F474851

General Info

Members Datasets Scaffolds Average Seq Length
681 298 1362 186

Family's Representative Sequence

Representative Sequence 3300041496|Ga0451839_0049611|Ga0451839_0049611_113_769
Length 218
Sequence LSLAVEVGNRHRRVDPSISVTRSRDAGLKPVTHAFVVTLAVLGVVGQALAVVLLVIGGLALAGVRAPLEWLREALWGYELWCAFVVTAIATAGSLFFSEIAGYVPCELCWYQRICMYPLSILTLFAAFTGDHRIARYLLPFPVIGAGVSTYHLLVENGVVEQAKACLLSAPGGCATKWIEEFGYVTIPTLALTGFALCFAFLLLASFPPLSAATVPER

Samples

Sample ID Description Type Environment
1 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
148 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
149 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
150 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
151 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
159 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
170 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
171 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
172 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
173 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
174 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
175 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
178 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
188 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
207 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
246 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
247 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
248 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
249 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
250 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
251 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
252 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
253 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
254 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
255 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
256 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
269 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
283 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
287 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
288 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
289 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
290 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
291 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
292 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
293 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
294 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
295 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 13.07
Rhizosphere 86.64
Stem 0
Stem Tuber 0
Unclassified 2.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451839_0049611 3300041496 Bacteria 824
2 Ga0070658_10038523 3300005327 Bacteria 3855
3 Ga0070658_10040158 3300005327 Bacteria 3775
4 Ga0070658_10070344 3300005327 Bacteria 2864
5 Ga0070658_10342567 3300005327 Bacteria 1279
6 Ga0070683_100130780 3300005329 Bacteria 2375
7 Ga0070683_100224141 3300005329 Bacteria 1787
8 Ga0070690_101116361 3300005330 Bacteria 626
9 Ga0070680_100219488 3300005336 Bacteria 1605
10 Ga0070680_100975301 3300005336 Bacteria 732
11 Ga0070682_100009361 3300005337 Bacteria 5543
12 Ga0070682_100179149 3300005337 Bacteria 1479
13 Ga0070682_100228833 3300005337 Bacteria 1328
14 Ga0070682_100509777 3300005337 Bacteria 934
15 Ga0068868_100074746 3300005338 Bacteria 2707
16 Ga0068868_100342040 3300005338 Bacteria 1279
17 Ga0068868_101025114 3300005338 Bacteria 756
18 Ga0070660_100009851 3300005339 Bacteria 6740
19 Ga0070660_100011347 3300005339 Bacteria 6325
20 Ga0070660_100014362 3300005339 Bacteria 5702
21 Ga0070660_100046579 3300005339 Bacteria 3324
22 Ga0070691_10067399 3300005341 Bacteria 1731
23 Ga0070691_10136952 3300005341 Bacteria 1245
24 Ga0070661_100786602 3300005344 Bacteria 780
25 Ga0070692_10780205 3300005345 Bacteria 651
26 Ga0070668_100329717 3300005347 Bacteria 1287
27 Ga0070668_100396423 3300005347 Unclassified 1178
28 Ga0070675_100534115 3300005354 Bacteria 1059
29 Ga0070671_100436988 3300005355 Bacteria 1122
30 Ga0070674_100243733 3300005356 Bacteria 1409
31 Ga0070673_100130296 3300005364 Bacteria 2109
32 Ga0070688_100162356 3300005365 Bacteria 1536
33 Ga0070659_100209209 3300005366 Bacteria 1607
34 Ga0070659_100442865 3300005366 Bacteria 1101
35 Ga0070703_10021687 3300005406 Bacteria 1880
36 Ga0070709_10013845 3300005434 Bacteria 4546
37 Ga0070709_10129268 3300005434 Bacteria 1722
38 Ga0070714_100002410 3300005435 Bacteria 13779
39 Ga0070714_100082674 3300005435 Bacteria 2798
40 Ga0070714_100105936 3300005435 Bacteria 2483
41 Ga0070713_100002387 3300005436 Bacteria 12248
42 Ga0070713_100217953 3300005436 Bacteria 1730
43 Ga0070713_100337552 3300005436 Bacteria 1395
44 Ga0070713_100616521 3300005436 Bacteria 1032
45 Ga0070710_10087367 3300005437 Bacteria 1832
46 Ga0070710_10221350 3300005437 Bacteria 1204
47 Ga0070701_10190025 3300005438 Bacteria 1208
48 Ga0070701_10197661 3300005438 Bacteria 1187
49 Ga0070701_10783808 3300005438 Bacteria 649
50 Ga0070711_100015520 3300005439 Bacteria 4822
51 Ga0070711_100039160 3300005439 Bacteria 3191
52 Ga0070705_100054192 3300005440 Bacteria 2351
53 Ga0070705_100100849 3300005440 Bacteria 1823
54 Ga0070705_100233351 3300005440 Bacteria 1281
55 Ga0070694_100173396 3300005444 Bacteria 1590
56 Ga0070708_100206003 3300005445 Bacteria 1842
57 Ga0070708_100223922 3300005445 Bacteria 1764
58 Ga0070708_100451642 3300005445 Bacteria 1213
59 Ga0070663_100053281 3300005455 Bacteria 2887
60 Ga0070678_100106155 3300005456 Bacteria 2188
61 Ga0070678_100192421 3300005456 Bacteria 1678
62 Ga0070681_10084054 3300005458 Bacteria 3135
63 Ga0070681_10186949 3300005458 Bacteria 1992
64 Ga0068867_100093398 3300005459 Bacteria 2286
65 Ga0070685_10110673 3300005466 Bacteria 1691
66 Ga0070706_100208918 3300005467 Bacteria 1823
67 Ga0070706_100761673 3300005467 Bacteria 897
68 Ga0070707_100136026 3300005468 Unclassified 2390
69 Ga0070707_100430621 3300005468 Bacteria 1280
70 Ga0070698_100047893 3300005471 Bacteria 4369
71 Ga0070698_100289880 3300005471 Bacteria 1568
72 Ga0070699_100010285 3300005518 Bacteria 8090
73 Ga0070699_100183458 3300005518 Bacteria 1857
74 Ga0070699_100462346 3300005518 Bacteria 1151
75 Ga0070679_100083947 3300005530 Bacteria 3173
76 Ga0070679_100097372 3300005530 Bacteria 2930
77 Ga0070679_100124152 3300005530 Bacteria 2565
78 Ga0070679_100276780 3300005530 Bacteria 1631
79 Ga0070679_101141928 3300005530 Bacteria 724
80 Ga0070679_101145537 3300005530 Bacteria 723
81 Ga0070684_100308435 3300005535 Bacteria 1453
82 Ga0070684_100487814 3300005535 Bacteria 1141
83 Ga0070684_100499562 3300005535 Bacteria 1126
84 Ga0070684_100580942 3300005535 Bacteria 1041
85 Ga0070697_100066356 3300005536 Bacteria 2950
86 Ga0070697_100594029 3300005536 Bacteria 973
87 Ga0070672_100544852 3300005543 Bacteria 1007
88 Ga0070686_100004678 3300005544 Bacteria 7543
89 Ga0070686_100149644 3300005544 Bacteria 1634
90 Ga0070695_100047691 3300005545 Bacteria 2737
91 Ga0070695_100104882 3300005545 Bacteria 1909
92 Ga0070695_100209405 3300005545 Bacteria 1398
93 Ga0070695_100357538 3300005545 Bacteria 1096
94 Ga0070696_100063543 3300005546 Bacteria 2586
95 Ga0070696_100066357 3300005546 Bacteria 2530
96 Ga0070696_100085962 3300005546 Bacteria 2232
97 Ga0070696_100099291 3300005546 Bacteria 2083
98 Ga0070696_100276996 3300005546 Bacteria 1277
99 Ga0070693_100048605 3300005547 Bacteria 2417
100 Ga0070704_100062258 3300005549 Bacteria 2674
101 Ga0070704_100313817 3300005549 Bacteria 1311
102 Ga0070704_100338660 3300005549 Bacteria 1266
103 Ga0070704_100569218 3300005549 Bacteria 992
104 Ga0070704_100909869 3300005549 Bacteria 792
105 Ga0068855_100060417 3300005563 Bacteria 4432
106 Ga0068855_100088026 3300005563 Bacteria 3588
107 Ga0068855_100117001 3300005563 Bacteria 3054
108 Ga0068855_100216002 3300005563 Bacteria 2152
109 Ga0068855_100991771 3300005563 Unclassified 883
110 Ga0068854_100697678 3300005578 Bacteria 876
111 Ga0068856_100054725 3300005614 Bacteria 3937
112 Ga0068856_100149834 3300005614 Bacteria 2341
113 Ga0068856_100164966 3300005614 Bacteria 2226
114 Ga0068852_100116071 3300005616 Bacteria 2442
115 Ga0068852_100749267 3300005616 Bacteria 989
116 Ga0068859_100204441 3300005617 Bacteria 2060
117 Ga0068866_10009869 3300005718 Bacteria 4072
118 Ga0068861_100002581 3300005719 Bacteria 11853
119 Ga0068860_100106354 3300005843 Bacteria 2680
120 Ga0068862_100065974 3300005844 Bacteria 3118
121 Ga0081455_10001217 3300005937 Bacteria 32259
122 Ga0070717_10084992 3300006028 Bacteria 2662
123 Ga0070717_10148643 3300006028 Bacteria 2026
124 Ga0070717_10499304 3300006028 Bacteria 1099
125 Ga0070717_10659387 3300006028 Bacteria 950
126 Ga0075364_10373641 3300006051 Bacteria 972
127 Ga0075432_10060894 3300006058 Bacteria 1344
128 Ga0070715_10000223 3300006163 Bacteria 13556
129 Ga0070715_10003374 3300006163 Bacteria 5062
130 Ga0070715_10033170 3300006163 Bacteria 2108
131 Ga0070716_100005561 3300006173 Bacteria 6118
132 Ga0070712_100002808 3300006175 Bacteria 10772
133 Ga0097621_100081979 3300006237 Bacteria 2685
134 Ga0068871_100024214 3300006358 Bacteria 4704
135 Ga0068871_100153921 3300006358 Bacteria 1962
136 Ga0068871_100171210 3300006358 Bacteria 1861
137 Ga0075428_100042066 3300006844 Bacteria 5025
138 Ga0075428_100814674 3300006844 Bacteria 992
139 Ga0075433_10012194 3300006852 Bacteria 6932
140 Ga0075433_10091022 3300006852 Bacteria 2696
141 Ga0075433_10140516 3300006852 Bacteria 2146
142 Ga0075433_10421197 3300006852 Bacteria 1178
143 Ga0075433_10702181 3300006852 Bacteria 886
144 Ga0075434_100001314 3300006871 Bacteria 20738
145 Ga0075434_100015211 3300006871 Bacteria 7373
146 Ga0075434_100105873 3300006871 Bacteria 2822
147 Ga0075434_100325557 3300006871 Bacteria 1557
148 Ga0068865_100012985 3300006881 Bacteria 5251
149 Ga0068865_100605175 3300006881 Bacteria 927
150 Ga0075436_100010403 3300006914 Bacteria 6376
151 Ga0075436_100013058 3300006914 Bacteria 5694
152 Ga0075436_100080544 3300006914 Bacteria 2256
153 Ga0097620_100204438 3300006931 Bacteria 2060
154 Ga0075435_100021112 3300007076 Bacteria 5002
155 Ga0075435_100041412 3300007076 Bacteria 3682
156 Ga0075435_100079435 3300007076 Bacteria 2692
157 Ga0075435_100116860 3300007076 Bacteria 2222
158 Ga0075435_100189973 3300007076 Bacteria 1738
159 Ga0105240_10653774 3300009093 Bacteria 1152
160 Ga0111539_10075680 3300009094 Bacteria 3965
161 Ga0111539_10312171 3300009094 Bacteria 1830
162 Ga0111539_11450025 3300009094 Bacteria 796
163 Ga0105245_10280459 3300009098 Bacteria 1628
164 Ga0105245_10464766 3300009098 Bacteria 1276
165 Ga0105245_10535866 3300009098 Bacteria 1191
166 Ga0105245_10619475 3300009098 Bacteria 1110
167 Ga0105245_11029455 3300009098 Bacteria 868
168 Ga0114129_10072428 3300009147 Bacteria 4803
169 Ga0114129_10232920 3300009147 Bacteria 2480
170 Ga0114129_10542185 3300009147 Bacteria 1514
171 Ga0114129_10736630 3300009147 Bacteria 1263
172 Ga0105243_10098017 3300009148 Bacteria 2428
173 Ga0105243_10636208 3300009148 Bacteria 1032
174 Ga0105241_10054114 3300009174 Bacteria 3071
175 Ga0105241_10062957 3300009174 Bacteria 2860
176 Ga0105241_10397040 3300009174 Bacteria 1208
177 Ga0105241_10406299 3300009174 Bacteria 1196
178 Ga0105242_10018858 3300009176 Bacteria 5402
179 Ga0105242_10040232 3300009176 Bacteria 3767
180 Ga0105242_10424205 3300009176 Bacteria 1247
181 Ga0105242_10459261 3300009176 Bacteria 1202
182 Ga0105248_10972798 3300009177 Bacteria 959
183 Ga0105248_11339947 3300009177 Bacteria 810
184 Ga0105237_11196764 3300009545 Bacteria 766
185 Ga0105249_10277738 3300009553 Bacteria 1671
186 Ga0105249_10792875 3300009553 Bacteria 1011
187 Ga0105239_10029797 3300010375 Bacteria 6001
188 Ga0105239_10258402 3300010375 Bacteria 1957
189 Ga0105239_10287508 3300010375 Bacteria 1851
190 Ga0105239_10527474 3300010375 Unclassified 1344
191 Ga0105239_11869964 3300010375 Bacteria 696
192 Ga0105246_10257927 3300011119 Bacteria 1387
193 Ga0157343_1003224 3300012488 Bacteria 944
194 Ga0157373_10167199 3300013100 Bacteria 1548
195 Ga0157373_10232197 3300013100 Bacteria 1303
196 Ga0157373_10524363 3300013100 Bacteria 857
197 Ga0157371_10139861 3300013102 Bacteria 1725
198 Ga0157370_10091369 3300013104 Bacteria 2858
199 Ga0157370_10101542 3300013104 Bacteria 2694
200 Ga0157369_10019574 3300013105 Bacteria 7575
201 Ga0157369_10034438 3300013105 Bacteria 5558
202 Ga0157369_10090340 3300013105 Bacteria 3270
203 Ga0157369_10677536 3300013105 Bacteria 1063
204 Ga0157369_10717469 3300013105 Bacteria 1029
205 Ga0157369_11324296 3300013105 Bacteria 734
206 Ga0157374_10114051 3300013296 Bacteria 2601
207 Ga0157378_10184002 3300013297 Bacteria 1967
208 Ga0163162_10396272 3300013306 Bacteria 1513
209 Ga0157372_10046430 3300013307 Bacteria 4821
210 Ga0157372_10336820 3300013307 Bacteria 1757
211 Ga0157372_10787331 3300013307 Bacteria 1105
212 Ga0157372_12471127 3300013307 Bacteria 596
213 Ga0157375_10253651 3300013308 Bacteria 1920
214 Ga0182008_10157121 3300014497 Bacteria 1143
215 Ga0157376_10295694 3300014969 Bacteria 1531
216 Ga0157376_10624451 3300014969 Bacteria 1075
217 Ga0163161_10151336 3300017792 Bacteria 1764
218 Ga0206354_10369313 3300020081 Bacteria 1158
219 Ga0206353_10590963 3300020082 Bacteria 4866
220 Ga0224712_10012329 3300022467 Bacteria 2686
221 Ga0207653_10016476 3300025885 Bacteria 2321
222 Ga0207692_10004162 3300025898 Bacteria 5711
223 Ga0207642_10060709 3300025899 Bacteria 1755
224 Ga0207688_10087946 3300025901 Bacteria 1781
225 Ga0207688_10508556 3300025901 Bacteria 755
226 Ga0207680_10214987 3300025903 Bacteria 1316
227 Ga0207699_10009017 3300025906 Bacteria 4948
228 Ga0207699_10020151 3300025906 Bacteria 3569
229 Ga0207699_10076174 3300025906 Bacteria 2066
230 Ga0207699_10125121 3300025906 Bacteria 1668
231 Ga0207705_10038377 3300025909 Bacteria 3429
232 Ga0207705_10093662 3300025909 Bacteria 2202
233 Ga0207705_10491177 3300025909 Bacteria 953
234 Ga0207684_10096178 3300025910 Bacteria 2528
235 Ga0207654_10041411 3300025911 Bacteria 2601
236 Ga0207654_10202213 3300025911 Bacteria 1308
237 Ga0207654_10814805 3300025911 Bacteria 675
238 Ga0207707_10129166 3300025912 Bacteria 2210
239 Ga0207707_10165415 3300025912 Bacteria 1933
240 Ga0207707_10340868 3300025912 Bacteria 1292
241 Ga0207707_10412102 3300025912 Bacteria 1159
242 Ga0207671_10638973 3300025914 Bacteria 848
243 Ga0207693_10000417 3300025915 Bacteria 38685
244 Ga0207693_10003150 3300025915 Bacteria 14185
245 Ga0207693_10285396 3300025915 Bacteria 1293
246 Ga0207663_10001106 3300025916 Bacteria 12393
247 Ga0207663_10017863 3300025916 Bacteria 3961
248 Ga0207663_10020346 3300025916 Bacteria 3756
249 Ga0207660_10145419 3300025917 Unclassified 1816
250 Ga0207660_10244234 3300025917 Bacteria 1415
251 Ga0207662_10136931 3300025918 Bacteria 1548
252 Ga0207657_10020049 3300025919 Bacteria 6333
253 Ga0207657_10027020 3300025919 Bacteria 5261
254 Ga0207657_10036563 3300025919 Bacteria 4394
255 Ga0207657_10054218 3300025919 Bacteria 3468
256 Ga0207657_10054699 3300025919 Bacteria 3450
257 Ga0207649_10265692 3300025920 Bacteria 1242
258 Ga0207652_10031017 3300025921 Bacteria 4484
259 Ga0207652_10124299 3300025921 Bacteria 2297
260 Ga0207652_10241978 3300025921 Bacteria 1627
261 Ga0207646_10035328 3300025922 Bacteria 4514
262 Ga0207646_10342808 3300025922 Bacteria 1350
263 Ga0207646_10579378 3300025922 Bacteria 1008
264 Ga0207694_10926245 3300025924 Bacteria 737
265 Ga0207694_11075083 3300025924 Bacteria 681
266 Ga0207687_10045576 3300025927 Bacteria 3032
267 Ga0207687_10173254 3300025927 Bacteria 1666
268 Ga0207687_10245655 3300025927 Bacteria 1420
269 Ga0207687_10251509 3300025927 Bacteria 1405
270 Ga0207687_10325867 3300025927 Bacteria 1245
271 Ga0207700_10029767 3300025928 Bacteria 3857
272 Ga0207700_10039566 3300025928 Bacteria 3434
273 Ga0207700_10409050 3300025928 Unclassified 1190
274 Ga0207700_10416009 3300025928 Bacteria 1180
275 Ga0207700_10517190 3300025928 Bacteria 1057
276 Ga0207700_10720930 3300025928 Bacteria 891
277 Ga0207664_10024027 3300025929 Bacteria 4575
278 Ga0207664_10054673 3300025929 Bacteria 3164
279 Ga0207664_10409545 3300025929 Unclassified 1207
280 Ga0207664_10437924 3300025929 Bacteria 1166
281 Ga0207644_10328532 3300025931 Bacteria 1238
282 Ga0207690_10093396 3300025932 Bacteria 2132
283 Ga0207690_10123165 3300025932 Bacteria 1886
284 Ga0207690_10281015 3300025932 Bacteria 1296
285 Ga0207690_10926901 3300025932 Bacteria 723
286 Ga0207706_10004543 3300025933 Bacteria 13025
287 Ga0207706_10492832 3300025933 Unclassified 1058
288 Ga0207686_10253405 3300025934 Bacteria 1287
289 Ga0207709_10047454 3300025935 Bacteria 2611
290 Ga0207709_10077424 3300025935 Bacteria 2132
291 Ga0207709_10579714 3300025935 Bacteria 886
292 Ga0207704_10343084 3300025938 Bacteria 1160
293 Ga0207665_10000322 3300025939 Bacteria 33292
294 Ga0207665_10029308 3300025939 Bacteria 3638
295 Ga0207691_10424909 3300025940 Bacteria 1132
296 Ga0207689_10181630 3300025942 Bacteria 1735
297 Ga0207661_10100931 3300025944 Bacteria 2423
298 Ga0207661_11069368 3300025944 Bacteria 743
299 Ga0207679_10044387 3300025945 Bacteria 3207
300 Ga0207667_10126828 3300025949 Bacteria 2629
301 Ga0207667_10171992 3300025949 Bacteria 2226
302 Ga0207667_10270935 3300025949 Bacteria 1736
303 Ga0207667_10302307 3300025949 Bacteria 1635
304 Ga0207667_10365326 3300025949 Bacteria 1472
305 Ga0207651_10142436 3300025960 Bacteria 1854
306 Ga0207712_10137205 3300025961 Bacteria 1872
307 Ga0207639_10397500 3300026041 Bacteria 1241
308 Ga0207639_10801631 3300026041 Bacteria 878
309 Ga0207639_11143471 3300026041 Bacteria 730
310 Ga0207678_10041229 3300026067 Bacteria 4003
311 Ga0207678_10574514 3300026067 Bacteria 987
312 Ga0207702_10005955 3300026078 Bacteria 10591
313 Ga0207702_10098181 3300026078 Bacteria 2579
314 Ga0207702_10231871 3300026078 Bacteria 1726
315 Ga0207648_10029930 3300026089 Bacteria 4828
316 Ga0207648_10369548 3300026089 Bacteria 1295
317 Ga0207676_10352484 3300026095 Bacteria 1361
318 Ga0207675_100140724 3300026118 Bacteria 2292
319 Ga0207675_100157000 3300026118 Bacteria 2168
320 Ga0207683_10004330 3300026121 Bacteria 12261
321 Ga0207683_10158188 3300026121 Bacteria 2047
322 Ga0207683_10779756 3300026121 Bacteria 887
323 Ga0207698_10129488 3300026142 Bacteria 2153
324 Ga0207428_10003682 3300027907 Bacteria 14749
325 Ga0207428_10060723 3300027907 Bacteria 2994
326 Ga0268265_10097215 3300028380 Bacteria 2369
327 Ga0265326_10018562 3300028558 Bacteria 2003
328 Ga0265319_1004340 3300028563 Bacteria 7040
329 Ga0265319_1012196 3300028563 Bacteria 3483
330 Ga0265334_10002668 3300028573 Bacteria 8254
331 Ga0265318_10001162 3300028577 Bacteria 16314
332 Ga0265318_10092644 3300028577 Bacteria 1113
333 Ga0265322_10004706 3300028654 Bacteria 4053
334 Ga0265338_10004801 3300028800 Bacteria 18068
335 Ga0265338_10005068 3300028800 Bacteria 17388
336 Ga0265338_10028345 3300028800 Bacteria 5587
337 Ga0265338_10038780 3300028800 Bacteria 4506
338 Ga0265330_10001175 3300031235 Bacteria 15554
339 Ga0265330_10082018 3300031235 Bacteria 1389
340 Ga0265332_10001094 3300031238 Bacteria 15781
341 Ga0265332_10050701 3300031238 Bacteria 1784
342 Ga0265332_10138763 3300031238 Bacteria 1019
343 Ga0265328_10007036 3300031239 Bacteria 4718
344 Ga0265320_10005081 3300031240 Bacteria 8506
345 Ga0265320_10226581 3300031240 Unclassified 832
346 Ga0265325_10000949 3300031241 Bacteria 20963
347 Ga0265325_10030285 3300031241 Bacteria 2903
348 Ga0265329_10005791 3300031242 Bacteria 4962
349 Ga0265340_10009485 3300031247 Bacteria 5221
350 Ga0265340_10108474 3300031247 Bacteria 1285
351 Ga0265339_10001880 3300031249 Bacteria 15419
352 Ga0265339_10006211 3300031249 Bacteria 7865
353 Ga0265339_10138542 3300031249 Bacteria 1239
354 Ga0265331_10017552 3300031250 Bacteria 3727
355 Ga0265331_10180648 3300031250 Bacteria 953
356 Ga0265327_10004531 3300031251 Bacteria 12247
357 Ga0265327_10009219 3300031251 Bacteria 7157
358 Ga0265327_10048809 3300031251 Bacteria 2224
359 Ga0265316_10002243 3300031344 Bacteria 20247
360 Ga0265316_10148862 3300031344 Bacteria 1754
361 Ga0265313_10001261 3300031595 Bacteria 24080
362 Ga0265314_10003398 3300031711 Bacteria 15419
363 Ga0265314_10024866 3300031711 Bacteria 4531
364 Ga0265314_10063917 3300031711 Bacteria 2494
365 Ga0265342_10002284 3300031712 Bacteria 16696
366 Ga0265342_10039969 3300031712 Bacteria 2847
367 Ga0307409_100353576 3300031995 Bacteria 1387
368 Ga0307416_100620969 3300032002 Bacteria 1163
369 Ga0373930_0025295 3300034816 Bacteria 1191
370 Ga0373948_0018876 3300034817 Bacteria 1299
371 Ga0373950_0014406 3300034818 Bacteria 1330
372 Ga0373958_0022890 3300034819 Bacteria 1171
373 Ga0373928_0002466 3300035084 Bacteria 3585
374 Ga0373929_0008341 3300035085 Bacteria 1907
375 Ga0373929_0047337 3300035085 Bacteria 974
376 Ga0373940_0002372 3300035088 Bacteria 3650
377 Ga0373949_0018946 3300035090 Bacteria 1564
378 Ga0373949_0034268 3300035090 Bacteria 1223
379 Ga0373952_0015434 3300035092 Bacteria 1542
380 Ga0373932_0053061 3300035112 Bacteria 1209
381 Ga0373936_0226757 3300035113 Bacteria 830
382 Ga0373939_0009176 3300035114 Bacteria 2448
383 Ga0373939_0056783 3300035114 Bacteria 1233
384 Ga0373941_0050757 3300035115 Bacteria 1318
385 Ga0373945_0127470 3300035116 Bacteria 1017
386 Ga0373956_0126344 3300035119 Bacteria 1196
387 Ga0373960_0040347 3300035121 Bacteria 1347
388 Ga0373960_0109514 3300035121 Bacteria 904
389 Ga0373943_0009056 3300035170 Bacteria 4463
390 Ga0373943_0009458 3300035170 Bacteria 4367
391 Ga0373946_0128855 3300035171 Bacteria 1162
392 Ga0373942_0010366 3300035207 Bacteria 2193
393 Ga0373962_0082461 3300035242 Bacteria 978
394 Ga0373931_0122543 3300035691 Bacteria 1487
395 Ga0373935_0090710 3300035692 Bacteria 2001
396 Ga0373935_0275995 3300035692 Bacteria 1182
397 Ga0373933_0136681 3300035724 Bacteria 1544
398 Ga0373947_0001889 3300035725 Bacteria 12792
399 Ga0373947_0004758 3300035725 Bacteria 7954
400 Ga0373947_0108596 3300035725 Bacteria 1751
401 Ga0373947_0174902 3300035725 Bacteria 1395
402 Ga0373937_0050373 3300036401 Bacteria 3814
403 Ga0373937_0068594 3300036401 Bacteria 3270
404 Ga0373937_0090274 3300036401 Bacteria 2837
405 Ga0373925_0006392 3300037068 Bacteria 8674
406 Ga0373925_0058176 3300037068 Bacteria 2898
407 Ga0395899_0006447 3300037312 Bacteria 9092
408 Ga0395899_0012260 3300037312 Bacteria 6565
409 Ga0395899_0036494 3300037312 Bacteria 3687
410 Ga0395899_0047795 3300037312 Bacteria 3185
411 Ga0395900_0016807 3300037418 Bacteria 7463
412 Ga0395900_0028036 3300037418 Bacteria 5766
413 Ga0395900_0058052 3300037418 Bacteria 3984
414 Ga0395900_0154892 3300037418 Bacteria 2340
415 Ga0395900_0266364 3300037418 Unclassified 1709
416 Ga0395900_0277957 3300037418 Bacteria 1667
417 Ga0395900_0986087 3300037418 Bacteria 763
418 Ga0395898_0005676 3300037466 Bacteria 13452
419 Ga0395898_0032509 3300037466 Bacteria 5208
420 Ga0395898_0041249 3300037466 Bacteria 4559
421 Ga0395898_0100449 3300037466 Bacteria 2778
422 Ga0395898_0146815 3300037466 Bacteria 2257
423 Ga0395898_0212438 3300037466 Bacteria 1845
424 Ga0395898_0637541 3300037466 Bacteria 1008
425 Ga0395898_0835161 3300037466 Bacteria 861
426 Ga0395905_0014996 3300037471 Bacteria 7388
427 Ga0395905_0031041 3300037471 Bacteria 5032
428 Ga0395905_0068058 3300037471 Bacteria 3335
429 Ga0395905_0114138 3300037471 Bacteria 2538
430 Ga0395905_0163484 3300037471 Bacteria 2092
431 Ga0395901_0010862 3300038443 Bacteria 9229
432 Ga0395901_0012545 3300038443 Bacteria 8599
433 Ga0395901_0017744 3300038443 Bacteria 7264
434 Ga0395901_0047634 3300038443 Bacteria 4451
435 Ga0395901_0073931 3300038443 Bacteria 3556
436 Ga0395901_0111368 3300038443 Bacteria 2874
437 Ga0395901_0182127 3300038443 Bacteria 2203
438 Ga0395901_0208211 3300038443 Bacteria 2048
439 Ga0395901_0227265 3300038443 Bacteria 1949
440 Ga0395901_0459991 3300038443 Bacteria 1300
441 Ga0395901_0567887 3300038443 Bacteria 1148
442 Ga0395901_0633746 3300038443 Bacteria 1074
443 Ga0436360_0765971 3300039438 Bacteria 711
444 Ga0439448_0004141 3300042005 Bacteria 4084
445 Ga0439458_0005889 3300042157 Bacteria 2745
446 Ga0466966_0029609 3300044684 Bacteria 3560
447 Ga0466966_0229434 3300044684 Bacteria 1120
448 Ga0466961_0011754 3300044693 Bacteria 5594
449 Ga0466963_0028895 3300044694 Bacteria 3564
450 Ga0466963_0054554 3300044694 Bacteria 2657
451 Ga0466964_0112682 3300044706 Bacteria 1215
452 Ga0466964_0319412 3300044706 Unclassified 788
453 Ga0466971_0014899 3300044719 Bacteria 3421
454 Ga0466971_0034937 3300044719 Bacteria 2253
455 Ga0466971_0278627 3300044719 Bacteria 800
456 Ga0466957_0004463 3300044842 Bacteria 7802
457 Ga0466957_0044136 3300044842 Bacteria 2702
458 Ga0466957_0054945 3300044842 Bacteria 2432
459 Ga0466957_0358655 3300044842 Unclassified 990
460 Ga0466957_0855001 3300044842 Bacteria 648
461 Ga0466960_0188687 3300044901 Bacteria 1121
462 Ga0466959_0021166 3300045049 Bacteria 4794
463 Ga0466959_0052189 3300045049 Bacteria 2996
464 Ga0451576_0305697 3300045051 Bacteria 1664
465 Ga0451576_0535303 3300045051 Bacteria 1231
466 Ga0466958_0015024 3300045836 Bacteria 4429
467 Ga0466958_0090592 3300045836 Bacteria 1892
468 Ga0466958_0200536 3300045836 Bacteria 1270
469 Ga0466967_0009558 3300045976 Bacteria 7204
470 Ga0466967_0030174 3300045976 Bacteria 4548
471 Ga0466967_0059136 3300045976 Bacteria 3391
472 Ga0466967_0170490 3300045976 Bacteria 2047
473 Ga0466967_0179452 3300045976 Bacteria 1996
474 Ga0466967_0211004 3300045976 Bacteria 1842
475 Ga0466967_0298488 3300045976 Bacteria 1549
476 Ga0466967_0707056 3300045976 Bacteria 998
477 Ga0466967_0867962 3300045976 Bacteria 897
478 Ga0495592_0000125 3300046454 Bacteria 68045
479 Ga0495603_0003255 3300046455 Bacteria 9675
480 Ga0495603_0003932 3300046455 Bacteria 8856
481 Ga0495629_0476069 3300046459 Bacteria 844
482 Ga0495641_0003822 3300046461 Bacteria 11006
483 Ga0495641_0012917 3300046461 Bacteria 4632
484 Ga0495641_0061226 3300046461 Bacteria 1699
485 Ga0495651_0000104 3300046462 Bacteria 61716
486 Ga0495653_0005005 3300046463 Bacteria 10755
487 Ga0495653_0019318 3300046463 Bacteria 5527
488 Ga0495580_0023007 3300046472 Bacteria 4582
489 Ga0495582_0020131 3300046473 Bacteria 3651
490 Ga0495582_0077124 3300046473 Bacteria 1848
491 Ga0495582_0094294 3300046473 Bacteria 1671
492 Ga0495594_0003266 3300046499 Bacteria 8404
493 Ga0495608_0000595 3300046511 Bacteria 24865
494 Ga0495608_0012057 3300046511 Bacteria 6008
495 Ga0495618_0000555 3300046514 Bacteria 26538
496 Ga0495628_0000040 3300046516 Bacteria 104506
497 Ga0495630_0051392 3300046517 Bacteria 3085
498 Ga0495630_0681690 3300046517 Bacteria 787
499 Ga0495663_0074267 3300046525 Bacteria 1087
500 Ga0495652_0000298 3300046529 Bacteria 59074
501 Ga0495652_0482949 3300046529 Bacteria 862
502 Ga0495652_0487316 3300046529 Bacteria 857
503 Ga0495587_0000212 3300046536 Bacteria 43340
504 Ga0495609_0086030 3300046538 Bacteria 1371
505 Ga0495645_0000035 3300046543 Bacteria 102305
506 Ga0495622_0154728 3300046557 Bacteria 1036
507 Ga0495667_0357409 3300046559 Bacteria 922
508 Ga0495656_0575279 3300046615 Bacteria 602
509 Ga0495634_0170881 3300046642 Bacteria 1366
510 Ga0495634_0282838 3300046642 Bacteria 1007
511 Ga0495611_0228256 3300046648 Bacteria 866
512 Ga0495635_0095524 3300046663 Bacteria 2032
513 Ga0495659_0364044 3300046664 Bacteria 620
514 Ga0495588_0000960 3300046674 Bacteria 12571
515 Ga0495657_0002891 3300046675 Bacteria 14255
516 Ga0495657_0098829 3300046675 Bacteria 1862
517 Ga0495599_0000009 3300046678 Bacteria 217299
518 Ga0495623_0003382 3300046679 Bacteria 10544
519 Ga0495647_0086478 3300046681 Bacteria 1279
520 Ga0495658_0311921 3300046683 Bacteria 996
521 Ga0495613_0309834 3300046689 Bacteria 1091
522 Ga0495624_0120402 3300046690 Bacteria 1612
523 Ga0495624_0236201 3300046690 Bacteria 1107
524 Ga0495589_0212785 3300046794 Bacteria 910
525 Ga0495600_0068549 3300046809 Bacteria 2318
526 Ga0495581_0006926 3300047315 Bacteria 6569
527 Ga0495581_0064668 3300047315 Bacteria 2114
528 Ga0495604_0000120 3300047317 Bacteria 66462
529 Ga0495674_0623502 3300047319 Bacteria 852
530 Ga0495674_0645880 3300047319 Bacteria 835
531 Ga0495676_0026671 3300047321 Bacteria 4969
532 Ga0495676_0070810 3300047321 Bacteria 2683
533 Ga0495676_0091898 3300047321 Bacteria 2266
534 Ga0495680_0008617 3300047322 Bacteria 9258
535 Ga0495680_0636154 3300047322 Bacteria 710
536 Ga0495675_0000029 3300047444 Bacteria 105305
537 Ga0495593_0104539 3300047673 Unclassified 1450
538 Ga0495602_0001635 3300048088 Bacteria 22289
539 Ga0495602_0474158 3300048088 Bacteria 879
540 Ga0496100_0013505 3300048903 Bacteria 4713
541 Ga0496100_0057784 3300048903 Bacteria 2542
542 Ga0496100_0058972 3300048903 Bacteria 2520
543 Ga0496100_0102968 3300048903 Bacteria 1971
544 Ga0496101_0012098 3300048904 Bacteria 5751
545 Ga0496101_0014083 3300048904 Bacteria 5371
546 Ga0496101_0071463 3300048904 Bacteria 2544
547 Ga0496101_0360883 3300048904 Bacteria 1142
548 Ga0496102_0071839 3300048905 Bacteria 3178
549 Ga0496102_0107761 3300048905 Bacteria 2594
550 Ga0496102_0181790 3300048905 Bacteria 1981
551 Ga0496102_0189094 3300048905 Bacteria 1940
552 Ga0496102_0387413 3300048905 Bacteria 1315
553 Ga0496103_0090568 3300048906 Bacteria 1930
554 Ga0496103_0123025 3300048906 Bacteria 1653
555 Ga0496103_0139112 3300048906 Bacteria 1552
556 Ga0496103_0143566 3300048906 Bacteria 1527
557 Ga0496103_0343517 3300048906 Bacteria 960
558 Ga0496104_0003284 3300048907 Bacteria 13957
559 Ga0496104_0008469 3300048907 Bacteria 9144
560 Ga0496104_0156913 3300048907 Bacteria 2184
561 Ga0496104_0484179 3300048907 Bacteria 1148
562 Ga0496104_0880728 3300048907 Bacteria 800
563 Ga0496105_0007484 3300048908 Bacteria 8457
564 Ga0496105_0009640 3300048908 Bacteria 7559
565 Ga0496105_0029108 3300048908 Bacteria 4520
566 Ga0496105_0084329 3300048908 Bacteria 2624
567 Ga0496105_0149958 3300048908 Bacteria 1917
568 Ga0496106_0021124 3300048909 Bacteria 4833
569 Ga0496106_0028800 3300048909 Bacteria 4138
570 Ga0496106_0037436 3300048909 Bacteria 3629
571 Ga0496106_0084328 3300048909 Bacteria 2445
572 Ga0496106_0119319 3300048909 Bacteria 2060
573 Ga0496106_0372270 3300048909 Bacteria 1148
574 Ga0496106_0439730 3300048909 Bacteria 1048
575 Ga0496107_0000634 3300048910 Bacteria 19794
576 Ga0496107_0035061 3300048910 Bacteria 3596
577 Ga0496107_0037492 3300048910 Bacteria 3478
578 Ga0496108_0008834 3300048911 Bacteria 8165
579 Ga0496108_0032911 3300048911 Bacteria 4306
580 Ga0496108_0052310 3300048911 Bacteria 3422
581 Ga0496108_0234939 3300048911 Bacteria 1594
582 Ga0496108_0427732 3300048911 Bacteria 1156
583 Ga0496109_0048783 3300048912 Bacteria 3852
584 Ga0496109_0098001 3300048912 Bacteria 2718
585 Ga0496109_0117591 3300048912 Bacteria 2474
586 Ga0496109_0228907 3300048912 Bacteria 1748
587 Ga0496109_0240879 3300048912 Bacteria 1702
588 Ga0496109_0285698 3300048912 Bacteria 1555
589 Ga0496109_0418348 3300048912 Bacteria 1266
590 Ga0496110_0002409 3300048913 Bacteria 14002
591 Ga0496110_0039329 3300048913 Bacteria 4118
592 Ga0496110_0053245 3300048913 Bacteria 3557
593 Ga0496110_0064556 3300048913 Bacteria 3236
594 Ga0496110_0163125 3300048913 Bacteria 2020
595 Ga0496110_0215676 3300048913 Bacteria 1745
596 Ga0496110_0258560 3300048913 Bacteria 1585
597 Ga0496110_0321175 3300048913 Bacteria 1410
598 Ga0496110_0330448 3300048913 Bacteria 1389
599 Ga0496110_0956706 3300048913 Bacteria 763
600 Ga0496111_0005035 3300048914 Bacteria 8406
601 Ga0496111_0007296 3300048914 Bacteria 7235
602 Ga0496111_0011625 3300048914 Bacteria 5938
603 Ga0496111_0081773 3300048914 Bacteria 2358
604 Ga0496111_0155448 3300048914 Bacteria 1697
605 Ga0496112_0004085 3300048915 Bacteria 12260
606 Ga0496112_0023950 3300048915 Bacteria 5841
607 Ga0496112_0044495 3300048915 Bacteria 4350
608 Ga0496112_0066344 3300048915 Bacteria 3561
609 Ga0496112_0087764 3300048915 Bacteria 3078
610 Ga0496112_0223719 3300048915 Bacteria 1837
611 Ga0496112_0463491 3300048915 Bacteria 1204
612 Ga0496112_0687186 3300048915 Bacteria 952
613 Ga0496112_0756338 3300048915 Bacteria 898
614 Ga0496112_0950153 3300048915 Bacteria 780
615 Ga0496113_0238850 3300048916 Bacteria 1449
616 Ga0496113_0323524 3300048916 Bacteria 1236
617 Ga0496113_0510120 3300048916 Bacteria 965
618 Ga0496114_0002005 3300048917 Bacteria 15475
619 Ga0496114_0013992 3300048917 Bacteria 6431
620 Ga0496114_0028680 3300048917 Bacteria 4569
621 Ga0496114_0112644 3300048917 Bacteria 2332
622 Ga0496114_0150619 3300048917 Bacteria 2018
623 Ga0496114_0389167 3300048917 Bacteria 1235
624 Ga0496114_0471276 3300048917 Bacteria 1111
625 Ga0496115_0033022 3300048918 Bacteria 4084
626 Ga0496115_0039677 3300048918 Bacteria 3740
627 Ga0496115_0049163 3300048918 Bacteria 3374
628 Ga0496115_0478033 3300048918 Bacteria 1004
629 Ga0501040_0118711 3300049576 Bacteria 1855
630 Ga0501069_0009114 3300049585 Bacteria 5237
631 Ga0501070_0023705 3300049586 Bacteria 5142
632 Ga0501070_0088021 3300049586 Bacteria 2571
633 Ga0501072_0007646 3300049588 Bacteria 8202
634 Ga0501073_0270097 3300049589 Bacteria 1173
635 Ga0501074_0079288 3300049590 Bacteria 2356
636 Ga0501076_0228359 3300049592 Unclassified 1522
637 Ga0501079_0040839 3300049741 Bacteria 3580
638 Ga0501080_0087871 3300049742 Bacteria 2887
639 Ga0501080_0414297 3300049742 Bacteria 1211
640 Ga0501081_0127789 3300049743 Bacteria 1814
641 Ga0501083_0000751 3300049744 Bacteria 21158
642 Ga0501083_0145475 3300049744 Bacteria 1552
643 Ga0501045_0557399 3300049824 Bacteria 850
644 nmdc:mga05p37_1799919_c1 3300050507 Unclassified 591
645 nmdc:mga05p37_298313_c1 3300050507 Bacteria 1916
646 nmdc:mga05p37_351609_c1 3300050507 Bacteria 1735
647 nmdc:mga05p37_820753_c1 3300050507 Unclassified 1014
648 nmdc:mga06r32_339138_c1 3300050510 Bacteria 1488
649 nmdc:mga08y16_157827_c1 3300050511 Bacteria 2358
650 nmdc:mga08y16_84698_c1 3300050511 Bacteria 3305
651 nmdc:mga0n895_30266_c1 3300050512 Bacteria 5172
652 nmdc:mga0n895_44035_c1 3300050512 Bacteria 4353
653 nmdc:mga0n895_64059_c1 3300050512 Bacteria 3636
654 nmdc:mga0n895_869209_c1 3300050512 Bacteria 889
655 nmdc:mga0rr50_156638_c1 3300050513 Bacteria 1846
656 nmdc:mga0rr50_16056_c1 3300050513 Bacteria 4961
657 nmdc:mga0rr50_246684_c1 3300050513 Bacteria 1482
658 nmdc:mga0rr50_27888_c1 3300050513 Bacteria 3962
659 nmdc:mga0rr50_7361_c1 3300050513 Bacteria 6783
660 nmdc:mga08x19_60376_c1 3300050514 Bacteria 2456
661 nmdc:mga08x19_8882_c1 3300050514 Bacteria 5994
662 nmdc:mga08x19_9579_c1 3300050514 Bacteria 5798
663 nmdc:mga0a205_175222_c1 3300050515 Bacteria 2040
664 nmdc:mga0a205_24008_c1 3300050515 Bacteria 5790
665 nmdc:mga0a205_386078_c1 3300050515 Bacteria 1265
666 nmdc:mga0a205_59673_c1 3300050515 Bacteria 3685
667 nmdc:mga0a205_9254_c2 3300050515 Bacteria 3202
668 Ga0495601_0000496 3300053077 Bacteria 20681
669 Ga0495601_0451300 3300053077 Bacteria 832
670 Ga0495612_0014802 3300053078 Unclassified 3130
671 Ga0495619_0023175 3300053085 Bacteria 3978
672 Ga0495619_0029915 3300053085 Bacteria 3522
673 Ga0495619_0284769 3300053085 Bacteria 1145
674 Ga0501084_0193062 3300054114 Bacteria 1718
675 Ga0501084_0260076 3300054114 Bacteria 1465
676 Ga0501084_0753176 3300054114 Bacteria 821
677 Ga0501082_0994423 3300060353 Bacteria 733
678 Ga0466962_0013776 3300061719 Bacteria 3892
679 Ga0466962_0031892 3300061719 Bacteria 2523
680 Ga0466962_0075502 3300061719 Bacteria 1610
681 Ga0530510_0014667 3300061734 Bacteria 5532
682 Ga0451839_0049611
683 Ga0070658_10038523
684 Ga0070658_10040158
685 Ga0070658_10070344
686 Ga0070658_10342567
687 Ga0070683_100130780
688 Ga0070683_100224141
689 Ga0070690_101116361
690 Ga0070680_100219488
691 Ga0070680_100975301
692 Ga0070682_100009361
693 Ga0070682_100179149
694 Ga0070682_100228833
695 Ga0070682_100509777
696 Ga0068868_100074746
697 Ga0068868_100342040
698 Ga0068868_101025114
699 Ga0070660_100009851
700 Ga0070660_100011347
701 Ga0070660_100014362
702 Ga0070660_100046579
703 Ga0070691_10067399
704 Ga0070691_10136952
705 Ga0070661_100786602
706 Ga0070692_10780205
707 Ga0070668_100329717
708 Ga0070668_100396423
709 Ga0070675_100534115
710 Ga0070671_100436988
711 Ga0070674_100243733
712 Ga0070673_100130296
713 Ga0070688_100162356
714 Ga0070659_100209209
715 Ga0070659_100442865
716 Ga0070703_10021687
717 Ga0070709_10013845
718 Ga0070709_10129268
719 Ga0070714_100002410
720 Ga0070714_100082674
721 Ga0070714_100105936
722 Ga0070713_100002387
723 Ga0070713_100217953
724 Ga0070713_100337552
725 Ga0070713_100616521
726 Ga0070710_10087367
727 Ga0070710_10221350
728 Ga0070701_10190025
729 Ga0070701_10197661
730 Ga0070701_10783808
731 Ga0070711_100015520
732 Ga0070711_100039160
733 Ga0070705_100054192
734 Ga0070705_100100849
735 Ga0070705_100233351
736 Ga0070694_100173396
737 Ga0070708_100206003
738 Ga0070708_100223922
739 Ga0070708_100451642
740 Ga0070663_100053281
741 Ga0070678_100106155
742 Ga0070678_100192421
743 Ga0070681_10084054
744 Ga0070681_10186949
745 Ga0068867_100093398
746 Ga0070685_10110673
747 Ga0070706_100208918
748 Ga0070706_100761673
749 Ga0070707_100136026
750 Ga0070707_100430621
751 Ga0070698_100047893
752 Ga0070698_100289880
753 Ga0070699_100010285
754 Ga0070699_100183458
755 Ga0070699_100462346
756 Ga0070679_100083947
757 Ga0070679_100097372
758 Ga0070679_100124152
759 Ga0070679_100276780
760 Ga0070679_101141928
761 Ga0070679_101145537
762 Ga0070684_100308435
763 Ga0070684_100487814
764 Ga0070684_100499562
765 Ga0070684_100580942
766 Ga0070697_100066356
767 Ga0070697_100594029
768 Ga0070672_100544852
769 Ga0070686_100004678
770 Ga0070686_100149644
771 Ga0070695_100047691
772 Ga0070695_100104882
773 Ga0070695_100209405
774 Ga0070695_100357538
775 Ga0070696_100063543
776 Ga0070696_100066357
777 Ga0070696_100085962
778 Ga0070696_100099291
779 Ga0070696_100276996
780 Ga0070693_100048605
781 Ga0070704_100062258
782 Ga0070704_100313817
783 Ga0070704_100338660
784 Ga0070704_100569218
785 Ga0070704_100909869
786 Ga0068855_100060417
787 Ga0068855_100088026
788 Ga0068855_100117001
789 Ga0068855_100216002
790 Ga0068855_100991771
791 Ga0068854_100697678
792 Ga0068856_100054725
793 Ga0068856_100149834
794 Ga0068856_100164966
795 Ga0068852_100116071
796 Ga0068852_100749267
797 Ga0068859_100204441
798 Ga0068866_10009869
799 Ga0068861_100002581
800 Ga0068860_100106354
801 Ga0068862_100065974
802 Ga0081455_10001217
803 Ga0070717_10084992
804 Ga0070717_10148643
805 Ga0070717_10499304
806 Ga0070717_10659387
807 Ga0075364_10373641
808 Ga0075432_10060894
809 Ga0070715_10000223
810 Ga0070715_10003374
811 Ga0070715_10033170
812 Ga0070716_100005561
813 Ga0070712_100002808
814 Ga0097621_100081979
815 Ga0068871_100024214
816 Ga0068871_100153921
817 Ga0068871_100171210
818 Ga0075428_100042066
819 Ga0075428_100814674
820 Ga0075433_10012194
821 Ga0075433_10091022
822 Ga0075433_10140516
823 Ga0075433_10421197
824 Ga0075433_10702181
825 Ga0075434_100001314
826 Ga0075434_100015211
827 Ga0075434_100105873
828 Ga0075434_100325557
829 Ga0068865_100012985
830 Ga0068865_100605175
831 Ga0075436_100010403
832 Ga0075436_100013058
833 Ga0075436_100080544
834 Ga0097620_100204438
835 Ga0075435_100021112
836 Ga0075435_100041412
837 Ga0075435_100079435
838 Ga0075435_100116860
839 Ga0075435_100189973
840 Ga0105240_10653774
841 Ga0111539_10075680
842 Ga0111539_10312171
843 Ga0111539_11450025
844 Ga0105245_10280459
845 Ga0105245_10464766
846 Ga0105245_10535866
847 Ga0105245_10619475
848 Ga0105245_11029455
849 Ga0114129_10072428
850 Ga0114129_10232920
851 Ga0114129_10542185
852 Ga0114129_10736630
853 Ga0105243_10098017
854 Ga0105243_10636208
855 Ga0105241_10054114
856 Ga0105241_10062957
857 Ga0105241_10397040
858 Ga0105241_10406299
859 Ga0105242_10018858
860 Ga0105242_10040232
861 Ga0105242_10424205
862 Ga0105242_10459261
863 Ga0105248_10972798
864 Ga0105248_11339947
865 Ga0105237_11196764
866 Ga0105249_10277738
867 Ga0105249_10792875
868 Ga0105239_10029797
869 Ga0105239_10258402
870 Ga0105239_10287508
871 Ga0105239_10527474
872 Ga0105239_11869964
873 Ga0105246_10257927
874 Ga0157343_1003224
875 Ga0157373_10167199
876 Ga0157373_10232197
877 Ga0157373_10524363
878 Ga0157371_10139861
879 Ga0157370_10091369
880 Ga0157370_10101542
881 Ga0157369_10019574
882 Ga0157369_10034438
883 Ga0157369_10090340
884 Ga0157369_10677536
885 Ga0157369_10717469
886 Ga0157369_11324296
887 Ga0157374_10114051
888 Ga0157378_10184002
889 Ga0163162_10396272
890 Ga0157372_10046430
891 Ga0157372_10336820
892 Ga0157372_10787331
893 Ga0157372_12471127
894 Ga0157375_10253651
895 Ga0182008_10157121
896 Ga0157376_10295694
897 Ga0157376_10624451
898 Ga0163161_10151336
899 Ga0206354_10369313
900 Ga0206353_10590963
901 Ga0224712_10012329
902 Ga0207653_10016476
903 Ga0207692_10004162
904 Ga0207642_10060709
905 Ga0207688_10087946
906 Ga0207688_10508556
907 Ga0207680_10214987
908 Ga0207699_10009017
909 Ga0207699_10020151
910 Ga0207699_10076174
911 Ga0207699_10125121
912 Ga0207705_10038377
913 Ga0207705_10093662
914 Ga0207705_10491177
915 Ga0207684_10096178
916 Ga0207654_10041411
917 Ga0207654_10202213
918 Ga0207654_10814805
919 Ga0207707_10129166
920 Ga0207707_10165415
921 Ga0207707_10340868
922 Ga0207707_10412102
923 Ga0207671_10638973
924 Ga0207693_10000417
925 Ga0207693_10003150
926 Ga0207693_10285396
927 Ga0207663_10001106
928 Ga0207663_10017863
929 Ga0207663_10020346
930 Ga0207660_10145419
931 Ga0207660_10244234
932 Ga0207662_10136931
933 Ga0207657_10020049
934 Ga0207657_10027020
935 Ga0207657_10036563
936 Ga0207657_10054218
937 Ga0207657_10054699
938 Ga0207649_10265692
939 Ga0207652_10031017
940 Ga0207652_10124299
941 Ga0207652_10241978
942 Ga0207646_10035328
943 Ga0207646_10342808
944 Ga0207646_10579378
945 Ga0207694_10926245
946 Ga0207694_11075083
947 Ga0207687_10045576
948 Ga0207687_10173254
949 Ga0207687_10245655
950 Ga0207687_10251509
951 Ga0207687_10325867
952 Ga0207700_10029767
953 Ga0207700_10039566
954 Ga0207700_10409050
955 Ga0207700_10416009
956 Ga0207700_10517190
957 Ga0207700_10720930
958 Ga0207664_10024027
959 Ga0207664_10054673
960 Ga0207664_10409545
961 Ga0207664_10437924
962 Ga0207644_10328532
963 Ga0207690_10093396
964 Ga0207690_10123165
965 Ga0207690_10281015
966 Ga0207690_10926901
967 Ga0207706_10004543
968 Ga0207706_10492832
969 Ga0207686_10253405
970 Ga0207709_10047454
971 Ga0207709_10077424
972 Ga0207709_10579714
973 Ga0207704_10343084
974 Ga0207665_10000322
975 Ga0207665_10029308
976 Ga0207691_10424909
977 Ga0207689_10181630
978 Ga0207661_10100931
979 Ga0207661_11069368
980 Ga0207679_10044387
981 Ga0207667_10126828
982 Ga0207667_10171992
983 Ga0207667_10270935
984 Ga0207667_10302307
985 Ga0207667_10365326
986 Ga0207651_10142436
987 Ga0207712_10137205
988 Ga0207639_10397500
989 Ga0207639_10801631
990 Ga0207639_11143471
991 Ga0207678_10041229
992 Ga0207678_10574514
993 Ga0207702_10005955
994 Ga0207702_10098181
995 Ga0207702_10231871
996 Ga0207648_10029930
997 Ga0207648_10369548
998 Ga0207676_10352484
999 Ga0207675_100140724
1000 Ga0207675_100157000
1001 Ga0207683_10004330
1002 Ga0207683_10158188
1003 Ga0207683_10779756
1004 Ga0207698_10129488
1005 Ga0207428_10003682
1006 Ga0207428_10060723
1007 Ga0268265_10097215
1008 Ga0265326_10018562
1009 Ga0265319_1004340
1010 Ga0265319_1012196
1011 Ga0265334_10002668
1012 Ga0265318_10001162
1013 Ga0265318_10092644
1014 Ga0265322_10004706
1015 Ga0265338_10004801
1016 Ga0265338_10005068
1017 Ga0265338_10028345
1018 Ga0265338_10038780
1019 Ga0265330_10001175
1020 Ga0265330_10082018
1021 Ga0265332_10001094
1022 Ga0265332_10050701
1023 Ga0265332_10138763
1024 Ga0265328_10007036
1025 Ga0265320_10005081
1026 Ga0265320_10226581
1027 Ga0265325_10000949
1028 Ga0265325_10030285
1029 Ga0265329_10005791
1030 Ga0265340_10009485
1031 Ga0265340_10108474
1032 Ga0265339_10001880
1033 Ga0265339_10006211
1034 Ga0265339_10138542
1035 Ga0265331_10017552
1036 Ga0265331_10180648
1037 Ga0265327_10004531
1038 Ga0265327_10009219
1039 Ga0265327_10048809
1040 Ga0265316_10002243
1041 Ga0265316_10148862
1042 Ga0265313_10001261
1043 Ga0265314_10003398
1044 Ga0265314_10024866
1045 Ga0265314_10063917
1046 Ga0265342_10002284
1047 Ga0265342_10039969
1048 Ga0307409_100353576
1049 Ga0307416_100620969
1050 Ga0373930_0025295
1051 Ga0373948_0018876
1052 Ga0373950_0014406
1053 Ga0373958_0022890
1054 Ga0373928_0002466
1055 Ga0373929_0008341
1056 Ga0373929_0047337
1057 Ga0373940_0002372
1058 Ga0373949_0018946
1059 Ga0373949_0034268
1060 Ga0373952_0015434
1061 Ga0373932_0053061
1062 Ga0373936_0226757
1063 Ga0373939_0009176
1064 Ga0373939_0056783
1065 Ga0373941_0050757
1066 Ga0373945_0127470
1067 Ga0373956_0126344
1068 Ga0373960_0040347
1069 Ga0373960_0109514
1070 Ga0373943_0009056
1071 Ga0373943_0009458
1072 Ga0373946_0128855
1073 Ga0373942_0010366
1074 Ga0373962_0082461
1075 Ga0373931_0122543
1076 Ga0373935_0090710
1077 Ga0373935_0275995
1078 Ga0373933_0136681
1079 Ga0373947_0001889
1080 Ga0373947_0004758
1081 Ga0373947_0108596
1082 Ga0373947_0174902
1083 Ga0373937_0050373
1084 Ga0373937_0068594
1085 Ga0373937_0090274
1086 Ga0373925_0006392
1087 Ga0373925_0058176
1088 Ga0395899_0006447
1089 Ga0395899_0012260
1090 Ga0395899_0036494
1091 Ga0395899_0047795
1092 Ga0395900_0016807
1093 Ga0395900_0028036
1094 Ga0395900_0058052
1095 Ga0395900_0154892
1096 Ga0395900_0266364
1097 Ga0395900_0277957
1098 Ga0395900_0986087
1099 Ga0395898_0005676
1100 Ga0395898_0032509
1101 Ga0395898_0041249
1102 Ga0395898_0100449
1103 Ga0395898_0146815
1104 Ga0395898_0212438
1105 Ga0395898_0637541
1106 Ga0395898_0835161
1107 Ga0395905_0014996
1108 Ga0395905_0031041
1109 Ga0395905_0068058
1110 Ga0395905_0114138
1111 Ga0395905_0163484
1112 Ga0395901_0010862
1113 Ga0395901_0012545
1114 Ga0395901_0017744
1115 Ga0395901_0047634
1116 Ga0395901_0073931
1117 Ga0395901_0111368
1118 Ga0395901_0182127
1119 Ga0395901_0208211
1120 Ga0395901_0227265
1121 Ga0395901_0459991
1122 Ga0395901_0567887
1123 Ga0395901_0633746
1124 Ga0436360_0765971
1125 Ga0439448_0004141
1126 Ga0439458_0005889
1127 Ga0466966_0029609
1128 Ga0466966_0229434
1129 Ga0466961_0011754
1130 Ga0466963_0028895
1131 Ga0466963_0054554
1132 Ga0466964_0112682
1133 Ga0466964_0319412
1134 Ga0466971_0014899
1135 Ga0466971_0034937
1136 Ga0466971_0278627
1137 Ga0466957_0004463
1138 Ga0466957_0044136
1139 Ga0466957_0054945
1140 Ga0466957_0358655
1141 Ga0466957_0855001
1142 Ga0466960_0188687
1143 Ga0466959_0021166
1144 Ga0466959_0052189
1145 Ga0451576_0305697
1146 Ga0451576_0535303
1147 Ga0466958_0015024
1148 Ga0466958_0090592
1149 Ga0466958_0200536
1150 Ga0466967_0009558
1151 Ga0466967_0030174
1152 Ga0466967_0059136
1153 Ga0466967_0170490
1154 Ga0466967_0179452
1155 Ga0466967_0211004
1156 Ga0466967_0298488
1157 Ga0466967_0707056
1158 Ga0466967_0867962
1159 Ga0495592_0000125
1160 Ga0495603_0003255
1161 Ga0495603_0003932
1162 Ga0495629_0476069
1163 Ga0495641_0003822
1164 Ga0495641_0012917
1165 Ga0495641_0061226
1166 Ga0495651_0000104
1167 Ga0495653_0005005
1168 Ga0495653_0019318
1169 Ga0495580_0023007
1170 Ga0495582_0020131
1171 Ga0495582_0077124
1172 Ga0495582_0094294
1173 Ga0495594_0003266
1174 Ga0495608_0000595
1175 Ga0495608_0012057
1176 Ga0495618_0000555
1177 Ga0495628_0000040
1178 Ga0495630_0051392
1179 Ga0495630_0681690
1180 Ga0495663_0074267
1181 Ga0495652_0000298
1182 Ga0495652_0482949
1183 Ga0495652_0487316
1184 Ga0495587_0000212
1185 Ga0495609_0086030
1186 Ga0495645_0000035
1187 Ga0495622_0154728
1188 Ga0495667_0357409
1189 Ga0495656_0575279
1190 Ga0495634_0170881
1191 Ga0495634_0282838
1192 Ga0495611_0228256
1193 Ga0495635_0095524
1194 Ga0495659_0364044
1195 Ga0495588_0000960
1196 Ga0495657_0002891
1197 Ga0495657_0098829
1198 Ga0495599_0000009
1199 Ga0495623_0003382
1200 Ga0495647_0086478
1201 Ga0495658_0311921
1202 Ga0495613_0309834
1203 Ga0495624_0120402
1204 Ga0495624_0236201
1205 Ga0495589_0212785
1206 Ga0495600_0068549
1207 Ga0495581_0006926
1208 Ga0495581_0064668
1209 Ga0495604_0000120
1210 Ga0495674_0623502
1211 Ga0495674_0645880
1212 Ga0495676_0026671
1213 Ga0495676_0070810
1214 Ga0495676_0091898
1215 Ga0495680_0008617
1216 Ga0495680_0636154
1217 Ga0495675_0000029
1218 Ga0495593_0104539
1219 Ga0495602_0001635
1220 Ga0495602_0474158
1221 Ga0496100_0013505
1222 Ga0496100_0057784
1223 Ga0496100_0058972
1224 Ga0496100_0102968
1225 Ga0496101_0012098
1226 Ga0496101_0014083
1227 Ga0496101_0071463
1228 Ga0496101_0360883
1229 Ga0496102_0071839
1230 Ga0496102_0107761
1231 Ga0496102_0181790
1232 Ga0496102_0189094
1233 Ga0496102_0387413
1234 Ga0496103_0090568
1235 Ga0496103_0123025
1236 Ga0496103_0139112
1237 Ga0496103_0143566
1238 Ga0496103_0343517
1239 Ga0496104_0003284
1240 Ga0496104_0008469
1241 Ga0496104_0156913
1242 Ga0496104_0484179
1243 Ga0496104_0880728
1244 Ga0496105_0007484
1245 Ga0496105_0009640
1246 Ga0496105_0029108
1247 Ga0496105_0084329
1248 Ga0496105_0149958
1249 Ga0496106_0021124
1250 Ga0496106_0028800
1251 Ga0496106_0037436
1252 Ga0496106_0084328
1253 Ga0496106_0119319
1254 Ga0496106_0372270
1255 Ga0496106_0439730
1256 Ga0496107_0000634
1257 Ga0496107_0035061
1258 Ga0496107_0037492
1259 Ga0496108_0008834
1260 Ga0496108_0032911
1261 Ga0496108_0052310
1262 Ga0496108_0234939
1263 Ga0496108_0427732
1264 Ga0496109_0048783
1265 Ga0496109_0098001
1266 Ga0496109_0117591
1267 Ga0496109_0228907
1268 Ga0496109_0240879
1269 Ga0496109_0285698
1270 Ga0496109_0418348
1271 Ga0496110_0002409
1272 Ga0496110_0039329
1273 Ga0496110_0053245
1274 Ga0496110_0064556
1275 Ga0496110_0163125
1276 Ga0496110_0215676
1277 Ga0496110_0258560
1278 Ga0496110_0321175
1279 Ga0496110_0330448
1280 Ga0496110_0956706
1281 Ga0496111_0005035
1282 Ga0496111_0007296
1283 Ga0496111_0011625
1284 Ga0496111_0081773
1285 Ga0496111_0155448
1286 Ga0496112_0004085
1287 Ga0496112_0023950
1288 Ga0496112_0044495
1289 Ga0496112_0066344
1290 Ga0496112_0087764
1291 Ga0496112_0223719
1292 Ga0496112_0463491
1293 Ga0496112_0687186
1294 Ga0496112_0756338
1295 Ga0496112_0950153
1296 Ga0496113_0238850
1297 Ga0496113_0323524
1298 Ga0496113_0510120
1299 Ga0496114_0002005
1300 Ga0496114_0013992
1301 Ga0496114_0028680
1302 Ga0496114_0112644
1303 Ga0496114_0150619
1304 Ga0496114_0389167
1305 Ga0496114_0471276
1306 Ga0496115_0033022
1307 Ga0496115_0039677
1308 Ga0496115_0049163
1309 Ga0496115_0478033
1310 Ga0501040_0118711
1311 Ga0501069_0009114
1312 Ga0501070_0023705
1313 Ga0501070_0088021
1314 Ga0501072_0007646
1315 Ga0501073_0270097
1316 Ga0501074_0079288
1317 Ga0501076_0228359
1318 Ga0501079_0040839
1319 Ga0501080_0087871
1320 Ga0501080_0414297
1321 Ga0501081_0127789
1322 Ga0501083_0000751
1323 Ga0501083_0145475
1324 Ga0501045_0557399
1325 nmdc:mga05p37_1799919_c1
1326 nmdc:mga05p37_298313_c1
1327 nmdc:mga05p37_351609_c1
1328 nmdc:mga05p37_820753_c1
1329 nmdc:mga06r32_339138_c1
1330 nmdc:mga08y16_157827_c1
1331 nmdc:mga08y16_84698_c1
1332 nmdc:mga0n895_30266_c1
1333 nmdc:mga0n895_44035_c1
1334 nmdc:mga0n895_64059_c1
1335 nmdc:mga0n895_869209_c1
1336 nmdc:mga0rr50_156638_c1
1337 nmdc:mga0rr50_16056_c1
1338 nmdc:mga0rr50_246684_c1
1339 nmdc:mga0rr50_27888_c1
1340 nmdc:mga0rr50_7361_c1
1341 nmdc:mga08x19_60376_c1
1342 nmdc:mga08x19_8882_c1
1343 nmdc:mga08x19_9579_c1
1344 nmdc:mga0a205_175222_c1
1345 nmdc:mga0a205_24008_c1
1346 nmdc:mga0a205_386078_c1
1347 nmdc:mga0a205_59673_c1
1348 nmdc:mga0a205_9254_c2
1349 Ga0495601_0000496
1350 Ga0495601_0451300
1351 Ga0495612_0014802
1352 Ga0495619_0023175
1353 Ga0495619_0029915
1354 Ga0495619_0284769
1355 Ga0501084_0193062
1356 Ga0501084_0260076
1357 Ga0501084_0753176
1358 Ga0501082_0994423
1359 Ga0466962_0013776
1360 Ga0466962_0031892
1361 Ga0466962_0075502
1362 Ga0530510_0014667

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02600

DsbB

Disulfide bond formation protein DsbB

78

205

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ltq-assembly1.cif.gz_A high resolution structure of dsbb c41s by joint calculation with solid-state nmr and x-ray data 0.6711 47 174
2ltq-assembly1.cif.gz_A high resolution structure of dsbb c41s by joint calculation with solid-state nmr and x-ray data 0.5908 47 174
8a6m-assembly1.cif.gz_A phosphatidylserine-dependent synaptic vesicle membrane sculpting by synaptogyrin 0.5239 39 179
8a6m-assembly1.cif.gz_A phosphatidylserine-dependent synaptic vesicle membrane sculpting by synaptogyrin 0.4651 39 179
6akf-assembly1.cif.gz_A crystal structure of mouse claudin-3 p134a mutant in complex with c-terminal fragment of clostridium perfringens enterotoxin 0.444 77 177
ID Description Score Start End Superfamily
2zuqD00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.7154 47 169 1.20.1550.10
2zuqA00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.7121 47 169 1.20.1550.10
af_Q55C26_1_134_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6789 49 188 1.20.140.150
af_A3AD49_1_274_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6311 40 131 1.20.140.150
af_Q7JYX3_1_150_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6141 49 186 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A538F3M6-F1-model_v4 Disulfide bond formation protein B 1.001 46 176 GO:0006457
GO:0015035
GO:0016020
AF-A0A538K525-F1-model_v4 Disulfide bond formation protein B 0.9975 1 178 GO:0006457
GO:0015035
GO:0016020
AF-A0A538K525-F1-model_v4 Disulfide bond formation protein B 0.9865 1 178 GO:0006457
GO:0015035
GO:0016020
AF-A0A538MAS8-F1-model_v4 Disulfide bond formation protein B 0.9809 35 176 GO:0006457
GO:0015035
GO:0016020
AF-A0A538I9L0-F1-model_v4 Disulfide bond formation protein B 0.9741 1 189 GO:0006457
GO:0015035
GO:0016020

Map