327
335 3300046530 Ga0495654_0023159 Ga0495654_0023159_1348_2373 327
336 3300046530 Ga0495654_0028871 Ga0495654_0028871_1585_2652 327
337 3300046530 Ga0495654_0032648 Ga0495654_0032648_493_1518 327
338 3300046530 Ga0495654_0089741 Ga0495654_0089741_376_1395 327
339 3300046536 Ga0495587_0050978 Ga0495587_0050978_913_1938 327
340 3300046538 Ga0495609_0000059 Ga0495609_0000059_31620_32645 327
341 3300046538 Ga0495609_0000987 Ga0495609_0000987_15191_16216 327
342 3300046538 Ga0495609_0007272 Ga0495609_0007272_1552_2577 327
343 3300046538 Ga0495609_0009818 Ga0495609_0009818_1525_2544 327
344 3300046538 Ga0495609_0012095 Ga0495609_0012095_2648_3670 327
345 3300046538 Ga0495609_0034283 Ga0495609_0034283_202_1263 327
346 3300046538 Ga0495609_0041149 Ga0495609_0041149_224_1249 327
347 3300046538 Ga0495609_0092209 Ga0495609_0092209_144_1187 327
348 3300046542 Ga0495597_0000274 Ga0495597_0000274_22081_23100 327
349 3300046542 Ga0495597_0000554 Ga0495597_0000554_4159_5196 327
350 3300046542 Ga0495597_0002485 Ga0495597_0002485_5323_6360 327
351 3300046542 Ga0495597_0003899 Ga0495597_0003899_932_1957 327
352 3300046542 Ga0495597_0013281 Ga0495597_0013281_2489_3520 327
353 3300046542 Ga0495597_0051840 Ga0495597_0051840_562_1581 327
354 3300046543 Ga0495645_0122449 Ga0495645_0122449_568_1593 327
355 3300046543 Ga0495645_0227224 Ga0495645_0227224_93_1118 327
356 3300046557 Ga0495622_0025367 Ga0495622_0025367_1033_2100 327
357 3300046558 Ga0495633_0002512 Ga0495633_0002512_5199_6242 327
358 3300046558 Ga0495633_0003520 Ga0495633_0003520_5411_6436 327
359 3300046558 Ga0495633_0004820 Ga0495633_0004820_2673_3695 327
360 3300046558 Ga0495633_0007858 Ga0495633_0007858_2168_3193 327
361 3300046558 Ga0495633_0008942 Ga0495633_0008942_809_1834 327
362 3300046558 Ga0495633_0011043 Ga0495633_0011043_775_1800 327
363 3300046558 Ga0495633_0022885 Ga0495633_0022885_276_1313 327
364 3300046558 Ga0495633_0053585 Ga0495633_0053585_349_1374 327
365 3300046558 Ga0495633_0092277 Ga0495633_0092277_286_1311 327
366 3300046558 Ga0495633_0100057 Ga0495633_0100057_160_1179 327
367 3300046615 Ga0495656_0006196 Ga0495656_0006196_1998_3065 327
368 3300046615 Ga0495656_0038285 Ga0495656_0038285_119_1144 327
369 3300046616 Ga0495668_0000682 Ga0495668_0000682_36643_37710 327
370 3300046616 Ga0495668_0001339 Ga0495668_0001339_22152_23177 327
371 3300046616 Ga0495668_0001688 Ga0495668_0001688_3175_4206 327
372 3300046616 Ga0495668_0002654 Ga0495668_0002654_11766_12791 327
373 3300046616 Ga0495668_0007057 Ga0495668_0007057_486_1511 327
374 3300046616 Ga0495668_0009569 Ga0495668_0009569_2120_3163 327
375 3300046616 Ga0495668_0013029 Ga0495668_0013029_1816_2841 327
376 3300046616 Ga0495668_0047226 Ga0495668_0047226_359_1420 327
377 3300046616 Ga0495668_0055215 Ga0495668_0055215_302_1321 327
378 3300046648 Ga0495611_0000328 Ga0495611_0000328_4076_5119 327
379 3300046648 Ga0495611_0001420 Ga0495611_0001420_4452_5489 327
380 3300046648 Ga0495611_0004896 Ga0495611_0004896_1903_2922 327
381 3300046648 Ga0495611_0047884 Ga0495611_0047884_18_1043 327
382 3300046648 Ga0495611_0051924 Ga0495611_0051924_687_1748 327
383 3300046660 Ga0495625_0022206 Ga0495625_0022206_2733_3764 327
384 3300046660 Ga0495625_0074242 Ga0495625_0074242_546_1607 327
385 3300046665 Ga0495661_0000259 Ga0495661_0000259_23606_24631 327
386 3300046665 Ga0495661_0000647 Ga0495661_0000647_3676_4701 327
387 3300046665 Ga0495661_0001779 Ga0495661_0001779_2309_3334 327
388 3300046665 Ga0495661_0003205 Ga0495661_0003205_4485_5552 327
389 3300046665 Ga0495661_0003234 Ga0495661_0003234_7459_8481 327
390 3300046665 Ga0495661_0004153 Ga0495661_0004153_5255_6280 327
391 3300046665 Ga0495661_0011989 Ga0495661_0011989_4061_5104 327
392 3300046665 Ga0495661_0025013 Ga0495661_0025013_1239_2264 327
393 3300046665 Ga0495661_0025858 Ga0495661_0025858_2532_3557 327
394 3300046665 Ga0495661_0033720 Ga0495661_0033720_481_1506 327
395 3300046665 Ga0495661_0034226 Ga0495661_0034226_99_1118 327
396 3300046665 Ga0495661_0037314 Ga0495661_0037314_411_1430 327
397 3300046665 Ga0495661_0068561 Ga0495661_0068561_254_1279 327
398 3300046674 Ga0495588_0000137 Ga0495588_0000137_34884_35909 327
399 3300046674 Ga0495588_0015420 Ga0495588_0015420_1667_2692 327
400 3300046674 Ga0495588_0042623 Ga0495588_0042623_718_1737 327
401 3300046674 Ga0495588_0056454 Ga0495588_0056454_442_1509 327
402 3300046680 Ga0495646_0170156 Ga0495646_0170156_110_1135 327
403 3300046684 Ga0495669_0000516 Ga0495669_0000516_16295_17320 327
404 3300046684 Ga0495669_0001191 Ga0495669_0001191_5734_6771 327
405 3300046684 Ga0495669_0021706 Ga0495669_0021706_387_1412 327
406 3300046684 Ga0495669_0034181 Ga0495669_0034181_331_1350 327
407 3300046684 Ga0495669_0039512 Ga0495669_0039512_202_1269 327
408 3300046691 Ga0495670_0001524 Ga0495670_0001524_6270_7295 327
409 3300046691 Ga0495670_0002554 Ga0495670_0002554_4629_5654 327
410 3300046691 Ga0495670_0011218 Ga0495670_0011218_1557_2582 327
411 3300046691 Ga0495670_0019668 Ga0495670_0019668_1635_2654 327
412 3300046691 Ga0495670_0022759 Ga0495670_0022759_616_1653 327
413 3300046691 Ga0495670_0023486 Ga0495670_0023486_735_1760 327
414 3300046692 Ga0495671_0000275 Ga0495671_0000275_38218_39285 327
415 3300046692 Ga0495671_0013692 Ga0495671_0013692_2456_3493 327
416 3300046692 Ga0495671_0016774 Ga0495671_0016774_1858_2889 327
417 3300046694 Ga0495649_0000122 Ga0495649_0000122_4075_5118 327
418 3300046694 Ga0495649_0004107 Ga0495649_0004107_5455_6486 327
419 3300046694 Ga0495649_0009673 Ga0495649_0009673_2388_3413 327
420 3300046694 Ga0495649_0016860 Ga0495649_0016860_1101_2138 327
421 3300046694 Ga0495649_0027927 Ga0495649_0027927_757_1740 327
422 3300046694 Ga0495649_0053090 Ga0495649_0053090_1028_2047 327
423 3300046694 Ga0495649_0078715 Ga0495649_0078715_315_1346 327
424 3300046794 Ga0495589_0000052 Ga0495589_0000052_102822_103847 327
425 3300046794 Ga0495589_0000185 Ga0495589_0000185_46143_47168 327
426 3300046794 Ga0495589_0001210 Ga0495589_0001210_11830_12849 327
427 3300046794 Ga0495589_0002207 Ga0495589_0002207_3701_4768 327
428 3300046794 Ga0495589_0006148 Ga0495589_0006148_3467_4486 327
429 3300046794 Ga0495589_0012254 Ga0495589_0012254_2278_3303 327
430 3300046794 Ga0495589_0016225 Ga0495589_0016225_2481_3506 327
431 3300046794 Ga0495589_0020361 Ga0495589_0020361_1734_2777 327
432 3300046794 Ga0495589_0029142 Ga0495589_0029142_703_1764 327
433 3300046794 Ga0495589_0043304 Ga0495589_0043304_1187_2212 327
434 3300046810 Ga0495660_0000154 Ga0495660_0000154_64673_65698 327
435 3300046810 Ga0495660_0005463 Ga0495660_0005463_3959_4996 327
436 3300046810 Ga0495660_0006813 Ga0495660_0006813_2284_3327 327
437 3300046810 Ga0495660_0007198 Ga0495660_0007198_110_1147 327
438 3300046810 Ga0495660_0008450 Ga0495660_0008450_1171_2190 327
439 3300046810 Ga0495660_0010475 Ga0495660_0010475_3954_4973 327
440 3300047320 Ga0495672_0000237 Ga0495672_0000237_49928_50971 327
441 3300047320 Ga0495672_0000579 Ga0495672_0000579_3843_4868 327
442 3300047320 Ga0495672_0000603 Ga0495672_0000603_4808_5833 327
443 3300047320 Ga0495672_0002539 Ga0495672_0002539_12193_13218 327
444 3300047320 Ga0495672_0050383 Ga0495672_0050383_1229_2254 327
445 3300047320 Ga0495672_0099608 Ga0495672_0099608_476_1495 327
446 3300047323 Ga0495683_0000079 Ga0495683_0000079_41971_42996 327
447 3300047323 Ga0495683_0000296 Ga0495683_0000296_34412_35455 327
448 3300047323 Ga0495683_0006650 Ga0495683_0006650_4936_5997 327
449 3300047323 Ga0495683_0014047 Ga0495683_0014047_2482_3501 327
450 3300047323 Ga0495683_0017410 Ga0495683_0017410_882_1907 327
451 3300047323 Ga0495683_0055516 Ga0495683_0055516_864_1883 327
452 3300047323 Ga0495683_0067172 Ga0495683_0067172_580_1599 327
453 3300047443 Ga0495687_000087 Ga0495687_000087_109759_110784 327
454 3300047443 Ga0495687_000226 Ga0495687_000226_3695_4720 327
455 3300047443 Ga0495687_000263 Ga0495687_000263_65860_66885 327
456 3300047443 Ga0495687_000275 Ga0495687_000275_26853_27878 327
457 3300047443 Ga0495687_000695 Ga0495687_000695_20627_21646 327
458 3300047443 Ga0495687_000831 Ga0495687_000831_3242_4279 327
459 3300047445 Ga0495677_0000033 Ga0495677_0000033_51332_52357 327
460 3300047445 Ga0495677_0000359 Ga0495677_0000359_12338_13381 327
461 3300047445 Ga0495677_0000747 Ga0495677_0000747_3825_4850 327
462 3300047445 Ga0495677_0001425 Ga0495677_0001425_6244_7269 327
463 3300047445 Ga0495677_0002594 Ga0495677_0002594_497_1519 327
464 3300047445 Ga0495677_0002820 Ga0495677_0002820_1092_2159 327
465 3300047445 Ga0495677_0003300 Ga0495677_0003300_3532_4563 327
466 3300047445 Ga0495677_0003383 Ga0495677_0003383_3433_4458 327
467 3300047445 Ga0495677_0017460 Ga0495677_0017460_989_2050 327
468 3300047445 Ga0495677_0078925 Ga0495677_0078925_127_1152 327
469 3300047446 Ga0495679_003638 Ga0495679_003638_1130_2161 327
470 3300047446 Ga0495679_013039 Ga0495679_013039_1731_2774 327
471 3300047446 Ga0495679_022462 Ga0495679_022462_176_1201 327
472 3300047447 Ga0495685_003984 Ga0495685_003984_1863_2882 327
473 3300047447 Ga0495685_014028 Ga0495685_014028_240_1259 327
474 3300047447 Ga0495685_019480 Ga0495685_019480_1211_2272 327
475 3300047470 Ga0495681_0000264 Ga0495681_0000264_4524_5549 327
476 3300047470 Ga0495681_0000802 Ga0495681_0000802_10403_11386 327
477 3300047470 Ga0495681_0003014 Ga0495681_0003014_3655_4680 327
478 3300047470 Ga0495681_0004990 Ga0495681_0004990_6076_7101 327
479 3300047470 Ga0495681_0006614 Ga0495681_0006614_3471_4508 327
480 3300047470 Ga0495681_0014549 Ga0495681_0014549_3268_4311 327
481 3300047470 Ga0495681_0020065 Ga0495681_0020065_2505_3536 327
482 3300047470 Ga0495681_0028954 Ga0495681_0028954_790_1809 327
483 3300047470 Ga0495681_0051870 Ga0495681_0051870_395_1462 327
484 3300047472 Ga0495686_0000364 Ga0495686_0000364_27255_28280 327
485 3300047472 Ga0495686_0005467 Ga0495686_0005467_6208_7233 327
486 3300047472 Ga0495686_0016124 Ga0495686_0016124_2596_3639 327
487 3300047472 Ga0495686_0037623 Ga0495686_0037623_657_1682 327
488 3300047472 Ga0495686_0045480 Ga0495686_0045480_1471_2538 327
489 3300047673 Ga0495593_0009480 Ga0495593_0009480_3123_4148 327
490 3300048091 Ga0495626_0000085 Ga0495626_0000085_114685_115710 327
491 3300048091 Ga0495626_0000316 Ga0495626_0000316_26901_27926 327
492 3300048091 Ga0495626_0000867 Ga0495626_0000867_2814_3836 327
493 3300048091 Ga0495626_0002571 Ga0495626_0002571_9728_10753 327
494 3300048091 Ga0495626_0002887 Ga0495626_0002887_3130_4173 327
495 3300048091 Ga0495626_0006583 Ga0495626_0006583_5416_6435 327
496 3300048091 Ga0495626_0012051 Ga0495626_0012051_2594_3613 327
497 3300048091 Ga0495626_0016046 Ga0495626_0016046_911_1948 327
498 3300048091 Ga0495626_0024876 Ga0495626_0024876_564_1601 327
499 3300048091 Ga0495626_0025620 Ga0495626_0025620_1229_2260 327
500 3300048091 Ga0495626_0033526 Ga0495626_0033526_1382_2401 327
501 3300048903 Ga0496100_0129009 Ga0496100_0129009_430_1455 327
502 3300048903 Ga0496100_0293962 Ga0496100_0293962_99_1124 327
503 3300048904 Ga0496101_0009394 Ga0496101_0009394_3588_4613 327
504 3300048904 Ga0496101_0310392 Ga0496101_0310392_147_1172 327
505 3300048905 Ga0496102_0000606 Ga0496102_0000606_25998_27023 327
506 3300048905 Ga0496102_0015543 Ga0496102_0015543_4590_5648 327
507 3300048909 Ga0496106_0040575 Ga0496106_0040575_686_1711 327
508 3300048910 Ga0496107_0031031 Ga0496107_0031031_2355_3380 327
509 3300048912 Ga0496109_0024501 Ga0496109_0024501_1649_2674 327
510 3300048913 Ga0496110_0000181 Ga0496110_0000181_5135_6172 327
511 3300048913 Ga0496110_0191962 Ga0496110_0191962_629_1654 327
512 3300048914 Ga0496111_0119356 Ga0496111_0119356_610_1635 327
513 3300048915 Ga0496112_0150227 Ga0496112_0150227_125_1183 327
514 3300048916 Ga0496113_0028141 Ga0496113_0028141_1425_2450 327
515 3300048918 Ga0496115_0070927 Ga0496115_0070927_642_1667 327
516 3300048918 Ga0496115_0289642 Ga0496115_0289642_300_1325 327
517 3300048925 Ga0496122_0001696 Ga0496122_0001696_29677_30702 327
518 3300048925 Ga0496122_0007880 Ga0496122_0007880_7100_8158 327
519 3300048925 Ga0496122_0011463 Ga0496122_0011463_3680_4738 327
520 3300048926 Ga0496123_0000797 Ga0496123_0000797_20258_21283 327
521 3300048926 Ga0496123_0011762 Ga0496123_0011762_1617_2675 327
522 3300048926 Ga0496123_0023703 Ga0496123_0023703_1438_2496 327
523 3300048927 Ga0496124_0019871 Ga0496124_0019871_1395_2420 327
524 3300048927 Ga0496124_0029923 Ga0496124_0029923_1173_2198 327
525 3300048927 Ga0496124_0049172 Ga0496124_0049172_190_1248 327
526 3300048927 Ga0496124_0144289 Ga0496124_0144289_761_1786 327
527 3300048928 Ga0496125_0011947 Ga0496125_0011947_5075_6100 327
528 3300049459 Ga0495678_000170 Ga0495678_000170_49320_50363 327
529 3300049459 Ga0495678_000482 Ga0495678_000482_3548_4567 327
530 3300049459 Ga0495678_000529 Ga0495678_000529_2630_3649 327
531 3300049459 Ga0495678_000854 Ga0495678_000854_23571_24608 327
532 3300049459 Ga0495678_033993 Ga0495678_033993_690_1709 327
533 3300049460 Ga0495682_0000907 Ga0495682_0000907_3831_4850 327
534 3300049460 Ga0495682_0010748 Ga0495682_0010748_1050_2075 327
535 3300049460 Ga0495682_0012489 Ga0495682_0012489_38_1057 327
536 3300049460 Ga0495682_0014536 Ga0495682_0014536_1056_2099 327
537 3300049822 Ga0501035_0000937 Ga0501035_0000937_27641_28666 327
538 3300059505 Ga0587083_0001550 Ga0587083_0001550_323_1348 327
539 3300059641 Ga0587068_001715 Ga0587068_001715_354_1379 327
540 3300059643 Ga0587072_004261 Ga0587072_004261_146_1171 327
541 3300061719 Ga0466962_0081232 Ga0466962_0081232_245_1270 327
542 3300047321 Ga0495676_0000243 Ga0495676_0000243_6173_7192 328
543 3300005356 Ga0070674_100093808 Ga0070674_1000938081 329
544 3300005441 Ga0070700_100122754 Ga0070700_1001227541 329
545 3300005548 Ga0070665_100265540 Ga0070665_1002655402 329
546 3300005718 Ga0068866_10054404 Ga0068866_100544041 329
547 3300013297 Ga0157378_10040450 Ga0157378_100404502 329
548 3300013308 Ga0157375_10086245 Ga0157375_100862452 329
549 3300025923 Ga0207681_10111118 Ga0207681_101111182 329
550 3300025937 Ga0207669_10200396 Ga0207669_102003962 329
551 3300026075 Ga0207708_10155162 Ga0207708_101551622 329
552 3300028379 Ga0268266_10217377 Ga0268266_102173772 329
553 3300046471 Ga0495650_0000048 Ga0495650_0000048_143536_144570 329
554 3300046471 Ga0495650_0003786 Ga0495650_0003786_7241_8275 329
555 2162886007 SwRhRL2b_contig_3016416 SwRhRL2b_0260.00007640 330
556 3300003791 Ga0055530_10000004 Ga0055530_10000004130 330
557 3300003792 Ga0055540_1000017 Ga0055540_100001772 330
558 3300005288 Ga0065714_10002490 Ga0065714_1000249015 330
559 3300005288 Ga0065714_10004800 Ga0065714_100048003 330
560 3300005288 Ga0065714_10018420 Ga0065714_100184202 330
561 3300005289 Ga0065704_10070219 Ga0065704_1007021922 330
562 3300005331 Ga0070670_100002465 Ga0070670_1000024656 330
563 3300005331 Ga0070670_100013267 Ga0070670_1000132676 330
564 3300005344 Ga0070661_100000016 Ga0070661_10000001673 330
565 3300005564 Ga0070664_100000013 Ga0070664_10000001375 330
566 3300006946 Ga0079104_1000006 Ga0079104_1000006218 330
567 3300009036 Ga0105244_10001587 Ga0105244_1000158713 330
568 3300009148 Ga0105243_10000045 Ga0105243_1000004567 330
569 3300009176 Ga0105242_10001142 Ga0105242_100011426 330
570 3300009545 Ga0105237_10000090 Ga0105237_1000009012 330
571 3300013100 Ga0157373_10030773 Ga0157373_100307734 330
572 3300013105 Ga0157369_10002211 Ga0157369_100022118 330
573 3300013306 Ga0163162_10000148 Ga0163162_1000014811 330
574 3300013308 Ga0157375_10000575 Ga0157375_1000057521 330
575 3300013308 Ga0157375_10571341 Ga0157375_105713412 330
576 3300015261 Ga0182006_1000305 Ga0182006_100030519 330
577 3300017792 Ga0163161_10002442 Ga0163161_1000244211 330
578 3300017792 Ga0163161_10225502 Ga0163161_102255022 330
579 3300025292 Ga0209676_1001053 Ga0209676_10010537 330
580 3300025298 Ga0209050_1000037 Ga0209050_1000037129 330
581 3300025303 Ga0209051_1000040 Ga0209051_1000040130 330
582 3300025304 Ga0209257_1016016 Ga0209257_10160163 330
583 3300025711 Ga0207696_1000006 Ga0207696_1000006169 330
584 3300025711 Ga0207696_1005533 Ga0207696_10055334 330
585 3300025728 Ga0207655_1000109 Ga0207655_100010984 330
586 3300025728 Ga0207655_1000176 Ga0207655_100017699 330
587 3300025735 Ga0207713_1002598 Ga0207713_10025982 330
588 3300025914 Ga0207671_10000118 Ga0207671_1000011860 330
589 3300025920 Ga0207649_10000046 Ga0207649_1000004636 330
590 3300025925 Ga0207650_10000192 Ga0207650_1000019270 330
591 3300025925 Ga0207650_10000208 Ga0207650_100002086 330
592 3300025935 Ga0207709_10000011 Ga0207709_10000011400 330
593 3300025945 Ga0207679_10000033 Ga0207679_1000003369 330
594 3300027111 Ga0209281_1000011 Ga0209281_1000011406 330
595 3300031548 Ga0307408_100000074 Ga0307408_10000007478 330
596 3300031548 Ga0307408_100001591 Ga0307408_1000015914 330
597 3300031548 Ga0307408_100090033 Ga0307408_1000900332 330
598 3300031731 Ga0307405_10000130 Ga0307405_1000013017 330
599 3300031731 Ga0307405_10015105 Ga0307405_100151054 330
600 3300031824 Ga0307413_10000948 Ga0307413_100009488 330
601 3300031901 Ga0307406_10029060 Ga0307406_100290602 330
602 3300031911 Ga0307412_10000661 Ga0307412_1000066114 330
603 3300031911 Ga0307412_10002366 Ga0307412_100023668 330
604 3300031911 Ga0307412_10113771 Ga0307412_101137712 330
605 3300031911 Ga0307412_10189525 Ga0307412_101895252 330
606 3300032002 Ga0307416_100367546 Ga0307416_1003675462 330
607 3300032004 Ga0307414_10000407 Ga0307414_1000040711 330
608 3300032004 Ga0307414_10028770 Ga0307414_100287702 330
609 3300032005 Ga0307411_10245087 Ga0307411_102450872 330
610 3300041411 Ga0439466_0001938 Ga0439466_0001938_818_1810 330
611 3300041411 Ga0439466_0012758 Ga0439466_0012758_1617_2609 330
612 3300046453 Ga0495627_051625 Ga0495627_051625_18_1049 330
613 3300046455 Ga0495603_0021673 Ga0495603_0021673_2650_3681 330
614 3300046457 Ga0495590_0000238 Ga0495590_0000238_19275_20312 330
615 3300046459 Ga0495629_0186745 Ga0495629_0186745_194_1225 330
616 3300046463 Ga0495653_0001958 Ga0495653_0001958_14477_15514 330
617 3300046472 Ga0495580_0053634 Ga0495580_0053634_1187_2224 330
618 3300046473 Ga0495582_0008200 Ga0495582_0008200_1563_2600 330
619 3300046473 Ga0495582_0014737 Ga0495582_0014737_2337_3368 330
620 3300046474 Ga0495605_0000053 Ga0495605_0000053_134030_135022 330
621 3300046474 Ga0495605_0033721 Ga0495605_0033721_808_1800 330
622 3300046474 Ga0495605_0062108 Ga0495605_0062108_364_1395 330
623 3300046491 Ga0495584_0042229 Ga0495584_0042229_311_1342 330
624 3300046491 Ga0495584_0053131 Ga0495584_0053131_16_1053 330
625 3300046499 Ga0495594_0006599 Ga0495594_0006599_2829_3860 330
626 3300046499 Ga0495594_0033362 Ga0495594_0033362_1392_2429 330
627 3300046500 Ga0495596_0004940 Ga0495596_0004940_1792_2829 330
628 3300046512 Ga0495610_0000069 Ga0495610_0000069_64445_65437 330
629 3300046513 Ga0495616_0058228 Ga0495616_0058228_216_1208 330
630 3300046517 Ga0495630_0048200 Ga0495630_0048200_1578_2615 330
631 3300046518 Ga0495631_0000240 Ga0495631_0000240_4006_4998 330
632 3300046518 Ga0495631_0078242 Ga0495631_0078242_364_1395 330
633 3300046523 Ga0495644_0024433 Ga0495644_0024433_211_1242 330
634 3300046526 Ga0495666_0005546 Ga0495666_0005546_557_1594 330
635 3300046528 Ga0495642_0041892 Ga0495642_0041892_472_1503 330
636 3300046529 Ga0495652_0023959 Ga0495652_0023959_4128_5165 330
637 3300046530 Ga0495654_0000276 Ga0495654_0000276_19945_20937 330
638 3300046533 Ga0495640_0113041 Ga0495640_0113041_651_1688 330
639 3300046535 Ga0495586_0010512 Ga0495586_0010512_3063_4094 330
640 3300046535 Ga0495586_0022138 Ga0495586_0022138_1100_2137 330
641 3300046538 Ga0495609_0027721 Ga0495609_0027721_892_1923 330
642 3300046557 Ga0495622_0011514 Ga0495622_0011514_929_1960 330
643 3300046663 Ga0495635_0001764 Ga0495635_0001764_2963_3994 330
644 3300046674 Ga0495588_0009704 Ga0495588_0009704_1189_2220 330
645 3300046674 Ga0495588_0017529 Ga0495588_0017529_1057_2088 330
646 3300046674 Ga0495588_0039793 Ga0495588_0039793_1163_2200 330
647 3300046679 Ga0495623_0022033 Ga0495623_0022033_2635_3672 330
648 3300046684 Ga0495669_0000120 Ga0495669_0000120_44310_45347 330
649 3300046689 Ga0495613_0015597 Ga0495613_0015597_1615_2646 330
650 3300046689 Ga0495613_0047884 Ga0495613_0047884_1735_2766 330
651 3300046691 Ga0495670_0013153 Ga0495670_0013153_929_1960 330
652 3300046694 Ga0495649_0110268 Ga0495649_0110268_286_1323 330
653 3300047315 Ga0495581_0008782 Ga0495581_0008782_2117_3148 330
654 3300047317 Ga0495604_0020837 Ga0495604_0020837_1214_2245 330
655 3300047320 Ga0495672_0085137 Ga0495672_0085137_366_1358 330
656 3300047322 Ga0495680_0016123 Ga0495680_0016123_2493_3524 330
657 3300047444 Ga0495675_0008913 Ga0495675_0008913_2471_3502 330
658 3300047470 Ga0495681_0034859 Ga0495681_0034859_1409_2440 330
659 3300047673 Ga0495593_0005405 Ga0495593_0005405_3235_4266 330
660 3300047673 Ga0495593_0139674 Ga0495593_0139674_14_1051 330
661 3300048088 Ga0495602_0011455 Ga0495602_0011455_2284_3321 330
662 3300048089 Ga0495614_0004888 Ga0495614_0004888_3774_4805 330
663 3300048089 Ga0495614_0025426 Ga0495614_0025426_466_1497 330
664 3300048091 Ga0495626_0077701 Ga0495626_0077701_77_1114 330
665 3300048920 Ga0496117_0000461 Ga0496117_0000461_12205_13197 330
666 3300048920 Ga0496117_0001482 Ga0496117_0001482_9814_10806 330
667 3300048921 Ga0496118_0000106 Ga0496118_0000106_96865_97857 330
668 3300048921 Ga0496118_0001585 Ga0496118_0001585_9819_10811 330
669 3300048924 Ga0496121_0000871 Ga0496121_0000871_28969_29961 330
670 3300048924 Ga0496121_0002025 Ga0496121_0002025_21348_22340 330
671 3300048924 Ga0496121_0107692 Ga0496121_0107692_139_1131 330
672 3300048925 Ga0496122_0001143 Ga0496122_0001143_24571_25563 330
673 3300048925 Ga0496122_0004800 Ga0496122_0004800_4304_5296 330
674 3300048926 Ga0496123_0057722 Ga0496123_0057722_1176_2168 330
675 3300048928 Ga0496125_0000038 Ga0496125_0000038_171984_172976 330
676 3300048928 Ga0496125_0000619 Ga0496125_0000619_33151_34143 330
677 3300048928 Ga0496125_0001480 Ga0496125_0001480_23013_24005 330
678 3300048928 Ga0496125_0023411 Ga0496125_0023411_2548_3540 330
679 3300048929 Ga0496126_0032096 Ga0496126_0032096_1858_2850 330
680 3300049662 Ga0501222_000076 Ga0501222_000076_16464_17456 330
681 3300049853 Ga0501226_000464 Ga0501226_000464_4050_5042 330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18288

FAA_hydro_N_2

Fumarylacetoacetase N-terminal domain 2

15

92

1

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

95

348

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lzk-assembly1.cif.gz_B the crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021 0.9787 1 327
3lzk-assembly1.cif.gz_B the crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021 0.967 1 327
8gst-assembly2.cif.gz_D crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (pyruvate bound-form) 0.8382 1 325
1nr9-assembly1.cif.gz_B crystal structure of escherichia coli 1262 (apc5008), putative isomerase 0.8232 68 323
6v77-assembly1.cif.gz_B crystal structure of a putative hpce protein from mycobacterium smegmatis 0.8217 1 325
ID Description Score Start End Superfamily
3lzkB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.953 2 327 3.90.850.10
3lzkB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9416 2 327 3.90.850.10
af_O86346_1_303_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8725 1 326 3.90.850.10
af_O86346_1_303_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8703 1 326 3.90.850.10
af_Q9VU50_128_337_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8606 76 324 3.90.850.10
ID Description Score Start End GO Terms
AF-I4N1P0-F1-model_v4 Hydrolase 0.9936 1 327 GO:0016787
AF-A0A7W9WT32-F1-model_v4 Fumarylacetoacetate (FAA) hydrolase (EC 3.7.1.2) 0.9934 1 325 GO:0004334
AF-A0A482PCP2-F1-model_v4 Fumarylacetoacetate hydrolase 0.991 1 326 GO:0016787
AF-A0A208XHG1-F1-model_v4 Fumarylacetoacetate hydrolase 0.991 1 325 GO:0016787
AF-A0A7X6FD65-F1-model_v4 Fumarylacetoacetate (FAA) hydrolase (EC 3.7.1.2) 0.9907 1 325 GO:0004334

Feature Viewer

pLDDT pTM Quality
91.49 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map