F474821

General Info

Members Datasets Scaffolds Average Seq Length
681 212 1362 238

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100136797|Ga0070689_1001367972
Length 255
Sequence MKVRTFLACSMAIAALAACNKNNTWADVVNETSAGGFVMGNPNAKVKLLEIGSLFCPYCKRFEDEGSDALVEKYVKTGNVSWEFRPYVIHGPIDVAANIVARCSGLKTFFPLTKALYKDQPVLEAKIQTVPQDKLQEIQNLPTNQVFVTYANLLGLQDWAAARGLPQAKSNQCLSDQKMIDREVQITSDVNTNIRTSRGPRPSCSTGNCLRRPETGKSSNPSWTPLSSDQGTFRDCPGLLCSRDPGRSGFGAAWN

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
160 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
185 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 3.82
Rhizosphere 95.59
Stem 0
Stem Tuber 0
Unclassified 4.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100136797 3300005340 Bacteria 1968
2 JGI24736J21556_1015881 3300001904 Bacteria 1203
3 JGI24746J21847_1006890 3300001977 Bacteria 1748
4 JGI24747J21853_1002930 3300001978 Bacteria 1439
5 JGI24740J21852_10011918 3300001979 Bacteria 3293
6 JGI24740J21852_10014138 3300001979 Bacteria 2956
7 JGI24740J21852_10042575 3300001979 Bacteria 1360
8 JGI24739J22299_10008246 3300001989 Bacteria 3888
9 JGI24739J22299_10035704 3300001989 Bacteria 1682
10 JGI24737J22298_10008325 3300001990 Bacteria 3478
11 JGI24737J22298_10009266 3300001990 Bacteria 3281
12 JGI24737J22298_10012831 3300001990 Bacteria 2732
13 JGI24737J22298_10024804 3300001990 Bacteria 1898
14 JGI24743J22301_10001834 3300001991 Bacteria 3064
15 JGI24743J22301_10028064 3300001991 Bacteria 1101
16 JGI24735J21928_10008482 3300002067 Bacteria 3320
17 JGI24735J21928_10014232 3300002067 Bacteria 2493
18 JGI24735J21928_10034402 3300002067 Bacteria 1494
19 JGI24735J21928_10036289 3300002067 Bacteria 1446
20 JGI24745J21846_1003588 3300002073 Bacteria 1631
21 JGI24738J21930_10001156 3300002075 Bacteria 7463
22 JGI24738J21930_10008652 3300002075 Bacteria 2313
23 JGI24744J21845_10000454 3300002077 Bacteria 7230
24 JGI24742J22300_10005209 3300002244 Bacteria 2137
25 Ga0065715_10166494 3300005293 Bacteria 1566
26 Ga0070658_10000216 3300005327 Bacteria 51121
27 Ga0070658_10048309 3300005327 Bacteria 3445
28 Ga0070658_10104911 3300005327 Bacteria 2338
29 Ga0070658_10127469 3300005327 Unclassified 2119
30 Ga0070658_10443912 3300005327 Bacteria 1117
31 Ga0070676_10005722 3300005328 Bacteria 6624
32 Ga0070676_10227634 3300005328 Bacteria 1234
33 Ga0070683_100000646 3300005329 Bacteria 25125
34 Ga0070683_100071219 3300005329 Bacteria 3243
35 Ga0070683_100203483 3300005329 Bacteria 1880
36 Ga0070690_100019764 3300005330 Bacteria 4096
37 Ga0070670_100005290 3300005331 Bacteria 10879
38 Ga0070670_100023777 3300005331 Bacteria 5272
39 Ga0070670_100036197 3300005331 Bacteria 4248
40 Ga0070670_100123406 3300005331 Bacteria 2235
41 Ga0070670_100124599 3300005331 Bacteria 2224
42 Ga0070670_100172407 3300005331 Bacteria 1877
43 Ga0070670_100658166 3300005331 Bacteria 940
44 Ga0070677_10008989 3300005333 Bacteria 3379
45 Ga0068869_100372042 3300005334 Unclassified 1169
46 Ga0070666_10000693 3300005335 Bacteria 20437
47 Ga0070666_10074591 3300005335 Bacteria 2312
48 Ga0070680_100033691 3300005336 Bacteria 4130
49 Ga0070680_100304925 3300005336 Bacteria 1351
50 Ga0070682_100020922 3300005337 Bacteria 3855
51 Ga0070682_100035562 3300005337 Bacteria 3042
52 Ga0070682_100072886 3300005337 Bacteria 2202
53 Ga0070682_100203015 3300005337 Bacteria 1399
54 Ga0070682_100251069 3300005337 Bacteria 1275
55 Ga0068868_100001337 3300005338 Bacteria 17015
56 Ga0068868_100021684 3300005338 Bacteria 4839
57 Ga0068868_100129452 3300005338 Bacteria 2064
58 Ga0068868_100145421 3300005338 Bacteria 1949
59 Ga0068868_100462339 3300005338 Unclassified 1105
60 Ga0070660_100000250 3300005339 Bacteria 35322
61 Ga0070660_100004767 3300005339 Bacteria 9381
62 Ga0070660_100009614 3300005339 Bacteria 6810
63 Ga0070660_100014132 3300005339 Bacteria 5747
64 Ga0070660_100048254 3300005339 Bacteria 3270
65 Ga0070660_100107793 3300005339 Bacteria 2213
66 Ga0070660_100129424 3300005339 Bacteria 2019
67 Ga0070660_100165279 3300005339 Bacteria 1785
68 Ga0070660_100320471 3300005339 Bacteria 1273
69 Ga0070660_100421368 3300005339 Unclassified 1105
70 Ga0070691_10060674 3300005341 Bacteria 1818
71 Ga0070691_10065579 3300005341 Bacteria 1753
72 Ga0070687_100026536 3300005343 Bacteria 2790
73 Ga0070661_100000157 3300005344 Bacteria 55418
74 Ga0070661_100035175 3300005344 Bacteria 3637
75 Ga0070661_100043442 3300005344 Bacteria 3283
76 Ga0070661_100044135 3300005344 Bacteria 3256
77 Ga0070661_100089042 3300005344 Bacteria 2285
78 Ga0070661_100095460 3300005344 Bacteria 2205
79 Ga0070668_100001195 3300005347 Bacteria 18419
80 Ga0070668_100053735 3300005347 Bacteria 3106
81 Ga0070668_100069658 3300005347 Bacteria 2737
82 Ga0070669_100027638 3300005353 Bacteria 4083
83 Ga0070669_100127799 3300005353 Bacteria 1946
84 Ga0070669_100692695 3300005353 Unclassified 860
85 Ga0070675_100028255 3300005354 Bacteria 4514
86 Ga0070675_100129005 3300005354 Bacteria 2153
87 Ga0070671_100001535 3300005355 Bacteria 17343
88 Ga0070671_100010877 3300005355 Bacteria 7305
89 Ga0070671_100021010 3300005355 Bacteria 5327
90 Ga0070671_100036503 3300005355 Bacteria 4076
91 Ga0070671_100116884 3300005355 Bacteria 2242
92 Ga0070671_100120845 3300005355 Bacteria 2204
93 Ga0070671_100265142 3300005355 Bacteria 1460
94 Ga0070674_100006398 3300005356 Bacteria 6870
95 Ga0070674_100319303 3300005356 Bacteria 1244
96 Ga0070674_100362068 3300005356 Bacteria 1175
97 Ga0070673_100000590 3300005364 Bacteria 19738
98 Ga0070673_100005097 3300005364 Bacteria 8385
99 Ga0070673_100011366 3300005364 Bacteria 6074
100 Ga0070673_100036446 3300005364 Bacteria 3739
101 Ga0070673_100044578 3300005364 Bacteria 3435
102 Ga0070673_100070216 3300005364 Bacteria 2810
103 Ga0070673_100133690 3300005364 Bacteria 2085
104 Ga0070673_100168498 3300005364 Bacteria 1868
105 Ga0070659_100000086 3300005366 Bacteria 70060
106 Ga0070659_100002532 3300005366 Bacteria 12993
107 Ga0070659_100012853 3300005366 Bacteria 6221
108 Ga0070659_100056568 3300005366 Bacteria 3092
109 Ga0070659_100058972 3300005366 Bacteria 3030
110 Ga0070659_100062366 3300005366 Bacteria 2947
111 Ga0070659_100107399 3300005366 Bacteria 2251
112 Ga0070667_100000512 3300005367 Bacteria 39082
113 Ga0070667_100088038 3300005367 Bacteria 2666
114 Ga0070667_100141114 3300005367 Bacteria 2110
115 Ga0070667_100166165 3300005367 Bacteria 1946
116 Ga0070667_100289895 3300005367 Bacteria 1471
117 Ga0070667_100395848 3300005367 Bacteria 1256
118 Ga0070667_100944376 3300005367 Unclassified 803
119 Ga0070709_10007175 3300005434 Bacteria 6103
120 Ga0070714_100007101 3300005435 Bacteria 8686
121 Ga0070663_100000888 3300005455 Bacteria 16248
122 Ga0070663_100053565 3300005455 Bacteria 2881
123 Ga0070663_100066127 3300005455 Bacteria 2619
124 Ga0070663_100177168 3300005455 Bacteria 1651
125 Ga0070663_100210675 3300005455 Bacteria 1521
126 Ga0070678_100004982 3300005456 Bacteria 7609
127 Ga0070678_100018930 3300005456 Bacteria 4474
128 Ga0070678_100066272 3300005456 Bacteria 2684
129 Ga0070678_100178871 3300005456 Bacteria 1734
130 Ga0070678_100315460 3300005456 Bacteria 1333
131 Ga0070662_100000082 3300005457 Bacteria 53245
132 Ga0070662_100003853 3300005457 Bacteria 9404
133 Ga0070662_100022283 3300005457 Bacteria 4335
134 Ga0070662_100033904 3300005457 Bacteria 3598
135 Ga0070662_100051880 3300005457 Bacteria 2963
136 Ga0070662_100092911 3300005457 Bacteria 2269
137 Ga0070662_100149782 3300005457 Bacteria 1815
138 Ga0070662_100179258 3300005457 Bacteria 1669
139 Ga0070662_100215530 3300005457 Unclassified 1529
140 Ga0070662_100219951 3300005457 Bacteria 1515
141 Ga0070662_100337555 3300005457 Unclassified 1232
142 Ga0070662_100367754 3300005457 Bacteria 1181
143 Ga0070681_10077720 3300005458 Bacteria 3276
144 Ga0068867_100006628 3300005459 Bacteria 8185
145 Ga0068867_100103721 3300005459 Bacteria 2175
146 Ga0070685_10032682 3300005466 Bacteria 2916
147 Ga0070685_10045471 3300005466 Bacteria 2518
148 Ga0070679_100057397 3300005530 Bacteria 3881
149 Ga0070679_100240715 3300005530 Bacteria 1767
150 Ga0070679_100359853 3300005530 Bacteria 1402
151 Ga0070684_100006570 3300005535 Bacteria 9007
152 Ga0070684_100019747 3300005535 Bacteria 5578
153 Ga0070684_100805410 3300005535 Unclassified 878
154 Ga0068853_100000151 3300005539 Bacteria 47652
155 Ga0068853_100003767 3300005539 Bacteria 11630
156 Ga0068853_100050429 3300005539 Bacteria 3580
157 Ga0068853_100155939 3300005539 Bacteria 2058
158 Ga0068853_100189291 3300005539 Bacteria 1869
159 Ga0068853_100313525 3300005539 Bacteria 1453
160 Ga0070672_100013483 3300005543 Bacteria 5775
161 Ga0070672_100015062 3300005543 Bacteria 5495
162 Ga0070672_100044310 3300005543 Bacteria 3435
163 Ga0070672_100053901 3300005543 Bacteria 3146
164 Ga0070672_100080461 3300005543 Bacteria 2610
165 Ga0070672_100108870 3300005543 Bacteria 2256
166 Ga0070672_100523823 3300005543 Bacteria 1027
167 Ga0070686_100014279 3300005544 Bacteria 4576
168 Ga0070696_100086079 3300005546 Bacteria 2231
169 Ga0070693_100000766 3300005547 Bacteria 14163
170 Ga0070693_100042051 3300005547 Bacteria 2574
171 Ga0070665_100002033 3300005548 Bacteria 22765
172 Ga0070665_100009343 3300005548 Bacteria 9925
173 Ga0070665_100023601 3300005548 Bacteria 6193
174 Ga0070665_100040004 3300005548 Bacteria 4714
175 Ga0070665_100056787 3300005548 Bacteria 3925
176 Ga0070665_100122448 3300005548 Bacteria 2603
177 Ga0068855_100000742 3300005563 Bacteria 40114
178 Ga0068855_100268274 3300005563 Bacteria 1899
179 Ga0068855_100271981 3300005563 Bacteria 1884
180 Ga0068855_100324883 3300005563 Bacteria 1700
181 Ga0068855_100445465 3300005563 Bacteria 1414
182 Ga0068855_100517727 3300005563 Bacteria 1294
183 Ga0070664_100000113 3300005564 Bacteria 53220
184 Ga0070664_100006119 3300005564 Bacteria 9735
185 Ga0070664_100048744 3300005564 Bacteria 3580
186 Ga0070664_100078023 3300005564 Bacteria 2849
187 Ga0070664_100108450 3300005564 Bacteria 2421
188 Ga0070664_100213929 3300005564 Bacteria 1723
189 Ga0068857_100005727 3300005577 Bacteria 10628
190 Ga0068857_100053263 3300005577 Bacteria 3590
191 Ga0068857_100067332 3300005577 Bacteria 3187
192 Ga0068857_100208250 3300005577 Bacteria 1784
193 Ga0068857_100339550 3300005577 Bacteria 1389
194 Ga0068857_100343609 3300005577 Bacteria 1381
195 Ga0068854_100005569 3300005578 Bacteria 7959
196 Ga0068854_100005929 3300005578 Bacteria 7741
197 Ga0068854_100009143 3300005578 Bacteria 6389
198 Ga0068854_100098067 3300005578 Bacteria 2192
199 Ga0068854_100150757 3300005578 Bacteria 1793
200 Ga0068854_100306502 3300005578 Bacteria 1287
201 Ga0068856_100000159 3300005614 Bacteria 70023
202 Ga0068856_100093698 3300005614 Bacteria 2989
203 Ga0068856_100123569 3300005614 Bacteria 2591
204 Ga0068856_100157326 3300005614 Bacteria 2283
205 Ga0068856_100239328 3300005614 Bacteria 1830
206 Ga0068856_100272414 3300005614 Bacteria 1709
207 Ga0068856_100318500 3300005614 Bacteria 1572
208 Ga0068856_100329879 3300005614 Unclassified 1543
209 Ga0068856_100472418 3300005614 Bacteria 1275
210 Ga0068852_100001102 3300005616 Bacteria 17834
211 Ga0068852_100034417 3300005616 Bacteria 4215
212 Ga0068852_100056141 3300005616 Bacteria 3402
213 Ga0068852_100071108 3300005616 Bacteria 3054
214 Ga0068852_100136490 3300005616 Bacteria 2265
215 Ga0068852_100153082 3300005616 Bacteria 2146
216 Ga0068852_100275220 3300005616 Bacteria 1621
217 Ga0068859_100041756 3300005617 Bacteria 4606
218 Ga0068859_100112389 3300005617 Bacteria 2787
219 Ga0068864_100120461 3300005618 Bacteria 2346
220 Ga0068866_10027509 3300005718 Bacteria 2698
221 Ga0068866_10058049 3300005718 Bacteria 1997
222 Ga0068861_100249123 3300005719 Bacteria 1515
223 Ga0068851_10020863 3300005834 Bacteria 3176
224 Ga0068851_10047480 3300005834 Bacteria 2175
225 Ga0068851_10085789 3300005834 Bacteria 1651
226 Ga0068851_10202292 3300005834 Bacteria 1109
227 Ga0068863_100031570 3300005841 Bacteria 5053
228 Ga0068863_100042229 3300005841 Bacteria 4333
229 Ga0068863_100119015 3300005841 Bacteria 2517
230 Ga0068863_100238223 3300005841 Unclassified 1756
231 Ga0068858_100000855 3300005842 Bacteria 31513
232 Ga0068858_100017514 3300005842 Bacteria 6719
233 Ga0068858_100070656 3300005842 Bacteria 3236
234 Ga0068858_100085810 3300005842 Bacteria 2929
235 Ga0068860_100009646 3300005843 Bacteria 9592
236 Ga0068860_100143125 3300005843 Bacteria 2299
237 Ga0068860_100342213 3300005843 Bacteria 1471
238 Ga0068860_100876542 3300005843 Bacteria 913
239 Ga0068862_100003384 3300005844 Bacteria 13757
240 Ga0068862_100020109 3300005844 Bacteria 5575
241 Ga0068862_100105816 3300005844 Bacteria 2466
242 Ga0081539_10065375 3300005985 Bacteria 1975
243 Ga0070717_10023236 3300006028 Bacteria 4910
244 Ga0070716_100010913 3300006173 Bacteria 4569
245 Ga0070712_100055872 3300006175 Bacteria 2767
246 Ga0070712_100405961 3300006175 Unclassified 1126
247 Ga0075366_10125710 3300006195 Bacteria 1547
248 Ga0097621_100011079 3300006237 Bacteria 6630
249 Ga0097621_100058333 3300006237 Bacteria 3158
250 Ga0097621_100061904 3300006237 Bacteria 3071
251 Ga0097621_100077710 3300006237 Bacteria 2756
252 Ga0097621_100582378 3300006237 Bacteria 1021
253 Ga0097621_100622732 3300006237 Unclassified 988
254 Ga0068871_100011341 3300006358 Bacteria 6533
255 Ga0068871_100026410 3300006358 Bacteria 4531
256 Ga0068871_100058243 3300006358 Bacteria 3145
257 Ga0068871_100382943 3300006358 Bacteria 1250
258 Ga0068865_100027709 3300006881 Bacteria 3745
259 Ga0068865_100036688 3300006881 Bacteria 3306
260 Ga0097620_100041757 3300006931 Bacteria 4606
261 Ga0097620_100112392 3300006931 Bacteria 2787
262 Ga0105240_10019039 3300009093 Bacteria 9182
263 Ga0105240_10111778 3300009093 Bacteria 3304
264 Ga0105240_11075729 3300009093 Bacteria 857
265 Ga0105245_10034533 3300009098 Bacteria 4486
266 Ga0105245_10070846 3300009098 Bacteria 3165
267 Ga0105245_10078992 3300009098 Bacteria 3003
268 Ga0105247_10450493 3300009101 Unclassified 928
269 Ga0105243_10163023 3300009148 Bacteria 1924
270 Ga0105243_10259250 3300009148 Bacteria 1556
271 Ga0105241_10186460 3300009174 Bacteria 1724
272 Ga0105241_10189542 3300009174 Bacteria 1711
273 Ga0105241_10193306 3300009174 Bacteria 1695
274 Ga0105241_10364226 3300009174 Bacteria 1259
275 Ga0105242_10019665 3300009176 Bacteria 5292
276 Ga0105242_10049839 3300009176 Bacteria 3408
277 Ga0105248_10000213 3300009177 Bacteria 66972
278 Ga0105248_10001030 3300009177 Bacteria 30868
279 Ga0105248_10009653 3300009177 Bacteria 10628
280 Ga0105248_10013727 3300009177 Bacteria 8918
281 Ga0105248_10039349 3300009177 Bacteria 5295
282 Ga0105248_10172082 3300009177 Bacteria 2441
283 Ga0105248_10276673 3300009177 Bacteria 1890
284 Ga0105248_10766167 3300009177 Unclassified 1089
285 Ga0105237_10017974 3300009545 Bacteria 7325
286 Ga0105237_10125056 3300009545 Bacteria 2566
287 Ga0105238_10013369 3300009551 Bacteria 8283
288 Ga0105238_10056134 3300009551 Bacteria 3951
289 Ga0105238_10076657 3300009551 Bacteria 3335
290 Ga0105238_10080373 3300009551 Bacteria 3249
291 Ga0105238_10135621 3300009551 Bacteria 2439
292 Ga0105239_10109101 3300010375 Bacteria 3066
293 Ga0105239_10389223 3300010375 Bacteria 1577
294 Ga0105246_10399755 3300011119 Bacteria 1141
295 Ga0157373_10014324 3300013100 Bacteria 5811
296 Ga0157373_10018514 3300013100 Bacteria 5069
297 Ga0157373_10039927 3300013100 Bacteria 3358
298 Ga0157373_10140358 3300013100 Bacteria 1699
299 Ga0157373_10172208 3300013100 Bacteria 1523
300 Ga0157373_10229589 3300013100 Bacteria 1310
301 Ga0157371_10001522 3300013102 Bacteria 23920
302 Ga0157371_10030466 3300013102 Bacteria 3892
303 Ga0157371_10089772 3300013102 Bacteria 2177
304 Ga0157371_10105818 3300013102 Bacteria 1996
305 Ga0157371_10120515 3300013102 Bacteria 1865
306 Ga0157371_10170580 3300013102 Bacteria 1555
307 Ga0157371_10302137 3300013102 Bacteria 1159
308 Ga0157371_10417015 3300013102 Bacteria 984
309 Ga0157370_10021347 3300013104 Bacteria 6452
310 Ga0157370_10244207 3300013104 Bacteria 1661
311 Ga0157369_10015017 3300013105 Bacteria 8739
312 Ga0157369_10042344 3300013105 Bacteria 4968
313 Ga0157369_10158019 3300013105 Bacteria 2394
314 Ga0157369_10184913 3300013105 Bacteria 2191
315 Ga0157369_10264743 3300013105 Bacteria 1792
316 Ga0157374_10006596 3300013296 Bacteria 9857
317 Ga0157374_10012096 3300013296 Bacteria 7494
318 Ga0157374_10263718 3300013296 Bacteria 1697
319 Ga0157374_10378744 3300013296 Bacteria 1409
320 Ga0157378_10068102 3300013297 Bacteria 3191
321 Ga0157378_10418136 3300013297 Bacteria 1324
322 Ga0163162_10004411 3300013306 Bacteria 13541
323 Ga0163162_10014056 3300013306 Bacteria 7825
324 Ga0163162_11192359 3300013306 Unclassified 864
325 Ga0157372_10005254 3300013307 Bacteria 13748
326 Ga0157372_10036532 3300013307 Bacteria 5414
327 Ga0157372_10231025 3300013307 Bacteria 2145
328 Ga0157372_10581644 3300013307 Bacteria 1305
329 Ga0157372_10719420 3300013307 Bacteria 1161
330 Ga0157372_10962498 3300013307 Unclassified 989
331 Ga0157375_10006437 3300013308 Bacteria 10232
332 Ga0157375_10826420 3300013308 Bacteria 1074
333 Ga0163163_10002019 3300014325 Bacteria 17136
334 Ga0163163_10015855 3300014325 Bacteria 6980
335 Ga0163163_10095039 3300014325 Bacteria 3000
336 Ga0163163_10122715 3300014325 Bacteria 2633
337 Ga0163163_11046690 3300014325 Bacteria 879
338 Ga0157377_10035468 3300014745 Bacteria 2736
339 Ga0157379_10032782 3300014968 Bacteria 4632
340 Ga0157379_10040050 3300014968 Bacteria 4181
341 Ga0157379_10155224 3300014968 Bacteria 2065
342 Ga0157376_10089227 3300014969 Bacteria 2665
343 Ga0213876_10228272 3300021384 Bacteria 989
344 Ga0207697_10005787 3300025315 Bacteria 5698
345 Ga0207697_10036054 3300025315 Bacteria 2025
346 Ga0207697_10132235 3300025315 Bacteria 1079
347 Ga0207656_10012615 3300025321 Bacteria 3217
348 Ga0207656_10058219 3300025321 Unclassified 1687
349 Ga0207656_10110300 3300025321 Bacteria 1271
350 Ga0207682_10034032 3300025893 Bacteria 2053
351 Ga0207688_10002710 3300025901 Bacteria 9598
352 Ga0207688_10028018 3300025901 Bacteria 3099
353 Ga0207680_10000274 3300025903 Bacteria 24714
354 Ga0207680_10005211 3300025903 Bacteria 6201
355 Ga0207680_10029461 3300025903 Bacteria 3084
356 Ga0207680_10067175 3300025903 Bacteria 2208
357 Ga0207680_10126564 3300025903 Bacteria 1678
358 Ga0207647_10007292 3300025904 Bacteria 8004
359 Ga0207647_10007373 3300025904 Bacteria 7951
360 Ga0207647_10008006 3300025904 Bacteria 7600
361 Ga0207647_10010332 3300025904 Bacteria 6593
362 Ga0207647_10017696 3300025904 Bacteria 4840
363 Ga0207647_10051013 3300025904 Bacteria 2559
364 Ga0207647_10077510 3300025904 Bacteria 1997
365 Ga0207647_10098754 3300025904 Bacteria 1734
366 Ga0207647_10150757 3300025904 Bacteria 1359
367 Ga0207645_10007001 3300025907 Bacteria 8027
368 Ga0207705_10000380 3300025909 Bacteria 39760
369 Ga0207705_10003585 3300025909 Bacteria 11829
370 Ga0207705_10023250 3300025909 Bacteria 4423
371 Ga0207705_10069908 3300025909 Bacteria 2543
372 Ga0207705_10070844 3300025909 Bacteria 2527
373 Ga0207654_10237033 3300025911 Bacteria 1217
374 Ga0207707_10103521 3300025912 Bacteria 2488
375 Ga0207695_10011469 3300025913 Bacteria 10731
376 Ga0207695_10016717 3300025913 Bacteria 8570
377 Ga0207671_10107677 3300025914 Bacteria 2117
378 Ga0207671_10259168 3300025914 Bacteria 1368
379 Ga0207693_10015589 3300025915 Bacteria 6096
380 Ga0207662_10015526 3300025918 Bacteria 4285
381 Ga0207662_10090246 3300025918 Bacteria 1884
382 Ga0207662_10162798 3300025918 Bacteria 1426
383 Ga0207657_10000276 3300025919 Bacteria 54727
384 Ga0207657_10005632 3300025919 Bacteria 13068
385 Ga0207657_10014095 3300025919 Bacteria 7822
386 Ga0207657_10017663 3300025919 Bacteria 6836
387 Ga0207657_10028676 3300025919 Bacteria 5073
388 Ga0207657_10033509 3300025919 Bacteria 4629
389 Ga0207657_10050218 3300025919 Bacteria 3630
390 Ga0207657_10059857 3300025919 Bacteria 3270
391 Ga0207657_10091118 3300025919 Bacteria 2543
392 Ga0207657_10123388 3300025919 Bacteria 2129
393 Ga0207657_10187367 3300025919 Bacteria 1671
394 Ga0207657_10201316 3300025919 Bacteria 1601
395 Ga0207657_10504507 3300025919 Unclassified 948
396 Ga0207649_10000277 3300025920 Bacteria 40521
397 Ga0207649_10014563 3300025920 Bacteria 4404
398 Ga0207649_10027196 3300025920 Bacteria 3354
399 Ga0207649_10065881 3300025920 Bacteria 2295
400 Ga0207649_10112019 3300025920 Bacteria 1825
401 Ga0207649_10246612 3300025920 Bacteria 1284
402 Ga0207652_10086581 3300025921 Bacteria 2747
403 Ga0207652_10346617 3300025921 Bacteria 1341
404 Ga0207694_10000665 3300025924 Bacteria 30841
405 Ga0207694_10096317 3300025924 Bacteria 2340
406 Ga0207694_10157736 3300025924 Bacteria 1831
407 Ga0207650_10011090 3300025925 Bacteria 6198
408 Ga0207650_10019327 3300025925 Bacteria 4784
409 Ga0207650_10033142 3300025925 Bacteria 3739
410 Ga0207650_10201154 3300025925 Bacteria 1596
411 Ga0207659_10257990 3300025926 Bacteria 1417
412 Ga0207659_10339992 3300025926 Bacteria 1243
413 Ga0207659_10391041 3300025926 Bacteria 1161
414 Ga0207687_10020065 3300025927 Bacteria 4432
415 Ga0207687_10149333 3300025927 Bacteria 1781
416 Ga0207687_10194200 3300025927 Unclassified 1582
417 Ga0207700_10389168 3300025928 Unclassified 1220
418 Ga0207664_10021421 3300025929 Bacteria 4806
419 Ga0207664_10047749 3300025929 Bacteria 3364
420 Ga0207664_10053428 3300025929 Bacteria 3198
421 Ga0207664_10099520 3300025929 Bacteria 2400
422 Ga0207644_10000142 3300025931 Bacteria 51611
423 Ga0207644_10013808 3300025931 Bacteria 5395
424 Ga0207644_10023454 3300025931 Bacteria 4226
425 Ga0207644_10026732 3300025931 Bacteria 3980
426 Ga0207690_10000100 3300025932 Bacteria 71510
427 Ga0207690_10009452 3300025932 Bacteria 5790
428 Ga0207690_10017744 3300025932 Bacteria 4352
429 Ga0207690_10134987 3300025932 Unclassified 1811
430 Ga0207690_10231435 3300025932 Bacteria 1419
431 Ga0207706_10000599 3300025933 Bacteria 38339
432 Ga0207706_10001371 3300025933 Bacteria 24356
433 Ga0207706_10004203 3300025933 Bacteria 13558
434 Ga0207706_10012743 3300025933 Bacteria 7652
435 Ga0207706_10038002 3300025933 Bacteria 4271
436 Ga0207706_10075601 3300025933 Bacteria 2962
437 Ga0207706_10078043 3300025933 Bacteria 2912
438 Ga0207706_10082248 3300025933 Bacteria 2830
439 Ga0207706_10182417 3300025933 Bacteria 1843
440 Ga0207706_10190563 3300025933 Bacteria 1800
441 Ga0207706_10298802 3300025933 Bacteria 1403
442 Ga0207706_10407432 3300025933 Bacteria 1179
443 Ga0207686_10063790 3300025934 Bacteria 2344
444 Ga0207709_10377449 3300025935 Unclassified 1078
445 Ga0207669_10011517 3300025937 Bacteria 4308
446 Ga0207669_10047511 3300025937 Bacteria 2543
447 Ga0207669_10056304 3300025937 Bacteria 2387
448 Ga0207669_10419974 3300025937 Unclassified 1052
449 Ga0207704_10082537 3300025938 Bacteria 2083
450 Ga0207704_10254139 3300025938 Bacteria 1321
451 Ga0207665_10006852 3300025939 Bacteria 7543
452 Ga0207691_10002694 3300025940 Bacteria 17373
453 Ga0207691_10003665 3300025940 Bacteria 14903
454 Ga0207691_10042105 3300025940 Bacteria 4211
455 Ga0207691_10051123 3300025940 Bacteria 3780
456 Ga0207691_10053018 3300025940 Bacteria 3704
457 Ga0207691_10287270 3300025940 Unclassified 1415
458 Ga0207691_10458880 3300025940 Unclassified 1084
459 Ga0207711_10000107 3300025941 Bacteria 87146
460 Ga0207711_10001316 3300025941 Bacteria 23500
461 Ga0207711_10011684 3300025941 Bacteria 7296
462 Ga0207711_10056318 3300025941 Bacteria 3378
463 Ga0207711_10072637 3300025941 Bacteria 2989
464 Ga0207689_10054650 3300025942 Bacteria 3288
465 Ga0207689_10083303 3300025942 Bacteria 2630
466 Ga0207661_10001636 3300025944 Bacteria 15261
467 Ga0207661_10034320 3300025944 Bacteria 3944
468 Ga0207661_10282666 3300025944 Bacteria 1483
469 Ga0207679_10000377 3300025945 Bacteria 32363
470 Ga0207679_10004055 3300025945 Bacteria 9101
471 Ga0207679_10013571 3300025945 Bacteria 5339
472 Ga0207679_10032103 3300025945 Bacteria 3683
473 Ga0207679_10074088 3300025945 Bacteria 2578
474 Ga0207679_10088538 3300025945 Bacteria 2387
475 Ga0207679_10163105 3300025945 Bacteria 1827
476 Ga0207679_10169663 3300025945 Bacteria 1795
477 Ga0207667_10006801 3300025949 Bacteria 13812
478 Ga0207667_10019206 3300025949 Bacteria 7642
479 Ga0207667_10043178 3300025949 Bacteria 4785
480 Ga0207667_10265062 3300025949 Bacteria 1757
481 Ga0207667_10275706 3300025949 Bacteria 1719
482 Ga0207667_10567357 3300025949 Bacteria 1147
483 Ga0207651_10008551 3300025960 Bacteria 5535
484 Ga0207651_10033208 3300025960 Bacteria 3325
485 Ga0207651_10041769 3300025960 Bacteria 3046
486 Ga0207651_10044732 3300025960 Bacteria 2965
487 Ga0207651_10155949 3300025960 Bacteria 1784
488 Ga0207651_10590733 3300025960 Unclassified 970
489 Ga0207651_10725108 3300025960 Unclassified 877
490 Ga0207668_10000513 3300025972 Bacteria 24253
491 Ga0207640_10002583 3300025981 Bacteria 9697
492 Ga0207640_10025647 3300025981 Bacteria 3570
493 Ga0207640_10044624 3300025981 Bacteria 2842
494 Ga0207640_10052241 3300025981 Bacteria 2661
495 Ga0207640_10234455 3300025981 Bacteria 1414
496 Ga0207658_10005458 3300025986 Bacteria 8723
497 Ga0207658_10034154 3300025986 Bacteria 3633
498 Ga0207658_10036356 3300025986 Bacteria 3530
499 Ga0207658_10041895 3300025986 Bacteria 3318
500 Ga0207658_10483205 3300025986 Bacteria 1101
501 Ga0207677_10001335 3300026023 Bacteria 13238
502 Ga0207677_10088628 3300026023 Bacteria 2244
503 Ga0207677_10217410 3300026023 Bacteria 1530
504 Ga0207677_10283148 3300026023 Bacteria 1362
505 Ga0207677_10612514 3300026023 Bacteria 957
506 Ga0207703_10005718 3300026035 Bacteria 9966
507 Ga0207703_10007831 3300026035 Bacteria 8450
508 Ga0207703_10013348 3300026035 Bacteria 6401
509 Ga0207703_10013450 3300026035 Bacteria 6374
510 Ga0207703_10094125 3300026035 Bacteria 2525
511 Ga0207703_10803354 3300026035 Bacteria 898
512 Ga0207639_10000162 3300026041 Bacteria 51395
513 Ga0207639_10000907 3300026041 Bacteria 20041
514 Ga0207639_10013256 3300026041 Bacteria 5764
515 Ga0207639_10140727 3300026041 Bacteria 2010
516 Ga0207639_10158764 3300026041 Bacteria 1903
517 Ga0207678_10010794 3300026067 Bacteria 8025
518 Ga0207678_10013681 3300026067 Bacteria 7126
519 Ga0207678_10024745 3300026067 Bacteria 5242
520 Ga0207678_10033375 3300026067 Bacteria 4485
521 Ga0207678_10044927 3300026067 Bacteria 3820
522 Ga0207678_10076964 3300026067 Bacteria 2857
523 Ga0207678_10106020 3300026067 Bacteria 2398
524 Ga0207678_10122453 3300026067 Bacteria 2219
525 Ga0207702_10000208 3300026078 Bacteria 69979
526 Ga0207702_10046136 3300026078 Bacteria 3667
527 Ga0207702_10084552 3300026078 Bacteria 2763
528 Ga0207702_10282518 3300026078 Bacteria 1570
529 Ga0207702_10649235 3300026078 Bacteria 1038
530 Ga0207641_10011287 3300026088 Bacteria 7330
531 Ga0207641_10021522 3300026088 Bacteria 5299
532 Ga0207641_10048172 3300026088 Bacteria 3596
533 Ga0207641_10063340 3300026088 Bacteria 3159
534 Ga0207641_10488113 3300026088 Bacteria 1195
535 Ga0207648_10005049 3300026089 Bacteria 13384
536 Ga0207648_10022199 3300026089 Bacteria 5702
537 Ga0207648_10084861 3300026089 Bacteria 2762
538 Ga0207648_10808681 3300026089 Bacteria 873
539 Ga0207676_10006581 3300026095 Bacteria 8215
540 Ga0207674_10001496 3300026116 Bacteria 30156
541 Ga0207674_10004813 3300026116 Bacteria 16172
542 Ga0207674_10004816 3300026116 Bacteria 16168
543 Ga0207674_10022910 3300026116 Bacteria 6700
544 Ga0207674_10040553 3300026116 Bacteria 4822
545 Ga0207674_10164120 3300026116 Bacteria 2175
546 Ga0207674_10469126 3300026116 Bacteria 1217
547 Ga0207675_100035951 3300026118 Bacteria 4620
548 Ga0207683_10000682 3300026121 Bacteria 31182
549 Ga0207683_10001585 3300026121 Bacteria 20512
550 Ga0207683_10024790 3300026121 Bacteria 5168
551 Ga0207683_10099444 3300026121 Bacteria 2596
552 Ga0207683_10122971 3300026121 Bacteria 2331
553 Ga0207698_10001295 3300026142 Bacteria 14580
554 Ga0207698_10047642 3300026142 Bacteria 3249
555 Ga0207698_10052361 3300026142 Bacteria 3127
556 Ga0207698_10217701 3300026142 Bacteria 1723
557 Ga0207698_10640693 3300026142 Unclassified 1052
558 Ga0268266_10006052 3300028379 Bacteria 11151
559 Ga0268266_10006699 3300028379 Bacteria 10509
560 Ga0268266_10011484 3300028379 Bacteria 7693
561 Ga0268266_10134355 3300028379 Bacteria 2215
562 Ga0268266_10153083 3300028379 Bacteria 2080
563 Ga0268265_10412386 3300028380 Bacteria 1252
564 Ga0268264_10004048 3300028381 Bacteria 12549
565 Ga0268264_10344563 3300028381 Bacteria 1416
566 Ga0373948_0015592 3300034817 Bacteria 1397
567 Ga0373953_0056171 3300035117 Bacteria 1600
568 Ga0373955_0005892 3300035172 Bacteria 5541
569 Ga0373931_0005654 3300035691 Bacteria 5803
570 Ga0373931_0099008 3300035691 Bacteria 1637
571 Ga0373935_0027334 3300035692 Bacteria 3526
572 Ga0373933_0048504 3300035724 Bacteria 2529
573 Ga0373937_0148733 3300036401 Bacteria 2193
574 Ga0395899_0003890 3300037312 Bacteria 11772
575 Ga0395899_0017518 3300037312 Bacteria 5457
576 Ga0395899_0083720 3300037312 Bacteria 2319
577 Ga0395899_0373138 3300037312 Bacteria 949
578 Ga0395900_0065287 3300037418 Bacteria 3739
579 Ga0395900_0139123 3300037418 Bacteria 2487
580 Ga0395900_0176406 3300037418 Bacteria 2173
581 Ga0395900_0234143 3300037418 Bacteria 1845
582 Ga0395900_0280404 3300037418 Bacteria 1658
583 Ga0395900_0363590 3300037418 Bacteria 1418
584 Ga0395900_0560294 3300037418 Bacteria 1086
585 Ga0395898_0019715 3300037466 Bacteria 6859
586 Ga0395898_0027891 3300037466 Bacteria 5662
587 Ga0395898_0146064 3300037466 Bacteria 2263
588 Ga0395898_0501385 3300037466 Bacteria 1154
589 Ga0395905_0002968 3300037471 Bacteria 18443
590 Ga0395905_0007295 3300037471 Bacteria 11021
591 Ga0395905_0013830 3300037471 Bacteria 7720
592 Ga0395905_0019683 3300037471 Bacteria 6396
593 Ga0395905_0024690 3300037471 Bacteria 5672
594 Ga0395905_0035706 3300037471 Bacteria 4668
595 Ga0395905_0067819 3300037471 Bacteria 3341
596 Ga0395905_0072298 3300037471 Bacteria 3233
597 Ga0395905_0095262 3300037471 Bacteria 2794
598 Ga0395905_0177966 3300037471 Bacteria 1996
599 Ga0395905_0195125 3300037471 Unclassified 1898
600 Ga0395905_0320284 3300037471 Bacteria 1440
601 Ga0395905_0326661 3300037471 Bacteria 1424
602 Ga0395905_0512674 3300037471 Bacteria 1100
603 Ga0395901_0027747 3300038443 Bacteria 5821
604 Ga0395901_0029201 3300038443 Bacteria 5675
605 Ga0395901_0054873 3300038443 Bacteria 4142
606 Ga0395901_0103732 3300038443 Bacteria 2983
607 Ga0395901_0104685 3300038443 Bacteria 2970
608 Ga0395901_0191524 3300038443 Bacteria 2144
609 Ga0395901_0301162 3300038443 Bacteria 1662
610 Ga0395901_0497404 3300038443 Bacteria 1241
611 Ga0436365_0333798 3300039437 Bacteria 1356
612 Ga0466965_0156256 3300044683 Bacteria 1194
613 Ga0466966_0020220 3300044684 Bacteria 4382
614 Ga0466966_0107578 3300044684 Bacteria 1720
615 Ga0466961_0025073 3300044693 Bacteria 3837
616 Ga0466961_0036025 3300044693 Bacteria 3176
617 Ga0466964_0023379 3300044706 Bacteria 2403
618 Ga0466964_0029615 3300044706 Bacteria 2163
619 Ga0466964_0263177 3300044706 Bacteria 855
620 Ga0466971_0004831 3300044719 Bacteria 5831
621 Ga0466968_0009478 3300044735 Bacteria 3746
622 Ga0466968_0183874 3300044735 Bacteria 973
623 Ga0466970_0005231 3300044765 Bacteria 6422
624 Ga0466970_0117578 3300044765 Bacteria 1454
625 Ga0466957_0067194 3300044842 Bacteria 2211
626 Ga0466960_0012779 3300044901 Bacteria 3552
627 Ga0466959_0067934 3300045049 Bacteria 2583
628 Ga0466959_0235376 3300045049 Bacteria 1266
629 Ga0466958_0010665 3300045836 Bacteria 5153
630 Ga0466958_0052505 3300045836 Bacteria 2471
631 Ga0466958_0093118 3300045836 Bacteria 1866
632 Ga0466967_0023810 3300045976 Bacteria 5024
633 Ga0466967_0161347 3300045976 Bacteria 2104
634 Ga0466967_0163536 3300045976 Bacteria 2090
635 Ga0466967_0700486 3300045976 Bacteria 1003
636 Ga0466967_0709195 3300045976 Bacteria 997
637 Ga0495620_0055569 3300046515 Bacteria 1668
638 Ga0495663_0014315 3300046525 Bacteria 2223
639 Ga0495598_0006545 3300046537 Bacteria 2635
640 Ga0495621_0000489 3300046539 Bacteria 9755
641 Ga0495633_0107607 3300046558 Bacteria 1293
642 Ga0495668_0144818 3300046616 Bacteria 1300
643 Ga0495623_0084400 3300046679 Unclassified 1960
644 Ga0495669_0001287 3300046684 Bacteria 10394
645 Ga0495669_0009188 3300046684 Bacteria 4165
646 Ga0495669_0052827 3300046684 Bacteria 1826
647 Ga0495669_0131735 3300046684 Bacteria 1177
648 Ga0495677_0059575 3300047445 Bacteria 1414
649 Ga0496100_0005046 3300048903 Bacteria 7063
650 Ga0496100_0268608 3300048903 Bacteria 1267
651 Ga0496101_0002701 3300048904 Bacteria 10885
652 Ga0496101_0039587 3300048904 Bacteria 3354
653 Ga0496103_0085291 3300048906 Bacteria 1990
654 Ga0496104_0104587 3300048907 Bacteria 2713
655 Ga0496105_0289546 3300048908 Bacteria 1319
656 Ga0496107_0006202 3300048910 Bacteria 8216
657 Ga0496108_0000417 3300048911 Bacteria 34833
658 Ga0496108_0075739 3300048911 Bacteria 2843
659 Ga0496109_0032632 3300048912 Bacteria 4681
660 Ga0496109_0495642 3300048912 Bacteria 1153
661 Ga0496110_0011747 3300048913 Bacteria 7185
662 Ga0496110_0023040 3300048913 Bacteria 5295
663 Ga0496110_0278238 3300048913 Unclassified 1524
664 Ga0496111_0002192 3300048914 Bacteria 11703
665 Ga0496111_0004388 3300048914 Bacteria 8907
666 Ga0496111_0053859 3300048914 Bacteria 2907
667 Ga0496111_0103029 3300048914 Bacteria 2098
668 Ga0496112_0009765 3300048915 Bacteria 8665
669 Ga0496112_0147078 3300048915 Bacteria 2324
670 Ga0496112_0206463 3300048915 Bacteria 1922
671 Ga0496113_0002012 3300048916 Bacteria 11664
672 Ga0496113_0009281 3300048916 Bacteria 6452
673 Ga0496113_0477861 3300048916 Unclassified 1001
674 Ga0496114_0004976 3300048917 Bacteria 10367
675 Ga0501069_0188402 3300049585 Bacteria 1193
676 Ga0501080_0053257 3300049742 Bacteria 3767
677 nmdc:mga0k408_120741_c1 3300050493 Bacteria 1552
678 Ga0587083_0044407 3300059505 Bacteria 944
679 Ga0587128_023666 3300059630 Bacteria 965
680 Ga0587069_013072 3300059642 Bacteria 1135
681 Ga0466962_0014995 3300061719 Bacteria 3735
682 Ga0070689_100136797
683 JGI24736J21556_1015881
684 JGI24746J21847_1006890
685 JGI24747J21853_1002930
686 JGI24740J21852_10011918
687 JGI24740J21852_10014138
688 JGI24740J21852_10042575
689 JGI24739J22299_10008246
690 JGI24739J22299_10035704
691 JGI24737J22298_10008325
692 JGI24737J22298_10009266
693 JGI24737J22298_10012831
694 JGI24737J22298_10024804
695 JGI24743J22301_10001834
696 JGI24743J22301_10028064
697 JGI24735J21928_10008482
698 JGI24735J21928_10014232
699 JGI24735J21928_10034402
700 JGI24735J21928_10036289
701 JGI24745J21846_1003588
702 JGI24738J21930_10001156
703 JGI24738J21930_10008652
704 JGI24744J21845_10000454
705 JGI24742J22300_10005209
706 Ga0065715_10166494
707 Ga0070658_10000216
708 Ga0070658_10048309
709 Ga0070658_10104911
710 Ga0070658_10127469
711 Ga0070658_10443912
712 Ga0070676_10005722
713 Ga0070676_10227634
714 Ga0070683_100000646
715 Ga0070683_100071219
716 Ga0070683_100203483
717 Ga0070690_100019764
718 Ga0070670_100005290
719 Ga0070670_100023777
720 Ga0070670_100036197
721 Ga0070670_100123406
722 Ga0070670_100124599
723 Ga0070670_100172407
724 Ga0070670_100658166
725 Ga0070677_10008989
726 Ga0068869_100372042
727 Ga0070666_10000693
728 Ga0070666_10074591
729 Ga0070680_100033691
730 Ga0070680_100304925
731 Ga0070682_100020922
732 Ga0070682_100035562
733 Ga0070682_100072886
734 Ga0070682_100203015
735 Ga0070682_100251069
736 Ga0068868_100001337
737 Ga0068868_100021684
738 Ga0068868_100129452
739 Ga0068868_100145421
740 Ga0068868_100462339
741 Ga0070660_100000250
742 Ga0070660_100004767
743 Ga0070660_100009614
744 Ga0070660_100014132
745 Ga0070660_100048254
746 Ga0070660_100107793
747 Ga0070660_100129424
748 Ga0070660_100165279
749 Ga0070660_100320471
750 Ga0070660_100421368
751 Ga0070691_10060674
752 Ga0070691_10065579
753 Ga0070687_100026536
754 Ga0070661_100000157
755 Ga0070661_100035175
756 Ga0070661_100043442
757 Ga0070661_100044135
758 Ga0070661_100089042
759 Ga0070661_100095460
760 Ga0070668_100001195
761 Ga0070668_100053735
762 Ga0070668_100069658
763 Ga0070669_100027638
764 Ga0070669_100127799
765 Ga0070669_100692695
766 Ga0070675_100028255
767 Ga0070675_100129005
768 Ga0070671_100001535
769 Ga0070671_100010877
770 Ga0070671_100021010
771 Ga0070671_100036503
772 Ga0070671_100116884
773 Ga0070671_100120845
774 Ga0070671_100265142
775 Ga0070674_100006398
776 Ga0070674_100319303
777 Ga0070674_100362068
778 Ga0070673_100000590
779 Ga0070673_100005097
780 Ga0070673_100011366
781 Ga0070673_100036446
782 Ga0070673_100044578
783 Ga0070673_100070216
784 Ga0070673_100133690
785 Ga0070673_100168498
786 Ga0070659_100000086
787 Ga0070659_100002532
788 Ga0070659_100012853
789 Ga0070659_100056568
790 Ga0070659_100058972
791 Ga0070659_100062366
792 Ga0070659_100107399
793 Ga0070667_100000512
794 Ga0070667_100088038
795 Ga0070667_100141114
796 Ga0070667_100166165
797 Ga0070667_100289895
798 Ga0070667_100395848
799 Ga0070667_100944376
800 Ga0070709_10007175
801 Ga0070714_100007101
802 Ga0070663_100000888
803 Ga0070663_100053565
804 Ga0070663_100066127
805 Ga0070663_100177168
806 Ga0070663_100210675
807 Ga0070678_100004982
808 Ga0070678_100018930
809 Ga0070678_100066272
810 Ga0070678_100178871
811 Ga0070678_100315460
812 Ga0070662_100000082
813 Ga0070662_100003853
814 Ga0070662_100022283
815 Ga0070662_100033904
816 Ga0070662_100051880
817 Ga0070662_100092911
818 Ga0070662_100149782
819 Ga0070662_100179258
820 Ga0070662_100215530
821 Ga0070662_100219951
822 Ga0070662_100337555
823 Ga0070662_100367754
824 Ga0070681_10077720
825 Ga0068867_100006628
826 Ga0068867_100103721
827 Ga0070685_10032682
828 Ga0070685_10045471
829 Ga0070679_100057397
830 Ga0070679_100240715
831 Ga0070679_100359853
832 Ga0070684_100006570
833 Ga0070684_100019747
834 Ga0070684_100805410
835 Ga0068853_100000151
836 Ga0068853_100003767
837 Ga0068853_100050429
838 Ga0068853_100155939
839 Ga0068853_100189291
840 Ga0068853_100313525
841 Ga0070672_100013483
842 Ga0070672_100015062
843 Ga0070672_100044310
844 Ga0070672_100053901
845 Ga0070672_100080461
846 Ga0070672_100108870
847 Ga0070672_100523823
848 Ga0070686_100014279
849 Ga0070696_100086079
850 Ga0070693_100000766
851 Ga0070693_100042051
852 Ga0070665_100002033
853 Ga0070665_100009343
854 Ga0070665_100023601
855 Ga0070665_100040004
856 Ga0070665_100056787
857 Ga0070665_100122448
858 Ga0068855_100000742
859 Ga0068855_100268274
860 Ga0068855_100271981
861 Ga0068855_100324883
862 Ga0068855_100445465
863 Ga0068855_100517727
864 Ga0070664_100000113
865 Ga0070664_100006119
866 Ga0070664_100048744
867 Ga0070664_100078023
868 Ga0070664_100108450
869 Ga0070664_100213929
870 Ga0068857_100005727
871 Ga0068857_100053263
872 Ga0068857_100067332
873 Ga0068857_100208250
874 Ga0068857_100339550
875 Ga0068857_100343609
876 Ga0068854_100005569
877 Ga0068854_100005929
878 Ga0068854_100009143
879 Ga0068854_100098067
880 Ga0068854_100150757
881 Ga0068854_100306502
882 Ga0068856_100000159
883 Ga0068856_100093698
884 Ga0068856_100123569
885 Ga0068856_100157326
886 Ga0068856_100239328
887 Ga0068856_100272414
888 Ga0068856_100318500
889 Ga0068856_100329879
890 Ga0068856_100472418
891 Ga0068852_100001102
892 Ga0068852_100034417
893 Ga0068852_100056141
894 Ga0068852_100071108
895 Ga0068852_100136490
896 Ga0068852_100153082
897 Ga0068852_100275220
898 Ga0068859_100041756
899 Ga0068859_100112389
900 Ga0068864_100120461
901 Ga0068866_10027509
902 Ga0068866_10058049
903 Ga0068861_100249123
904 Ga0068851_10020863
905 Ga0068851_10047480
906 Ga0068851_10085789
907 Ga0068851_10202292
908 Ga0068863_100031570
909 Ga0068863_100042229
910 Ga0068863_100119015
911 Ga0068863_100238223
912 Ga0068858_100000855
913 Ga0068858_100017514
914 Ga0068858_100070656
915 Ga0068858_100085810
916 Ga0068860_100009646
917 Ga0068860_100143125
918 Ga0068860_100342213
919 Ga0068860_100876542
920 Ga0068862_100003384
921 Ga0068862_100020109
922 Ga0068862_100105816
923 Ga0081539_10065375
924 Ga0070717_10023236
925 Ga0070716_100010913
926 Ga0070712_100055872
927 Ga0070712_100405961
928 Ga0075366_10125710
929 Ga0097621_100011079
930 Ga0097621_100058333
931 Ga0097621_100061904
932 Ga0097621_100077710
933 Ga0097621_100582378
934 Ga0097621_100622732
935 Ga0068871_100011341
936 Ga0068871_100026410
937 Ga0068871_100058243
938 Ga0068871_100382943
939 Ga0068865_100027709
940 Ga0068865_100036688
941 Ga0097620_100041757
942 Ga0097620_100112392
943 Ga0105240_10019039
944 Ga0105240_10111778
945 Ga0105240_11075729
946 Ga0105245_10034533
947 Ga0105245_10070846
948 Ga0105245_10078992
949 Ga0105247_10450493
950 Ga0105243_10163023
951 Ga0105243_10259250
952 Ga0105241_10186460
953 Ga0105241_10189542
954 Ga0105241_10193306
955 Ga0105241_10364226
956 Ga0105242_10019665
957 Ga0105242_10049839
958 Ga0105248_10000213
959 Ga0105248_10001030
960 Ga0105248_10009653
961 Ga0105248_10013727
962 Ga0105248_10039349
963 Ga0105248_10172082
964 Ga0105248_10276673
965 Ga0105248_10766167
966 Ga0105237_10017974
967 Ga0105237_10125056
968 Ga0105238_10013369
969 Ga0105238_10056134
970 Ga0105238_10076657
971 Ga0105238_10080373
972 Ga0105238_10135621
973 Ga0105239_10109101
974 Ga0105239_10389223
975 Ga0105246_10399755
976 Ga0157373_10014324
977 Ga0157373_10018514
978 Ga0157373_10039927
979 Ga0157373_10140358
980 Ga0157373_10172208
981 Ga0157373_10229589
982 Ga0157371_10001522
983 Ga0157371_10030466
984 Ga0157371_10089772
985 Ga0157371_10105818
986 Ga0157371_10120515
987 Ga0157371_10170580
988 Ga0157371_10302137
989 Ga0157371_10417015
990 Ga0157370_10021347
991 Ga0157370_10244207
992 Ga0157369_10015017
993 Ga0157369_10042344
994 Ga0157369_10158019
995 Ga0157369_10184913
996 Ga0157369_10264743
997 Ga0157374_10006596
998 Ga0157374_10012096
999 Ga0157374_10263718
1000 Ga0157374_10378744
1001 Ga0157378_10068102
1002 Ga0157378_10418136
1003 Ga0163162_10004411
1004 Ga0163162_10014056
1005 Ga0163162_11192359
1006 Ga0157372_10005254
1007 Ga0157372_10036532
1008 Ga0157372_10231025
1009 Ga0157372_10581644
1010 Ga0157372_10719420
1011 Ga0157372_10962498
1012 Ga0157375_10006437
1013 Ga0157375_10826420
1014 Ga0163163_10002019
1015 Ga0163163_10015855
1016 Ga0163163_10095039
1017 Ga0163163_10122715
1018 Ga0163163_11046690
1019 Ga0157377_10035468
1020 Ga0157379_10032782
1021 Ga0157379_10040050
1022 Ga0157379_10155224
1023 Ga0157376_10089227
1024 Ga0213876_10228272
1025 Ga0207697_10005787
1026 Ga0207697_10036054
1027 Ga0207697_10132235
1028 Ga0207656_10012615
1029 Ga0207656_10058219
1030 Ga0207656_10110300
1031 Ga0207682_10034032
1032 Ga0207688_10002710
1033 Ga0207688_10028018
1034 Ga0207680_10000274
1035 Ga0207680_10005211
1036 Ga0207680_10029461
1037 Ga0207680_10067175
1038 Ga0207680_10126564
1039 Ga0207647_10007292
1040 Ga0207647_10007373
1041 Ga0207647_10008006
1042 Ga0207647_10010332
1043 Ga0207647_10017696
1044 Ga0207647_10051013
1045 Ga0207647_10077510
1046 Ga0207647_10098754
1047 Ga0207647_10150757
1048 Ga0207645_10007001
1049 Ga0207705_10000380
1050 Ga0207705_10003585
1051 Ga0207705_10023250
1052 Ga0207705_10069908
1053 Ga0207705_10070844
1054 Ga0207654_10237033
1055 Ga0207707_10103521
1056 Ga0207695_10011469
1057 Ga0207695_10016717
1058 Ga0207671_10107677
1059 Ga0207671_10259168
1060 Ga0207693_10015589
1061 Ga0207662_10015526
1062 Ga0207662_10090246
1063 Ga0207662_10162798
1064 Ga0207657_10000276
1065 Ga0207657_10005632
1066 Ga0207657_10014095
1067 Ga0207657_10017663
1068 Ga0207657_10028676
1069 Ga0207657_10033509
1070 Ga0207657_10050218
1071 Ga0207657_10059857
1072 Ga0207657_10091118
1073 Ga0207657_10123388
1074 Ga0207657_10187367
1075 Ga0207657_10201316
1076 Ga0207657_10504507
1077 Ga0207649_10000277
1078 Ga0207649_10014563
1079 Ga0207649_10027196
1080 Ga0207649_10065881
1081 Ga0207649_10112019
1082 Ga0207649_10246612
1083 Ga0207652_10086581
1084 Ga0207652_10346617
1085 Ga0207694_10000665
1086 Ga0207694_10096317
1087 Ga0207694_10157736
1088 Ga0207650_10011090
1089 Ga0207650_10019327
1090 Ga0207650_10033142
1091 Ga0207650_10201154
1092 Ga0207659_10257990
1093 Ga0207659_10339992
1094 Ga0207659_10391041
1095 Ga0207687_10020065
1096 Ga0207687_10149333
1097 Ga0207687_10194200
1098 Ga0207700_10389168
1099 Ga0207664_10021421
1100 Ga0207664_10047749
1101 Ga0207664_10053428
1102 Ga0207664_10099520
1103 Ga0207644_10000142
1104 Ga0207644_10013808
1105 Ga0207644_10023454
1106 Ga0207644_10026732
1107 Ga0207690_10000100
1108 Ga0207690_10009452
1109 Ga0207690_10017744
1110 Ga0207690_10134987
1111 Ga0207690_10231435
1112 Ga0207706_10000599
1113 Ga0207706_10001371
1114 Ga0207706_10004203
1115 Ga0207706_10012743
1116 Ga0207706_10038002
1117 Ga0207706_10075601
1118 Ga0207706_10078043
1119 Ga0207706_10082248
1120 Ga0207706_10182417
1121 Ga0207706_10190563
1122 Ga0207706_10298802
1123 Ga0207706_10407432
1124 Ga0207686_10063790
1125 Ga0207709_10377449
1126 Ga0207669_10011517
1127 Ga0207669_10047511
1128 Ga0207669_10056304
1129 Ga0207669_10419974
1130 Ga0207704_10082537
1131 Ga0207704_10254139
1132 Ga0207665_10006852
1133 Ga0207691_10002694
1134 Ga0207691_10003665
1135 Ga0207691_10042105
1136 Ga0207691_10051123
1137 Ga0207691_10053018
1138 Ga0207691_10287270
1139 Ga0207691_10458880
1140 Ga0207711_10000107
1141 Ga0207711_10001316
1142 Ga0207711_10011684
1143 Ga0207711_10056318
1144 Ga0207711_10072637
1145 Ga0207689_10054650
1146 Ga0207689_10083303
1147 Ga0207661_10001636
1148 Ga0207661_10034320
1149 Ga0207661_10282666
1150 Ga0207679_10000377
1151 Ga0207679_10004055
1152 Ga0207679_10013571
1153 Ga0207679_10032103
1154 Ga0207679_10074088
1155 Ga0207679_10088538
1156 Ga0207679_10163105
1157 Ga0207679_10169663
1158 Ga0207667_10006801
1159 Ga0207667_10019206
1160 Ga0207667_10043178
1161 Ga0207667_10265062
1162 Ga0207667_10275706
1163 Ga0207667_10567357
1164 Ga0207651_10008551
1165 Ga0207651_10033208
1166 Ga0207651_10041769
1167 Ga0207651_10044732
1168 Ga0207651_10155949
1169 Ga0207651_10590733
1170 Ga0207651_10725108
1171 Ga0207668_10000513
1172 Ga0207640_10002583
1173 Ga0207640_10025647
1174 Ga0207640_10044624
1175 Ga0207640_10052241
1176 Ga0207640_10234455
1177 Ga0207658_10005458
1178 Ga0207658_10034154
1179 Ga0207658_10036356
1180 Ga0207658_10041895
1181 Ga0207658_10483205
1182 Ga0207677_10001335
1183 Ga0207677_10088628
1184 Ga0207677_10217410
1185 Ga0207677_10283148
1186 Ga0207677_10612514
1187 Ga0207703_10005718
1188 Ga0207703_10007831
1189 Ga0207703_10013348
1190 Ga0207703_10013450
1191 Ga0207703_10094125
1192 Ga0207703_10803354
1193 Ga0207639_10000162
1194 Ga0207639_10000907
1195 Ga0207639_10013256
1196 Ga0207639_10140727
1197 Ga0207639_10158764
1198 Ga0207678_10010794
1199 Ga0207678_10013681
1200 Ga0207678_10024745
1201 Ga0207678_10033375
1202 Ga0207678_10044927
1203 Ga0207678_10076964
1204 Ga0207678_10106020
1205 Ga0207678_10122453
1206 Ga0207702_10000208
1207 Ga0207702_10046136
1208 Ga0207702_10084552
1209 Ga0207702_10282518
1210 Ga0207702_10649235
1211 Ga0207641_10011287
1212 Ga0207641_10021522
1213 Ga0207641_10048172
1214 Ga0207641_10063340
1215 Ga0207641_10488113
1216 Ga0207648_10005049
1217 Ga0207648_10022199
1218 Ga0207648_10084861
1219 Ga0207648_10808681
1220 Ga0207676_10006581
1221 Ga0207674_10001496
1222 Ga0207674_10004813
1223 Ga0207674_10004816
1224 Ga0207674_10022910
1225 Ga0207674_10040553
1226 Ga0207674_10164120
1227 Ga0207674_10469126
1228 Ga0207675_100035951
1229 Ga0207683_10000682
1230 Ga0207683_10001585
1231 Ga0207683_10024790
1232 Ga0207683_10099444
1233 Ga0207683_10122971
1234 Ga0207698_10001295
1235 Ga0207698_10047642
1236 Ga0207698_10052361
1237 Ga0207698_10217701
1238 Ga0207698_10640693
1239 Ga0268266_10006052
1240 Ga0268266_10006699
1241 Ga0268266_10011484
1242 Ga0268266_10134355
1243 Ga0268266_10153083
1244 Ga0268265_10412386
1245 Ga0268264_10004048
1246 Ga0268264_10344563
1247 Ga0373948_0015592
1248 Ga0373953_0056171
1249 Ga0373955_0005892
1250 Ga0373931_0005654
1251 Ga0373931_0099008
1252 Ga0373935_0027334
1253 Ga0373933_0048504
1254 Ga0373937_0148733
1255 Ga0395899_0003890
1256 Ga0395899_0017518
1257 Ga0395899_0083720
1258 Ga0395899_0373138
1259 Ga0395900_0065287
1260 Ga0395900_0139123
1261 Ga0395900_0176406
1262 Ga0395900_0234143
1263 Ga0395900_0280404
1264 Ga0395900_0363590
1265 Ga0395900_0560294
1266 Ga0395898_0019715
1267 Ga0395898_0027891
1268 Ga0395898_0146064
1269 Ga0395898_0501385
1270 Ga0395905_0002968
1271 Ga0395905_0007295
1272 Ga0395905_0013830
1273 Ga0395905_0019683
1274 Ga0395905_0024690
1275 Ga0395905_0035706
1276 Ga0395905_0067819
1277 Ga0395905_0072298
1278 Ga0395905_0095262
1279 Ga0395905_0177966
1280 Ga0395905_0195125
1281 Ga0395905_0320284
1282 Ga0395905_0326661
1283 Ga0395905_0512674
1284 Ga0395901_0027747
1285 Ga0395901_0029201
1286 Ga0395901_0054873
1287 Ga0395901_0103732
1288 Ga0395901_0104685
1289 Ga0395901_0191524
1290 Ga0395901_0301162
1291 Ga0395901_0497404
1292 Ga0436365_0333798
1293 Ga0466965_0156256
1294 Ga0466966_0020220
1295 Ga0466966_0107578
1296 Ga0466961_0025073
1297 Ga0466961_0036025
1298 Ga0466964_0023379
1299 Ga0466964_0029615
1300 Ga0466964_0263177
1301 Ga0466971_0004831
1302 Ga0466968_0009478
1303 Ga0466968_0183874
1304 Ga0466970_0005231
1305 Ga0466970_0117578
1306 Ga0466957_0067194
1307 Ga0466960_0012779
1308 Ga0466959_0067934
1309 Ga0466959_0235376
1310 Ga0466958_0010665
1311 Ga0466958_0052505
1312 Ga0466958_0093118
1313 Ga0466967_0023810
1314 Ga0466967_0161347
1315 Ga0466967_0163536
1316 Ga0466967_0700486
1317 Ga0466967_0709195
1318 Ga0495620_0055569
1319 Ga0495663_0014315
1320 Ga0495598_0006545
1321 Ga0495621_0000489
1322 Ga0495633_0107607
1323 Ga0495668_0144818
1324 Ga0495623_0084400
1325 Ga0495669_0001287
1326 Ga0495669_0009188
1327 Ga0495669_0052827
1328 Ga0495669_0131735
1329 Ga0495677_0059575
1330 Ga0496100_0005046
1331 Ga0496100_0268608
1332 Ga0496101_0002701
1333 Ga0496101_0039587
1334 Ga0496103_0085291
1335 Ga0496104_0104587
1336 Ga0496105_0289546
1337 Ga0496107_0006202
1338 Ga0496108_0000417
1339 Ga0496108_0075739
1340 Ga0496109_0032632
1341 Ga0496109_0495642
1342 Ga0496110_0011747
1343 Ga0496110_0023040
1344 Ga0496110_0278238
1345 Ga0496111_0002192
1346 Ga0496111_0004388
1347 Ga0496111_0053859
1348 Ga0496111_0103029
1349 Ga0496112_0009765
1350 Ga0496112_0147078
1351 Ga0496112_0206463
1352 Ga0496113_0002012
1353 Ga0496113_0009281
1354 Ga0496113_0477861
1355 Ga0496114_0004976
1356 Ga0501069_0188402
1357 Ga0501080_0053257
1358 nmdc:mga0k408_120741_c1
1359 Ga0587083_0044407
1360 Ga0587128_023666
1361 Ga0587069_013072
1362 Ga0466962_0014995

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13462

Thioredoxin_4

Thioredoxin

32

194

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gmf-assembly1.cif.gz_A crystal structure of protein-disulfide isomerase from novosphingobium aromaticivorans 0.9506 57 251
3gmf-assembly1.cif.gz_A crystal structure of protein-disulfide isomerase from novosphingobium aromaticivorans 0.932 57 251
3f4t-assembly1.cif.gz_A crystal structure of wolbachia pipientis alpha-dsba1 c97a/c146a 0.8046 60 250
3f4r-assembly1.cif.gz_A crystal structure of wolbachia pipientis alpha-dsba1 0.8001 60 250
3eu4-assembly1.cif.gz_A crystal structure of bdbd from bacillus subtilis (oxidised) 0.7982 60 251
ID Description Score Start End Superfamily
3gmfA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9521 57 251 3.40.30.10
3gmfA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9128 57 251 3.40.30.10
3gmfA02 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1; 0.9053 114 216 1.10.40.110
3gmfA02 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1; 0.8973 114 216 1.10.40.110
af_Q9SA00_68_167_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.821 66 108 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A520I3Q4-F1-model_v4 Protein-disulfide isomerase 0.955 46 248 GO:0016853
AF-A0A841L812-F1-model_v4 Protein-disulfide isomerase 0.9537 46 249 GO:0016853
AF-A0A4Q3C1D4-F1-model_v4 Protein-disulfide isomerase 0.9512 72 249 GO:0016853
AF-A0A845AWE0-F1-model_v4 Thioredoxin domain-containing protein 0.9482 46 247
AF-A0A6G7ZFF7-F1-model_v4 Thioredoxin domain-containing protein 0.9423 38 248

Map