F474817

General Info

Members Datasets Scaffolds Average Seq Length
680 503 404 313

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8057132660|8057134304
Length 312
Sequence TRRMLMAAVATMPLMAGSAWAEGLITVIVNDPANPYWFTEGEVAKATAEELGYTANVAAHRGDTNTESTLIDTAITNQSVAIILDPANADGSVGAVQKAVDAGIPVFLVNAEINQEGLAKAQLVSNNAQGAALGAQAWVEAMGTEGGQYVELFGAPSDNNAQTRSNGYETVLSQYPEFEKVGQEVANWDRTEGYQSMQSLMQANPDITGVISGNDEMALGAIAALKEAGKLDGVVVGGFDGSPDAVEAIKAGEMAYTVLQPVAIFSEEAVRQADNFIKTGETGADAEKQLFDALLITPENVDQYSAPFVLDQ

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
9 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
10 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
11 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
12 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
13 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
14 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
15 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
16 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
17 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
18 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
19 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
20 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
21 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
22 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
23 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
24 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
25 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
26 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
27 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
28 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
29 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
30 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
31 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
32 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
33 2534681786 Brucella suis 92/29 Isolate Unclassified
34 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
35 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
36 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
37 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
38 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
39 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
40 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
41 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
42 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
43 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
44 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
45 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
46 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
47 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
48 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
49 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
50 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
51 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
52 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
53 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
54 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
55 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
56 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
57 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
58 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
59 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
60 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
61 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
62 2643221599 Rhizobium sp. Root708 Isolate Unclassified
63 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
64 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
65 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
66 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
67 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
68 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
69 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
70 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
71 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
72 2738541293 Rhizobium sp. GV031 Isolate Unclassified
73 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
74 2751185800 Brucella pituitosa AA2 Isolate Unclassified
75 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
76 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
77 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
78 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
79 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
80 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
81 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
82 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
83 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
84 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
85 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
86 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
87 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
88 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
89 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
90 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
91 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
92 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
93 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
94 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
95 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
96 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
97 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
98 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
99 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
100 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
101 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
102 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
103 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
104 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
105 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
106 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
107 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
108 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
109 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
110 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
111 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
112 2854911287 Brucella lupini LUP21 Isolate Unclassified
113 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
114 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
115 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
116 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
117 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
118 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
119 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
120 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
121 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
122 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
123 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
124 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
125 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
126 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
127 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
128 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
129 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
130 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
131 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
132 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
133 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
134 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
135 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
136 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
137 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
138 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
139 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
140 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
141 2876601092 Pantoea endophytica 596 Isolate Unclassified
142 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
143 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
144 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
145 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
146 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
147 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
148 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
149 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
150 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
151 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
152 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
153 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
154 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
155 2904504865 Serratia marcescens 1822 Isolate Unclassified
156 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
157 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
158 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
159 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
160 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
161 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
162 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
163 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
164 2909042592 Labrys sp. LIt4 Isolate Nodule
165 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
166 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
167 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
168 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
169 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
170 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
171 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
172 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
173 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
174 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
175 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
176 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
177 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
178 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
179 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
180 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
181 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
182 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
183 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
184 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
185 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
186 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
187 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
188 2952252522 Salinicola sp. DM10 Isolate Unclassified
189 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
190 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
191 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
192 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
193 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
194 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
195 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
196 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
197 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
198 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
199 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
200 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
201 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
202 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
203 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
204 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
205 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
206 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
207 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
208 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
209 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
210 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
211 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
212 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
213 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
214 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
215 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
216 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
217 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
218 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
219 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
220 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
221 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
222 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
223 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
224 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
225 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
226 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
227 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
228 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
229 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
230 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
231 3004167301 Mesorhizobium loti 582 Isolate Unclassified
232 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
233 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
234 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
235 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
236 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
237 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
238 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
239 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
240 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
241 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
242 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
243 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
244 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
245 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
246 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
247 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
248 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
249 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
250 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
251 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
252 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
253 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
254 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
255 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
256 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
257 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
258 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
259 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
260 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
261 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
262 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
263 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
264 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
265 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
266 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
267 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
268 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
269 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
270 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
271 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
272 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
273 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
274 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
275 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
276 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
277 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
278 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
279 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
280 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
281 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
282 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
283 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
284 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
285 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
286 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
287 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
288 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
289 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
290 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
291 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
292 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
293 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
294 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
295 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
296 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
297 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
298 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
299 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
300 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
301 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
302 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
303 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
304 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
305 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
306 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
307 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
308 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
309 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
310 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
311 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
312 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
313 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
314 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
315 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
316 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
317 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
318 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
319 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
320 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
321 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
322 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
323 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
324 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
325 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
326 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
327 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
328 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
329 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
349 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
352 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
353 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
354 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
355 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
356 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
357 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
358 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
359 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
360 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
361 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
362 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
363 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
364 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
365 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
366 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
367 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
368 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
369 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
370 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
371 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
372 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
373 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
374 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
375 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
376 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
377 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
378 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
379 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
380 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
381 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
382 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
383 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
384 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
385 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
386 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
387 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
388 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
389 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
390 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
391 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
392 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
393 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
394 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
395 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
396 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
397 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
398 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
399 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
400 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
401 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
402 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
403 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
404 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
405 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
406 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
407 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
408 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
409 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
410 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
411 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
412 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
413 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
414 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
415 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
416 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
417 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
418 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
419 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
420 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
421 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
422 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
423 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
424 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
425 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
439 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
440 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
441 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
442 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
443 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
444 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
445 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
446 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
447 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
448 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
451 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
452 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
453 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
454 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
455 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
456 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
457 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
458 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
459 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
460 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
461 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
462 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
463 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
464 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
465 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
466 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
467 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
468 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
469 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
470 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
471 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
472 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
473 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
474 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
475 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
476 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
477 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
478 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
479 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
480 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
481 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
482 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
483 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
484 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
485 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
486 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
487 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
488 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
489 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
490 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
491 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
492 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
493 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
494 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
495 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
496 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
497 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
498 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
499 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
500 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
501 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
502 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
503 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 59.12
Metatranscriptomes 0.29
Isolates 40.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.24
Nodule 26.32
Rhizoplane 1.47
Rhizosphere 37.06
Stem 0
Stem Tuber 0
Unclassified 16.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000155 3300000549 Bacteria 12120
2 JGI24740J21852_10000014 3300001979 Bacteria 61371
3 JGI25155J39150_1000068 3300002704 Bacteria 65706
4 JGI25156J39149_1000093 3300002705 Bacteria 65706
5 JGI25156J39149_1009111 3300002705 Bacteria 2439
6 JGI25162J39368_1000184 3300002737 Bacteria 67069
7 JGI25162J39368_1000275 3300002737 Bacteria 49524
8 JGI25154J39366_1000116 3300002738 Bacteria 65706
9 JGI25158J39367_1000107 3300002739 Bacteria 19509
10 JGI25157J39369_1000125 3300002741 Bacteria 65706
11 JGI25157J39369_1004707 3300002741 Bacteria 2393
12 JGI25152J39213_1000199 3300002773 Bacteria 40048
13 JGI25152J39213_1001105 3300002773 Bacteria 12607
14 JGI25152J39213_1002514 3300002773 Bacteria 6920
15 JGI25150J39212_1000022 3300002774 Bacteria 131963
16 JGI25150J39212_1014169 3300002774 Bacteria 1362
17 JGI25159J45721_1000169 3300002987 Bacteria 30408
18 JGI25159J45721_1000543 3300002987 Bacteria 17164
19 JGI25151J46595_10000023 3300003187 Bacteria 221548
20 JGI25151J46595_10001667 3300003187 Bacteria 14569
21 JGI25151J46595_10003807 3300003187 Bacteria 8180
22 JGI25165J46597_1000163 3300003214 Bacteria 104693
23 JGI25165J46597_1000624 3300003214 Bacteria 29664
24 JGI25165J46597_1004033 3300003214 Bacteria 3329
25 JGI25153J46596_10000087 3300003215 Bacteria 111217
26 JGI25153J46596_10001049 3300003215 Bacteria 16847
27 JGI25153J46596_10004413 3300003215 Bacteria 7593
28 JGI25153J46596_10032974 3300003215 Bacteria 1718
29 rootH2_10006291 3300003320 Bacteria 7366
30 JGI25160J50197_1000018 3300003354 Bacteria 239933
31 JGI25160J50197_1001094 3300003354 Bacteria 13841
32 JGI25161J50226_1000020 3300003374 Bacteria 164844
33 JGI25161J50226_1000119 3300003374 Bacteria 58009
34 Ga0006562J51391_1004840 3300003578 Bacteria 9133
35 Ga0006562J51391_1012646 3300003578 Bacteria 2215
36 Ga0055542_1001656 3300003762 Bacteria 9984
37 Ga0055529_1005248 3300003763 Bacteria 1891
38 Ga0055526_1002906 3300003771 Bacteria 11269
39 Ga0055524_1013514 3300003775 Bacteria 3074
40 Ga0055528_1000098 3300003790 Bacteria 69408
41 Ga0055528_1001538 3300003790 Bacteria 13918
42 Ga0055540_1002685 3300003792 Bacteria 9167
43 Ga0055540_1009980 3300003792 Bacteria 3206
44 Ga0055531_10010506 3300003794 Bacteria 4589
45 Ga0058692_1000710 3300003856 Bacteria 13625
46 Ga0055543_1000004 3300004625 Bacteria 239971
47 Ga0055543_1000581 3300004625 Bacteria 20173
48 Ga0065165_1000429 3300005262 Bacteria 66016
49 Ga0065165_1020120 3300005262 Bacteria 2361
50 Ga0070658_10114583 3300005327 Bacteria 2236
51 Ga0070660_100352792 3300005339 Bacteria 1212
52 Ga0070674_100321404 3300005356 Bacteria 1241
53 Ga0070673_100481907 3300005364 Bacteria 1120
54 Ga0070696_100145153 3300005546 Bacteria 1737
55 Ga0070665_100056042 3300005548 Bacteria 3952
56 Ga0070704_100372265 3300005549 Bacteria 1211
57 Ga0068856_100028071 3300005614 Bacteria 5493
58 Ga0068856_100052698 3300005614 Bacteria 4013
59 Ga0068852_100355955 3300005616 Bacteria 1431
60 Ga0068862_100006734 3300005844 Bacteria 9528
61 Ga0075365_10001834 3300006038 Bacteria 9953
62 Ga0075365_10076694 3300006038 Bacteria 2257
63 Ga0075365_10190485 3300006038 Bacteria 1435
64 Ga0075368_10042999 3300006042 Bacteria 1779
65 Ga0075364_10039739 3300006051 Bacteria 3050
66 Ga0075364_10041608 3300006051 Bacteria 2984
67 Ga0075364_10042342 3300006051 Bacteria 2958
68 Ga0075367_10021668 3300006178 Bacteria 3595
69 Ga0075367_10136547 3300006178 Bacteria 1517
70 Ga0075367_10157540 3300006178 Bacteria 1411
71 Ga0075367_10221371 3300006178 Bacteria 1184
72 Ga0075369_10040781 3300006186 Bacteria 1985
73 Ga0075369_10049672 3300006186 Bacteria 1812
74 Ga0075369_10060140 3300006186 Bacteria 1656
75 Ga0075366_10270971 3300006195 Bacteria 1037
76 Ga0075370_10000487 3300006353 Bacteria 14976
77 Ga0075370_10035775 3300006353 Bacteria 2788
78 Ga0075370_10071644 3300006353 Bacteria 1983
79 Ga0075370_10196359 3300006353 Bacteria 1190
80 Ga0105244_10000695 3300009036 Bacteria 29185
81 Ga0105244_10001298 3300009036 Bacteria 20462
82 Ga0105244_10017656 3300009036 Bacteria 4027
83 Ga0105244_10079238 3300009036 Bacteria 1628
84 Ga0105250_10000003 3300009092 Bacteria 547770
85 Ga0105250_10008267 3300009092 Bacteria 4429
86 Ga0105240_10000976 3300009093 Bacteria 50953
87 Ga0105243_10474763 3300009148 Bacteria 1179
88 Ga0105243_10521357 3300009148 Bacteria 1130
89 Ga0105242_10036780 3300009176 Bacteria 3929
90 Ga0105237_10014322 3300009545 Bacteria 8301
91 Ga0105237_10232524 3300009545 Bacteria 1844
92 Ga0105237_10318639 3300009545 Bacteria 1558
93 Ga0105237_10367785 3300009545 Bacteria 1443
94 Ga0105238_10064862 3300009551 Bacteria 3652
95 Ga0105249_10082277 3300009553 Bacteria 2996
96 Ga0105239_10045549 3300010375 Bacteria 4808
97 Ga0105239_10056394 3300010375 Bacteria 4309
98 Ga0105239_10154885 3300010375 Bacteria 2559
99 Ga0105239_10362971 3300010375 Bacteria 1636
100 Ga0105239_10491146 3300010375 Bacteria 1395
101 Ga0157373_10000219 3300013100 Bacteria 46927
102 Ga0157373_10006096 3300013100 Bacteria 9014
103 Ga0157373_10195199 3300013100 Bacteria 1427
104 Ga0157371_10000823 3300013102 Bacteria 35549
105 Ga0157371_10336922 3300013102 Bacteria 1097
106 Ga0157370_10027522 3300013104 Bacteria 5606
107 Ga0157370_10317823 3300013104 Bacteria 1436
108 Ga0157370_10413956 3300013104 Bacteria 1240
109 Ga0157369_10026933 3300013105 Bacteria 6376
110 Ga0157369_10143724 3300013105 Bacteria 2523
111 Ga0157369_10270404 3300013105 Bacteria 1771
112 Ga0157374_10311257 3300013296 Bacteria 1559
113 Ga0157374_10332745 3300013296 Bacteria 1507
114 Ga0157378_10086331 3300013297 Bacteria 2845
115 Ga0157378_10283328 3300013297 Bacteria 1598
116 Ga0163162_10033092 3300013306 Bacteria 5135
117 Ga0163162_10385477 3300013306 Bacteria 1535
118 Ga0157372_10043514 3300013307 Bacteria 4972
119 Ga0157375_10141086 3300013308 Bacteria 2537
120 Ga0182008_10138280 3300014497 Bacteria 1217
121 Ga0157376_10248496 3300014969 Bacteria 1660
122 Ga0182007_10004230 3300015262 Bacteria 6559
123 Ga0182005_1010635 3300015265 Bacteria 2642
124 Ga0209435_100068 3300025206 Bacteria 65762
125 Ga0209436_100017 3300025208 Bacteria 116238
126 Ga0209437_100095 3300025233 Bacteria 236997
127 Ga0209437_100239 3300025233 Bacteria 89942
128 Ga0209437_104328 3300025233 Bacteria 2514
129 Ga0207425_1000038 3300025245 Bacteria 221600
130 Ga0207425_1001193 3300025245 Bacteria 11528
131 Ga0209646_1000210 3300025246 Bacteria 65762
132 Ga0209646_1005841 3300025246 Bacteria 2114
133 Ga0209026_1000023 3300025250 Bacteria 357521
134 Ga0209026_1000259 3300025250 Bacteria 65762
135 Ga0209677_100224 3300025253 Bacteria 40459
136 Ga0209148_1000128 3300025254 Bacteria 179154
137 Ga0209759_1000311 3300025256 Bacteria 65762
138 Ga0209759_1001335 3300025256 Bacteria 14461
139 Ga0209129_1000036 3300025258 Bacteria 328331
140 Ga0209129_1000120 3300025258 Bacteria 137898
141 Ga0209129_1001817 3300025258 Bacteria 11320
142 Ga0209129_1002328 3300025258 Bacteria 9408
143 Ga0209129_1002942 3300025258 Bacteria 7781
144 Ga0209129_1006029 3300025258 Bacteria 4065
145 Ga0209233_1000097 3300025261 Bacteria 295452
146 Ga0209233_1000117 3300025261 Bacteria 236984
147 Ga0209233_1000245 3300025261 Bacteria 89961
148 Ga0209455_1000174 3300025272 Bacteria 109384
149 Ga0209673_1000132 3300025273 Bacteria 162349
150 Ga0209673_1003180 3300025273 Bacteria 9995
151 Ga0209673_1007394 3300025273 Bacteria 5075
152 Ga0209673_1026860 3300025273 Bacteria 1882
153 Ga0209130_1000001 3300025284 Bacteria 831557
154 Ga0209130_1000035 3300025284 Bacteria 296161
155 Ga0209025_1000086 3300025294 Bacteria 262586
156 Ga0209025_1000108 3300025294 Bacteria 221600
157 Ga0209025_1010659 3300025294 Bacteria 6190
158 Ga0209564_1003137 3300025295 Bacteria 11654
159 Ga0209564_1017637 3300025295 Bacteria 2768
160 Ga0209564_1018632 3300025295 Bacteria 2636
161 Ga0209758_1000104 3300025297 Bacteria 221600
162 Ga0209758_1000110 3300025297 Bacteria 213110
163 Ga0209758_1000504 3300025297 Bacteria 63308
164 Ga0209758_1003598 3300025297 Bacteria 13864
165 Ga0209758_1003601 3300025297 Bacteria 13860
166 Ga0209758_1009156 3300025297 Bacteria 6231
167 Ga0209758_1010491 3300025297 Bacteria 5533
168 Ga0209256_1002227 3300025299 Bacteria 16553
169 Ga0209256_1002579 3300025299 Bacteria 14454
170 Ga0207426_1000005 3300025302 Bacteria 1037188
171 Ga0207426_1000017 3300025302 Bacteria 577913
172 Ga0209051_1001654 3300025303 Bacteria 17996
173 Ga0209051_1007618 3300025303 Bacteria 5892
174 Ga0209051_1022839 3300025303 Bacteria 2620
175 Ga0209051_1039509 3300025303 Bacteria 1703
176 Ga0209257_1000376 3300025304 Bacteria 89065
177 Ga0209257_1022059 3300025304 Bacteria 2285
178 Ga0207697_10067022 3300025315 Bacteria 1500
179 Ga0207696_1000004 3300025711 Bacteria 671626
180 Ga0207696_1000042 3300025711 Bacteria 307256
181 Ga0207655_1000069 3300025728 Bacteria 239968
182 Ga0207655_1009964 3300025728 Bacteria 5830
183 Ga0207655_1036050 3300025728 Bacteria 2199
184 Ga0207688_10165159 3300025901 Bacteria 1314
185 Ga0207647_10051642 3300025904 Bacteria 2540
186 Ga0207647_10125090 3300025904 Bacteria 1513
187 Ga0207645_10035117 3300025907 Bacteria 3219
188 Ga0207705_10026135 3300025909 Bacteria 4165
189 Ga0207705_10030752 3300025909 Bacteria 3832
190 Ga0207654_10057999 3300025911 Bacteria 2252
191 Ga0207695_10000948 3300025913 Bacteria 51627
192 Ga0207671_10000749 3300025914 Bacteria 41199
193 Ga0207671_10176386 3300025914 Bacteria 1661
194 Ga0207657_10191206 3300025919 Bacteria 1651
195 Ga0207650_10001166 3300025925 Bacteria 19321
196 Ga0207706_10158657 3300025933 Bacteria 1989
197 Ga0207709_10005309 3300025935 Bacteria 7330
198 Ga0207704_10366902 3300025938 Bacteria 1126
199 Ga0207668_10412111 3300025972 Bacteria 1145
200 Ga0207702_10007239 3300026078 Bacteria 9493
201 Ga0207648_10145368 3300026089 Bacteria 2091
202 Ga0207674_10186703 3300026116 Bacteria 2023
203 Ga0209371_1001461 3300027312 Bacteria 15946
204 Ga0209371_1005590 3300027312 Bacteria 4945
205 Ga0268266_10128985 3300028379 Bacteria 2260
206 Ga0268266_10174480 3300028379 Bacteria 1953
207 Ga0268265_10018412 3300028380 Bacteria 4839
208 Ga0307515_10001382 3300028794 Bacteria 54946
209 Ga0268256_1001246 3300030500 Bacteria 15946
210 Ga0268256_1005503 3300030500 Bacteria 4945
211 Ga0265330_10038188 3300031235 Bacteria 2135
212 Ga0265325_10011321 3300031241 Bacteria 5126
213 Ga0307513_10271364 3300031456 Bacteria 1479
214 Ga0307513_10411082 3300031456 Bacteria 1085
215 Ga0307405_10251351 3300031731 Bacteria 1315
216 Ga0307410_10092696 3300031852 Bacteria 2148
217 Ga0307412_10072750 3300031911 Bacteria 2350
218 Ga0307409_100088838 3300031995 Bacteria 2524
219 Ga0307510_10173761 3300033180 Bacteria 1729
220 Ga0395900_0282597 3300037418 Bacteria 1651
221 Ga0395905_0003418 3300037471 Bacteria 16981
222 Ga0395905_0364801 3300037471 Bacteria 1337
223 Ga0436364_0932243 3300037853 Bacteria 4846
224 Ga0436365_0533423 3300039437 Bacteria 5285
225 Ga0436365_1270426 3300039437 Bacteria 6245
226 Ga0451833_0147555 3300041491 Bacteria 1435
227 Ga0466965_0011546 3300044683 Bacteria 4143
228 Ga0466970_0053530 3300044765 Bacteria 2155
229 Ga0466960_0099216 3300044901 Bacteria 1497
230 Ga0466967_0010746 3300045976 Bacteria 6883
231 Ga0466967_0180099 3300045976 Bacteria 1993
232 Ga0495592_0033250 3300046454 Bacteria 3890
233 Ga0495591_000007 3300046458 Bacteria 366385
234 Ga0495629_0048188 3300046459 Bacteria 2987
235 Ga0495638_0000255 3300046460 Bacteria 71823
236 Ga0495638_0013615 3300046460 Bacteria 5526
237 Ga0495638_0019057 3300046460 Bacteria 4543
238 Ga0495651_0045985 3300046462 Bacteria 3380
239 Ga0495605_0090742 3300046474 Bacteria 1416
240 Ga0495662_0063546 3300046476 Bacteria 1783
241 Ga0495585_0005063 3300046492 Bacteria 8398
242 Ga0495585_0073226 3300046492 Bacteria 1865
243 Ga0495607_0054412 3300046501 Bacteria 2306
244 Ga0495583_0019629 3300046506 Bacteria 3523
245 Ga0495583_0041380 3300046506 Bacteria 2158
246 Ga0495606_0011198 3300046507 Bacteria 7341
247 Ga0495610_0000138 3300046512 Bacteria 81842
248 Ga0495618_0050514 3300046514 Bacteria 2627
249 Ga0495632_0176354 3300046519 Bacteria 980
250 Ga0495643_0009855 3300046522 Bacteria 5909
251 Ga0495643_0080947 3300046522 Bacteria 1689
252 Ga0495643_0135953 3300046522 Bacteria 1230
253 Ga0495643_0137993 3300046522 Bacteria 1218
254 Ga0495644_0035642 3300046523 Bacteria 1879
255 Ga0495648_0009192 3300046524 Bacteria 7697
256 Ga0495654_0000007 3300046530 Bacteria 403529
257 Ga0495587_0016718 3300046536 Bacteria 4563
258 Ga0495597_0095127 3300046542 Bacteria 1261
259 Ga0495633_0040072 3300046558 Bacteria 2233
260 Ga0495668_0030743 3300046616 Bacteria 3030
261 Ga0495625_0015345 3300046660 Bacteria 6070
262 Ga0495625_0037596 3300046660 Bacteria 3550
263 Ga0495625_0121417 3300046660 Bacteria 1777
264 Ga0495635_0028276 3300046663 Bacteria 3897
265 Ga0495588_0020295 3300046674 Bacteria 3264
266 Ga0495657_0003107 3300046675 Bacteria 13702
267 Ga0495670_0095956 3300046691 Bacteria 1522
268 Ga0495671_0029547 3300046692 Bacteria 2814
269 Ga0495589_0056607 3300046794 Bacteria 1930
270 Ga0495600_0006506 3300046809 Bacteria 7110
271 Ga0495660_0048436 3300046810 Bacteria 2324
272 Ga0495604_0005585 3300047317 Bacteria 9974
273 Ga0495672_0011579 3300047320 Bacteria 6216
274 Ga0495683_0000899 3300047323 Bacteria 20988
275 Ga0495681_0095730 3300047470 Bacteria 1305
276 Ga0495686_0000090 3300047472 Bacteria 193179
277 Ga0495686_0004949 3300047472 Bacteria 10720
278 Ga0495686_0008679 3300047472 Bacteria 7421
279 Ga0495626_0036263 3300048091 Bacteria 2350
280 Ga0496101_0000083 3300048904 Bacteria 104105
281 Ga0496102_0146839 3300048905 Bacteria 2214
282 Ga0496106_0000324 3300048909 Bacteria 33740
283 Ga0496110_0407367 3300048913 Bacteria 1240
284 Ga0496111_0000747 3300048914 Bacteria 17329
285 Ga0496112_0173946 3300048915 Bacteria 2118
286 Ga0496116_0001317 3300048919 Bacteria 28320
287 Ga0496116_0001490 3300048919 Bacteria 26108
288 Ga0496117_0037428 3300048920 Bacteria 3613
289 Ga0496117_0038696 3300048920 Bacteria 3531
290 Ga0496117_0051776 3300048920 Bacteria 2899
291 Ga0496117_0076850 3300048920 Bacteria 2211
292 Ga0496118_0087862 3300048921 Bacteria 2153
293 Ga0496118_0138082 3300048921 Bacteria 1551
294 Ga0496119_0009697 3300048922 Bacteria 8201
295 Ga0496119_0112648 3300048922 Bacteria 1507
296 Ga0496120_0000123 3300048923 Bacteria 129989
297 Ga0496120_0001513 3300048923 Bacteria 27460
298 Ga0496121_0027101 3300048924 Bacteria 5373
299 Ga0496121_0098908 3300048924 Bacteria 2256
300 Ga0496121_0213834 3300048924 Bacteria 1363
301 Ga0496122_0000032 3300048925 Bacteria 327099
302 Ga0496122_0011506 3300048925 Bacteria 8950
303 Ga0496122_0050984 3300048925 Bacteria 3150
304 Ga0496122_0077525 3300048925 Bacteria 2333
305 Ga0496123_0000228 3300048926 Bacteria 113817
306 Ga0496123_0003776 3300048926 Bacteria 16594
307 Ga0496123_0022441 3300048926 Bacteria 4864
308 Ga0496123_0043802 3300048926 Bacteria 3069
309 Ga0496123_0062811 3300048926 Bacteria 2376
310 Ga0496123_0107871 3300048926 Bacteria 1600
311 Ga0496124_0000902 3300048927 Bacteria 48012
312 Ga0496124_0001386 3300048927 Bacteria 36318
313 Ga0496124_0002497 3300048927 Bacteria 23933
314 Ga0496124_0006816 3300048927 Bacteria 12330
315 Ga0496124_0011490 3300048927 Bacteria 8847
316 Ga0496124_0020253 3300048927 Bacteria 6155
317 Ga0496124_0106894 3300048927 Bacteria 2258
318 Ga0496124_0269134 3300048927 Bacteria 1249
319 Ga0496125_0000041 3300048928 Bacteria 310158
320 Ga0496125_0009789 3300048928 Bacteria 9773
321 Ga0496125_0161453 3300048928 Bacteria 1521
322 Ga0496126_0011133 3300048929 Bacteria 9340
323 Ga0496126_0031652 3300048929 Bacteria 4993
324 Ga0496126_0092580 3300048929 Bacteria 2656
325 Ga0495678_033358 3300049459 Bacteria 2126
326 Ga0501031_0035822 3300049568 Bacteria 3238
327 Ga0501032_0043999 3300049569 Bacteria 3023
328 Ga0501033_0000158 3300049570 Bacteria 64817
329 Ga0501033_0023881 3300049570 Bacteria 4612
330 Ga0501033_0081170 3300049570 Bacteria 2378
331 Ga0501033_0198530 3300049570 Bacteria 1433
332 Ga0501034_0092048 3300049571 Bacteria 3029
333 Ga0501034_0101033 3300049571 Bacteria 2878
334 Ga0501034_0221884 3300049571 Bacteria 1842
335 Ga0501036_0231100 3300049572 Bacteria 1552
336 Ga0501036_0329380 3300049572 Bacteria 1276
337 Ga0501037_0056985 3300049573 Bacteria 2853
338 Ga0501037_0216143 3300049573 Bacteria 1350
339 Ga0501038_0079776 3300049574 Bacteria 2759
340 Ga0501038_0086384 3300049574 Bacteria 2635
341 Ga0501038_0132558 3300049574 Bacteria 2044
342 Ga0501039_0040700 3300049575 Bacteria 3587
343 Ga0501040_0000310 3300049576 Bacteria 28534
344 Ga0501040_0019347 3300049576 Bacteria 4528
345 Ga0501040_0308967 3300049576 Bacteria 1130
346 Ga0501042_0012781 3300049578 Bacteria 5698
347 Ga0501043_0000030 3300049579 Bacteria 142422
348 Ga0501043_0013598 3300049579 Bacteria 6368
349 Ga0501043_0020533 3300049579 Bacteria 5181
350 Ga0501043_0042389 3300049579 Bacteria 3577
351 Ga0501046_0108995 3300049580 Bacteria 2117
352 Ga0501046_0114601 3300049580 Bacteria 2056
353 Ga0501047_0015910 3300049581 Bacteria 7170
354 Ga0501047_0312234 3300049581 Bacteria 1412
355 Ga0501067_0012560 3300049583 Bacteria 4700
356 Ga0501068_0004976 3300049584 Bacteria 7239
357 Ga0501068_0066414 3300049584 Bacteria 2197
358 Ga0501069_0000006 3300049585 Bacteria 184515
359 Ga0501070_0001077 3300049586 Bacteria 24464
360 Ga0501070_0026061 3300049586 Bacteria 4905
361 Ga0501070_0111797 3300049586 Bacteria 2258
362 Ga0501070_0219550 3300049586 Bacteria 1559
363 Ga0501071_0016785 3300049587 Bacteria 5036
364 Ga0501071_0105891 3300049587 Bacteria 2076
365 Ga0501072_0166123 3300049588 Bacteria 1761
366 Ga0501073_0016069 3300049589 Bacteria 5427
367 Ga0501073_0038189 3300049589 Bacteria 3408
368 Ga0501074_0000026 3300049590 Bacteria 68218
369 Ga0501080_0000222 3300049742 Bacteria 42490
370 Ga0501080_0310519 3300049742 Bacteria 1429
371 Ga0501083_0000129 3300049744 Bacteria 51513
372 Ga0501083_0077872 3300049744 Bacteria 2199
373 Ga0501083_0251440 3300049744 Bacteria 1150
374 Ga0501035_0000017 3300049822 Bacteria 241915
375 Ga0501035_0049568 3300049822 Bacteria 3762
376 Ga0501035_0058125 3300049822 Bacteria 3447
377 Ga0501035_0123396 3300049822 Bacteria 2262
378 Ga0501044_0000034 3300049823 Bacteria 164058
379 Ga0501044_0030003 3300049823 Bacteria 5732
380 Ga0501044_0032627 3300049823 Bacteria 5473
381 Ga0501044_0327672 3300049823 Bacteria 1455
382 Ga0501045_0019953 3300049824 Bacteria 4783
383 nmdc:mga00v17_21568_c1 3300050491 Bacteria 3704
384 nmdc:mga00v17_80258_c1 3300050491 Bacteria 2036
385 nmdc:mga06z11_170292_c1 3300050494 Bacteria 1250
386 nmdc:mga0sz30_74958_c1 3300050516 Bacteria 1460
387 Ga0500610_0001510 3300053079 Bacteria 7977
388 Ga0500651_0005532 3300053093 Bacteria 7223
389 Ga0500555_005923 3300053103 Bacteria 3468
390 Ga0500556_0071632 3300053104 Bacteria 1296
391 Ga0500608_036757 3300053122 Bacteria 2339
392 Ga0500642_0002456 3300053130 Bacteria 5447
393 Ga0500658_0001228 3300053134 Bacteria 10424
394 Ga0500658_0034412 3300053134 Bacteria 1999
395 Ga0500568_0000119 3300053139 Bacteria 70768
396 Ga0500573_0007990 3300053140 Bacteria 5808
397 Ga0500590_005028 3300053148 Bacteria 6326
398 Ga0500616_0001232 3300053153 Bacteria 25675
399 Ga0500616_0023591 3300053153 Bacteria 3425
400 Ga0500620_000123 3300053155 Bacteria 15458
401 Ga0500627_0037871 3300053158 Bacteria 2060
402 Ga0500627_0057920 3300053158 Bacteria 1700
403 Ga0500611_001575 3300053727 Bacteria 2549
404 Ga0501082_0231006 3300060353 Bacteria 1610

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046519 Ga0495632_0176354 Ga0495632_0176354_51_914 287
2 3300044683 Ga0466965_0011546 Ga0466965_0011546_478_1470 291
3 3300044901 Ga0466960_0099216 Ga0466960_0099216_175_1167 291
4 3300053140 Ga0500573_0007990 Ga0500573_0007990_55_1062 291
5 3300047323 Ga0495683_0000899 Ga0495683_0000899_13137_14120 292
6 3300028794 Ga0307515_10001382 Ga0307515_1000138252 293
7 3300031456 Ga0307513_10411082 Ga0307513_104110821 293
8 3300045976 Ga0466967_0010746 Ga0466967_0010746_4623_5612 295
9 3300037418 Ga0395900_0282597 Ga0395900_0282597_748_1641 297
10 3300031852 Ga0307410_10092696 Ga0307410_100926962 299
11 3300031995 Ga0307409_100088838 Ga0307409_1000888382 299
12 3300005356 Ga0070674_100321404 Ga0070674_1003214041 301
13 3300005546 Ga0070696_100145153 Ga0070696_1001451532 301
14 3300005549 Ga0070704_100372265 Ga0070704_1003722651 301
15 3300005616 Ga0068852_100355955 Ga0068852_1003559552 301
16 3300009176 Ga0105242_10036780 Ga0105242_100367802 301
17 3300009551 Ga0105238_10064862 Ga0105238_100648622 301
18 3300009553 Ga0105249_10082277 Ga0105249_100822773 301
19 3300013297 Ga0157378_10086331 Ga0157378_100863313 301
20 3300013308 Ga0157375_10141086 Ga0157375_101410863 301
21 3300014969 Ga0157376_10248496 Ga0157376_102484962 301
22 3300025914 Ga0207671_10176386 Ga0207671_101763862 301
23 3300025935 Ga0207709_10005309 Ga0207709_100053093 301
24 3300048091 Ga0495626_0036263 Ga0495626_0036263_639_1544 301
25 3300053122 Ga0500608_036757 Ga0500608_036757_268_1227 301
26 3300049572 Ga0501036_0329380 Ga0501036_0329380_203_1186 302
27 3300049580 Ga0501046_0108995 Ga0501046_0108995_325_1308 302
28 3300049581 Ga0501047_0312234 Ga0501047_0312234_284_1267 302
29 3300049584 Ga0501068_0066414 Ga0501068_0066414_221_1396 302
30 3300049586 Ga0501070_0111797 Ga0501070_0111797_397_1380 302
31 3300013104 Ga0157370_10413956 Ga0157370_104139561 304
32 3300049578 Ga0501042_0012781 Ga0501042_0012781_4745_5671 304
33 3300005364 Ga0070673_100481907 Ga0070673_1004819071 305
34 3300006038 Ga0075365_10190485 Ga0075365_101904851 305
35 3300006042 Ga0075368_10042999 Ga0075368_100429992 305
36 3300006178 Ga0075367_10157540 Ga0075367_101575402 305
37 3300006186 Ga0075369_10040781 Ga0075369_100407812 305
38 3300006195 Ga0075366_10270971 Ga0075366_102709711 305
39 3300009148 Ga0105243_10474763 Ga0105243_104747631 305
40 3300010375 Ga0105239_10362971 Ga0105239_103629712 305
41 3300013100 Ga0157373_10006096 Ga0157373_100060965 305
42 3300013105 Ga0157369_10026933 Ga0157369_100269334 305
43 3300013297 Ga0157378_10283328 Ga0157378_102833282 305
44 3300013306 Ga0163162_10385477 Ga0163162_103854771 305
45 3300025315 Ga0207697_10067022 Ga0207697_100670222 305
46 3300025901 Ga0207688_10165159 Ga0207688_101651592 305
47 3300025907 Ga0207645_10035117 Ga0207645_100351172 305
48 3300025933 Ga0207706_10158657 Ga0207706_101586572 305
49 3300026089 Ga0207648_10145368 Ga0207648_101453682 305
50 3300026116 Ga0207674_10186703 Ga0207674_101867032 305
51 3300037853 Ga0436364_0932243 Ga0436364_0932243_1863_2813 305
52 3300046460 Ga0495638_0019057 Ga0495638_0019057_3287_4228 305
53 3300046522 Ga0495643_0135953 Ga0495643_0135953_144_1085 305
54 3300046542 Ga0495597_0095127 Ga0495597_0095127_23_970 305
55 3300046660 Ga0495625_0037596 Ga0495625_0037596_2518_3465 305
56 3300046810 Ga0495660_0048436 Ga0495660_0048436_547_1494 305
57 3300047470 Ga0495681_0095730 Ga0495681_0095730_83_1024 305
58 3300049586 Ga0501070_0026061 Ga0501070_0026061_2396_3337 305
59 3300049823 Ga0501044_0327672 Ga0501044_0327672_448_1389 305
60 3300053079 Ga0500610_0001510 Ga0500610_0001510_1918_2865 305
61 3300053155 Ga0500620_000123 Ga0500620_000123_6102_7043 305
62 3300053158 Ga0500627_0057920 Ga0500627_0057920_15_962 305
63 3300053727 Ga0500611_001575 Ga0500611_001575_307_1248 305
64 iso_pu_bacteria 2509276018 2509369176 305
65 iso_pu_bacteria 2510065059 2510316932 305
66 iso_pu_bacteria 2600254933 2600376371 305
67 iso_pu_bacteria 2643221595 2643986402 305
68 iso_pu_bacteria 2643221627 2644152634 305
69 iso_pu_bacteria 2687453392 2688600726 305
70 iso_pu_bacteria 2756170246 2756672675 305
71 iso_pu_bacteria 2791355123 2792745724 305
72 iso_pu_bacteria 2844002411 2844005131 305
73 iso_pu_bacteria 2844009547 2844016076 305
74 iso_pu_bacteria 2856328259 2856330142 305
75 iso_pu_bacteria 2856334872 2856336868 305
76 iso_pu_bacteria 2857367948 2857370820 305
77 iso_pu_bacteria 2869169390 2869170243 305
78 iso_pu_bacteria 2869234852 2869235594 305
79 iso_pu_bacteria 2869242130 2869249647 305
80 iso_pu_bacteria 2869249662 2869251865 305
81 iso_pu_bacteria 2869256925 2869259174 305
82 iso_pu_bacteria 2869264136 2869265814 305
83 iso_pu_bacteria 2869271264 2869277104 305
84 iso_pu_bacteria 2871435913 2871437310 305
85 iso_pu_bacteria 2871451962 2871455778 305
86 iso_pu_bacteria 2871459585 2871463661 305
87 iso_pu_bacteria 2871466892 2871469165 305
88 iso_pu_bacteria 2871481445 2871486317 305
89 iso_pu_bacteria 2874109183 2874110440 305
90 iso_pu_bacteria 2874116593 2874121182 305
91 iso_pu_bacteria 2874123672 2874124870 305
92 iso_pu_bacteria 2874131515 2874135572 305
93 iso_pu_bacteria 2874162495 2874164125 305
94 iso_pu_bacteria 2874168670 2874173993 305
95 iso_pu_bacteria 2876386047 2876387611 305
96 iso_pu_bacteria 2876399893 2876401783 305
97 iso_pu_bacteria 2876406927 2876407473 305
98 iso_pu_bacteria 2876420981 2876425590 305
99 iso_pu_bacteria 2878730984 2878738344 305
100 iso_pu_bacteria 2878774303 2878774927 305
101 iso_pu_bacteria 2878781027 2878784021 305
102 iso_pu_bacteria 2903513507 2903514317 305
103 iso_pu_bacteria 2906363423 2906368598 305
104 iso_pu_bacteria 2906370794 2906377110 305
105 iso_pu_bacteria 2906378014 2906382304 305
106 iso_pu_bacteria 2906386501 2906392777 305
107 iso_pu_bacteria 2906393657 2906399088 305
108 iso_pu_bacteria 2906401398 2906404845 305
109 iso_pu_bacteria 2906408224 2906409812 305
110 iso_pu_bacteria 2906427513 2906435156 305
111 iso_pu_bacteria 2922151315 2922156654 305
112 iso_pu_bacteria 2922172374 2922176283 305
113 iso_pu_bacteria 2922178524 2922185669 305
114 iso_pu_bacteria 2924710171 2924712867 305
115 iso_pu_bacteria 2924733363 2924737554 305
116 iso_pu_bacteria 2924741084 2924741459 305
117 iso_pu_bacteria 2924748358 2924752497 305
118 iso_pu_bacteria 2924762789 2924769069 305
119 iso_pu_bacteria 2937861824 2937868749 305
120 iso_pu_bacteria 2937868953 2937875651 305
121 iso_pu_bacteria 2937980651 2937983658 305
122 iso_pu_bacteria 2958108152 2958111751 305
123 iso_pu_bacteria 2958122699 2958126571 305
124 iso_pu_bacteria 2958137437 2958141869 305
125 iso_pu_bacteria 2958158011 2958160683 305
126 iso_pu_bacteria 2961136820 2961141421 305
127 iso_pu_bacteria 2961183825 2961186174 305
128 iso_pu_bacteria 2965025482 2965031331 305
129 iso_pu_bacteria 2965032056 2965035023 305
130 iso_pu_bacteria 2965040258 2965043268 305
131 iso_pu_bacteria 2965047637 2965049479 305
132 iso_pu_bacteria 2965089291 2965096127 305
133 iso_pu_bacteria 2965102966 2965104155 305
134 iso_pu_bacteria 2965110997 2965116281 305
135 iso_pu_bacteria 2968138860 2968146284 305
136 iso_pu_bacteria 2970489779 2970491780 305
137 iso_pu_bacteria 2970510686 2970516271 305
138 iso_pu_bacteria 2970532167 2970535014 305
139 iso_pu_bacteria 2970547951 2970549637 305
140 iso_pu_bacteria 2970619444 2970620782 305
141 iso_pu_bacteria 2970627176 2970627758 305
142 iso_pu_bacteria 2977851361 2977855731 305
143 iso_pu_bacteria 2977864932 2977868008 305
144 iso_pu_bacteria 2977872689 2977877328 305
145 iso_pu_bacteria 2977898635 2977903468 305
146 iso_pu_bacteria 2977907340 2977912870 305
147 iso_pu_bacteria 2977915119 2977917393 305
148 iso_pu_bacteria 2977935797 2977937350 305
149 iso_pu_bacteria 2977950692 2977952592 305
150 iso_pu_bacteria 2977957713 2977960379 305
151 iso_pu_bacteria 2979764755 2979766948 305
152 iso_pu_bacteria 2979772303 2979775999 305
153 iso_pu_bacteria 2979793036 2979796822 305
154 iso_pu_bacteria 2987645492 2987651688 305
155 iso_pu_bacteria 2987666974 2987672921 305
156 iso_pu_bacteria 2987673487 2987676189 305
157 iso_pu_bacteria 2996386984 2996391160 305
158 iso_pu_bacteria 3004167301 3004171613 305
159 iso_pu_bacteria 3004195979 3004201345 305
160 iso_pu_bacteria 3004232784 3004234599 305
161 iso_pu_bacteria 3004239961 3004245021 305
162 iso_pu_bacteria 3004248173 3004252615 305
163 iso_pu_bacteria 3004268573 3004270176 305
164 iso_pu_bacteria 649633066 649875179 305
165 iso_pu_bacteria 8004300914 8004303480 305
166 iso_pu_bacteria 8004312739 8004318048 305
167 iso_pu_bacteria 8004361976 8004364412 305
168 iso_pu_bacteria 8004695233 8004698988 305
169 iso_pu_bacteria 8004727605 8004733629 305
170 3300001979 JGI24740J21852_10000014 JGI24740J21852_1000001417 306
171 3300002704 JGI25155J39150_1000068 JGI25155J39150_100006815 306
172 3300002705 JGI25156J39149_1000093 JGI25156J39149_100009315 306
173 3300002705 JGI25156J39149_1009111 JGI25156J39149_10091113 306
174 3300002737 JGI25162J39368_1000184 JGI25162J39368_100018413 306
175 3300002737 JGI25162J39368_1000275 JGI25162J39368_100027520 306
176 3300002738 JGI25154J39366_1000116 JGI25154J39366_100011615 306
177 3300002739 JGI25158J39367_1000107 JGI25158J39367_10001075 306
178 3300002741 JGI25157J39369_1000125 JGI25157J39369_100012515 306
179 3300002741 JGI25157J39369_1004707 JGI25157J39369_10047072 306
180 3300002773 JGI25152J39213_1000199 JGI25152J39213_10001995 306
181 3300002773 JGI25152J39213_1001105 JGI25152J39213_10011051 306
182 3300002773 JGI25152J39213_1002514 JGI25152J39213_10025143 306
183 3300002774 JGI25150J39212_1000022 JGI25150J39212_1000022109 306
184 3300002774 JGI25150J39212_1014169 JGI25150J39212_10141692 306
185 3300002987 JGI25159J45721_1000543 JGI25159J45721_100054312 306
186 3300003187 JGI25151J46595_10000023 JGI25151J46595_1000002336 306
187 3300003187 JGI25151J46595_10001667 JGI25151J46595_100016673 306
188 3300003187 JGI25151J46595_10003807 JGI25151J46595_100038073 306
189 3300003214 JGI25165J46597_1000163 JGI25165J46597_100016338 306
190 3300003214 JGI25165J46597_1000624 JGI25165J46597_100062428 306
191 3300003214 JGI25165J46597_1004033 JGI25165J46597_10040332 306
192 3300003215 JGI25153J46596_10001049 JGI25153J46596_100010494 306
193 3300003215 JGI25153J46596_10004413 JGI25153J46596_100044137 306
194 3300003215 JGI25153J46596_10032974 JGI25153J46596_100329742 306
195 3300003320 rootH2_10006291 rootH2_100062913 306
196 3300003354 JGI25160J50197_1001094 JGI25160J50197_100109411 306
197 3300003374 JGI25161J50226_1000119 JGI25161J50226_100011940 306
198 3300003578 Ga0006562J51391_1004840 Ga0006562J51391_10048405 306
199 3300003578 Ga0006562J51391_1012646 Ga0006562J51391_10126462 306
200 3300003771 Ga0055526_1002906 Ga0055526_10029067 306
201 3300003775 Ga0055524_1013514 Ga0055524_10135143 306
202 3300003790 Ga0055528_1000098 Ga0055528_100009848 306
203 3300003790 Ga0055528_1001538 Ga0055528_10015389 306
204 3300003792 Ga0055540_1002685 Ga0055540_10026856 306
205 3300003792 Ga0055540_1009980 Ga0055540_10099803 306
206 3300004625 Ga0055543_1000581 Ga0055543_10005812 306
207 3300005262 Ga0065165_1020120 Ga0065165_10201203 306
208 3300005614 Ga0068856_100028071 Ga0068856_1000280713 306
209 3300005614 Ga0068856_100052698 Ga0068856_1000526983 306
210 3300006178 Ga0075367_10136547 Ga0075367_101365472 306
211 3300006186 Ga0075369_10060140 Ga0075369_100601402 306
212 3300006353 Ga0075370_10000487 Ga0075370_1000048714 306
213 3300006353 Ga0075370_10071644 Ga0075370_100716442 306
214 3300006353 Ga0075370_10196359 Ga0075370_101963591 306
215 3300009036 Ga0105244_10079238 Ga0105244_100792381 306
216 3300009093 Ga0105240_10000976 Ga0105240_100009769 306
217 3300009148 Ga0105243_10521357 Ga0105243_105213571 306
218 3300009545 Ga0105237_10014322 Ga0105237_100143226 306
219 3300009545 Ga0105237_10367785 Ga0105237_103677852 306
220 3300010375 Ga0105239_10056394 Ga0105239_100563943 306
221 3300010375 Ga0105239_10154885 Ga0105239_101548853 306
222 3300013100 Ga0157373_10195199 Ga0157373_101951992 306
223 3300013102 Ga0157371_10336922 Ga0157371_103369221 306
224 3300013104 Ga0157370_10027522 Ga0157370_100275223 306
225 3300013105 Ga0157369_10143724 Ga0157369_101437243 306
226 3300013296 Ga0157374_10311257 Ga0157374_103112572 306
227 3300014497 Ga0182008_10138280 Ga0182008_101382801 306
228 3300015262 Ga0182007_10004230 Ga0182007_100042304 306
229 3300015265 Ga0182005_1010635 Ga0182005_10106352 306
230 3300025206 Ga0209435_100068 Ga0209435_10006815 306
231 3300025208 Ga0209436_100017 Ga0209436_10001716 306
232 3300025233 Ga0209437_100095 Ga0209437_100095171 306
233 3300025233 Ga0209437_100239 Ga0209437_10023927 306
234 3300025233 Ga0209437_104328 Ga0209437_1043282 306
235 3300025245 Ga0207425_1000038 Ga0207425_1000038190 306
236 3300025245 Ga0207425_1001193 Ga0207425_10011938 306
237 3300025246 Ga0209646_1000210 Ga0209646_100021015 306
238 3300025246 Ga0209646_1005841 Ga0209646_10058411 306
239 3300025250 Ga0209026_1000023 Ga0209026_1000023364 306
240 3300025250 Ga0209026_1000259 Ga0209026_100025915 306
241 3300025253 Ga0209677_100224 Ga0209677_10022419 306
242 3300025256 Ga0209759_1000311 Ga0209759_100031115 306
243 3300025256 Ga0209759_1001335 Ga0209759_10013359 306
244 3300025258 Ga0209129_1000036 Ga0209129_1000036190 306
245 3300025258 Ga0209129_1000120 Ga0209129_1000120126 306
246 3300025258 Ga0209129_1001817 Ga0209129_10018175 306
247 3300025258 Ga0209129_1002328 Ga0209129_10023286 306
248 3300025258 Ga0209129_1002942 Ga0209129_10029426 306
249 3300025258 Ga0209129_1006029 Ga0209129_10060293 306
250 3300025261 Ga0209233_1000097 Ga0209233_100009723 306
251 3300025261 Ga0209233_1000117 Ga0209233_1000117171 306
252 3300025261 Ga0209233_1000245 Ga0209233_100024555 306
253 3300025273 Ga0209673_1000132 Ga0209673_100013262 306
254 3300025273 Ga0209673_1003180 Ga0209673_10031809 306
255 3300025273 Ga0209673_1007394 Ga0209673_10073943 306
256 3300025273 Ga0209673_1026860 Ga0209673_10268602 306
257 3300025284 Ga0209130_1000001 Ga0209130_100000134 306
258 3300025294 Ga0209025_1000086 Ga0209025_1000086153 306
259 3300025294 Ga0209025_1000108 Ga0209025_1000108190 306
260 3300025294 Ga0209025_1010659 Ga0209025_10106594 306
261 3300025295 Ga0209564_1003137 Ga0209564_10031376 306
262 3300025295 Ga0209564_1017637 Ga0209564_10176372 306
263 3300025295 Ga0209564_1018632 Ga0209564_10186323 306
264 3300025297 Ga0209758_1000104 Ga0209758_100010437 306
265 3300025297 Ga0209758_1000504 Ga0209758_100050457 306
266 3300025297 Ga0209758_1003598 Ga0209758_10035986 306
267 3300025297 Ga0209758_1003601 Ga0209758_10036016 306
268 3300025297 Ga0209758_1010491 Ga0209758_10104913 306
269 3300025299 Ga0209256_1002227 Ga0209256_10022273 306
270 3300025299 Ga0209256_1002579 Ga0209256_10025799 306
271 3300025302 Ga0207426_1000005 Ga0207426_1000005639 306
272 3300025303 Ga0209051_1001654 Ga0209051_100165417 306
273 3300025303 Ga0209051_1007618 Ga0209051_10076183 306
274 3300025303 Ga0209051_1022839 Ga0209051_10228391 306
275 3300025304 Ga0209257_1022059 Ga0209257_10220592 306
276 3300025904 Ga0207647_10125090 Ga0207647_101250901 306
277 3300025913 Ga0207695_10000948 Ga0207695_100009489 306
278 3300025914 Ga0207671_10000749 Ga0207671_1000074917 306
279 3300025938 Ga0207704_10366902 Ga0207704_103669021 306
280 3300025972 Ga0207668_10412111 Ga0207668_104121111 306
281 3300026078 Ga0207702_10007239 Ga0207702_100072394 306
282 3300027312 Ga0209371_1005590 Ga0209371_10055904 306
283 3300030500 Ga0268256_1005503 Ga0268256_10055034 306
284 3300031731 Ga0307405_10251351 Ga0307405_102513511 306
285 3300031911 Ga0307412_10072750 Ga0307412_100727502 306
286 3300037471 Ga0395905_0003418 Ga0395905_0003418_10450_11382 306
287 3300037471 Ga0395905_0364801 Ga0395905_0364801_171_1118 306
288 3300041491 Ga0451833_0147555 Ga0451833_0147555_52_999 306
289 3300044765 Ga0466970_0053530 Ga0466970_0053530_488_1435 306
290 3300045976 Ga0466967_0180099 Ga0466967_0180099_839_1786 306
291 3300046460 Ga0495638_0013615 Ga0495638_0013615_1555_2487 306
292 3300046474 Ga0495605_0090742 Ga0495605_0090742_314_1261 306
293 3300046492 Ga0495585_0073226 Ga0495585_0073226_334_1266 306
294 3300046501 Ga0495607_0054412 Ga0495607_0054412_632_1579 306
295 3300046506 Ga0495583_0041380 Ga0495583_0041380_695_1642 306
296 3300046512 Ga0495610_0000138 Ga0495610_0000138_62211_63158 306
297 3300046522 Ga0495643_0009855 Ga0495643_0009855_4017_4964 306
298 3300046522 Ga0495643_0080947 Ga0495643_0080947_715_1662 306
299 3300046522 Ga0495643_0137993 Ga0495643_0137993_196_1143 306
300 3300046523 Ga0495644_0035642 Ga0495644_0035642_102_1049 306
301 3300046524 Ga0495648_0009192 Ga0495648_0009192_111_1058 306
302 3300046558 Ga0495633_0040072 Ga0495633_0040072_1097_2044 306
303 3300046660 Ga0495625_0121417 Ga0495625_0121417_178_1125 306
304 3300046692 Ga0495671_0029547 Ga0495671_0029547_592_1539 306
305 3300047472 Ga0495686_0004949 Ga0495686_0004949_6195_7142 306
306 3300048909 Ga0496106_0000324 Ga0496106_0000324_15685_16632 306
307 3300048914 Ga0496111_0000747 Ga0496111_0000747_10625_11572 306
308 3300048919 Ga0496116_0001317 Ga0496116_0001317_21340_22380 306
309 3300048920 Ga0496117_0037428 Ga0496117_0037428_1568_2515 306
310 3300048920 Ga0496117_0038696 Ga0496117_0038696_1017_1964 306
311 3300048920 Ga0496117_0076850 Ga0496117_0076850_112_1059 306
312 3300048921 Ga0496118_0138082 Ga0496118_0138082_387_1334 306
313 3300048922 Ga0496119_0112648 Ga0496119_0112648_205_1152 306
314 3300048924 Ga0496121_0213834 Ga0496121_0213834_369_1316 306
315 3300048925 Ga0496122_0000032 Ga0496122_0000032_41928_42875 306
316 3300048925 Ga0496122_0050984 Ga0496122_0050984_1065_2012 306
317 3300048925 Ga0496122_0077525 Ga0496122_0077525_1000_1947 306
318 3300048926 Ga0496123_0000228 Ga0496123_0000228_89143_90090 306
319 3300048926 Ga0496123_0022441 Ga0496123_0022441_3428_4375 306
320 3300048926 Ga0496123_0043802 Ga0496123_0043802_229_1269 306
321 3300048926 Ga0496123_0062811 Ga0496123_0062811_1241_2188 306
322 3300048926 Ga0496123_0107871 Ga0496123_0107871_76_1023 306
323 3300048927 Ga0496124_0000902 Ga0496124_0000902_11847_12887 306
324 3300048927 Ga0496124_0001386 Ga0496124_0001386_31295_32242 306
325 3300048927 Ga0496124_0020253 Ga0496124_0020253_4902_5849 306
326 3300048927 Ga0496124_0106894 Ga0496124_0106894_266_1213 306
327 3300048927 Ga0496124_0269134 Ga0496124_0269134_186_1118 306
328 3300048928 Ga0496125_0000041 Ga0496125_0000041_89092_90039 306
329 3300048928 Ga0496125_0009789 Ga0496125_0009789_5449_6396 306
330 3300048928 Ga0496125_0161453 Ga0496125_0161453_119_1066 306
331 3300048929 Ga0496126_0011133 Ga0496126_0011133_4716_5663 306
332 3300048929 Ga0496126_0031652 Ga0496126_0031652_26_973 306
333 3300049568 Ga0501031_0035822 Ga0501031_0035822_853_1800 306
334 3300049569 Ga0501032_0043999 Ga0501032_0043999_478_1425 306
335 3300049570 Ga0501033_0000158 Ga0501033_0000158_6520_7467 306
336 3300049570 Ga0501033_0023881 Ga0501033_0023881_625_1572 306
337 3300049570 Ga0501033_0081170 Ga0501033_0081170_392_1339 306
338 3300049570 Ga0501033_0198530 Ga0501033_0198530_310_1257 306
339 3300049571 Ga0501034_0092048 Ga0501034_0092048_1859_2806 306
340 3300049571 Ga0501034_0101033 Ga0501034_0101033_1013_1960 306
341 3300049571 Ga0501034_0221884 Ga0501034_0221884_472_1485 306
342 3300049572 Ga0501036_0231100 Ga0501036_0231100_442_1455 306
343 3300049573 Ga0501037_0056985 Ga0501037_0056985_1829_2776 306
344 3300049573 Ga0501037_0216143 Ga0501037_0216143_297_1244 306
345 3300049574 Ga0501038_0079776 Ga0501038_0079776_1673_2686 306
346 3300049574 Ga0501038_0086384 Ga0501038_0086384_1531_2478 306
347 3300049574 Ga0501038_0132558 Ga0501038_0132558_344_1291 306
348 3300049575 Ga0501039_0040700 Ga0501039_0040700_2359_3306 306
349 3300049576 Ga0501040_0000310 Ga0501040_0000310_24330_25268 306
350 3300049576 Ga0501040_0019347 Ga0501040_0019347_565_1512 306
351 3300049576 Ga0501040_0308967 Ga0501040_0308967_86_1045 306
352 3300049579 Ga0501043_0000030 Ga0501043_0000030_67032_67979 306
353 3300049579 Ga0501043_0013598 Ga0501043_0013598_2169_3182 306
354 3300049579 Ga0501043_0020533 Ga0501043_0020533_2704_3651 306
355 3300049579 Ga0501043_0042389 Ga0501043_0042389_2152_3099 306
356 3300049580 Ga0501046_0114601 Ga0501046_0114601_1034_1981 306
357 3300049581 Ga0501047_0015910 Ga0501047_0015910_1706_2653 306
358 3300049583 Ga0501067_0012560 Ga0501067_0012560_3050_3997 306
359 3300049584 Ga0501068_0004976 Ga0501068_0004976_5826_6773 306
360 3300049585 Ga0501069_0000006 Ga0501069_0000006_65002_65949 306
361 3300049586 Ga0501070_0001077 Ga0501070_0001077_12072_13019 306
362 3300049586 Ga0501070_0219550 Ga0501070_0219550_469_1416 306
363 3300049587 Ga0501071_0016785 Ga0501071_0016785_900_1847 306
364 3300049587 Ga0501071_0105891 Ga0501071_0105891_1093_2040 306
365 3300049588 Ga0501072_0166123 Ga0501072_0166123_578_1525 306
366 3300049589 Ga0501073_0016069 Ga0501073_0016069_1895_2842 306
367 3300049589 Ga0501073_0038189 Ga0501073_0038189_1707_2654 306
368 3300049590 Ga0501074_0000026 Ga0501074_0000026_10913_11860 306
369 3300049742 Ga0501080_0000222 Ga0501080_0000222_5421_6368 306
370 3300049742 Ga0501080_0310519 Ga0501080_0310519_74_1021 306
371 3300049744 Ga0501083_0000129 Ga0501083_0000129_41139_42086 306
372 3300049744 Ga0501083_0077872 Ga0501083_0077872_1240_2187 306
373 3300049744 Ga0501083_0251440 Ga0501083_0251440_127_1074 306
374 3300049822 Ga0501035_0000017 Ga0501035_0000017_118374_119321 306
375 3300049822 Ga0501035_0049568 Ga0501035_0049568_1951_2898 306
376 3300049822 Ga0501035_0058125 Ga0501035_0058125_2127_3074 306
377 3300049822 Ga0501035_0123396 Ga0501035_0123396_726_1739 306
378 3300049823 Ga0501044_0000034 Ga0501044_0000034_65886_66833 306
379 3300049823 Ga0501044_0030003 Ga0501044_0030003_2834_3781 306
380 3300049823 Ga0501044_0032627 Ga0501044_0032627_2674_3621 306
381 3300049824 Ga0501045_0019953 Ga0501045_0019953_2972_3919 306
382 3300053134 Ga0500658_0001228 Ga0500658_0001228_8164_9111 306
383 3300060353 Ga0501082_0231006 Ga0501082_0231006_11_934 306
384 iso_pu_bacteria 2510065019 2510136404 306
385 iso_pu_bacteria 2510461076 2510892587 306
386 iso_pu_bacteria 2510917022 2511131660 306
387 iso_pu_bacteria 2510917030 2511195741 306
388 iso_pu_bacteria 2513237084 2513568033 306
389 iso_pu_bacteria 2513237085 2513578404 306
390 iso_pu_bacteria 2513237093 2513630977 306
391 iso_pu_bacteria 2513237103 2513711103 306
392 iso_pu_bacteria 2513237144 2513909372 306
393 iso_pu_bacteria 2513237146 2513925035 306
394 iso_pu_bacteria 2513237162 2514018541 306
395 iso_pu_bacteria 2515075009 2515108640 306
396 iso_pu_bacteria 2515154113 2515632480 306
397 iso_pu_bacteria 2515154114 2515640633 306
398 iso_pu_bacteria 2515154116 2515661377 306
399 iso_pu_bacteria 2515154134 2515738134 306
400 iso_pu_bacteria 2516653077 2517041178 306
401 iso_pu_bacteria 2516653085 2517080190 306
402 iso_pu_bacteria 2517093000 2517098190 306
403 iso_pu_bacteria 2517287029 2517410283 306
404 iso_pu_bacteria 2523231067 2523468995 306
405 iso_pu_bacteria 2529292951 2530649899 306
406 iso_pu_bacteria 2534681786 2535486806 306
407 iso_pu_bacteria 2534681796 2535519740 306
408 iso_pu_bacteria 2582581298 2585221809 306
409 iso_pu_bacteria 2582581299 2585228273 306
410 iso_pu_bacteria 2582581304 2585258762 306
411 iso_pu_bacteria 2582581307 2585275134 306
412 iso_pu_bacteria 2582581308 2585283662 306
413 iso_pu_bacteria 2582581315 2585328752 306
414 iso_pu_bacteria 2582581316 2585335787 306
415 iso_pu_bacteria 2585427526 2585525563 306
416 iso_pu_bacteria 2585427527 2585536813 306
417 iso_pu_bacteria 2585427529 2585544021 306
418 iso_pu_bacteria 2585427530 2585555514 306
419 iso_pu_bacteria 2585427531 2585561152 306
420 iso_pu_bacteria 2585427594 2585842292 306
421 iso_pu_bacteria 2585427608 2585899801 306
422 iso_pu_bacteria 2585427609 2585908256 306
423 iso_pu_bacteria 2585428125 2587983709 306
424 iso_pu_bacteria 2599185156 2599332599 306
425 iso_pu_bacteria 2599185170 2599416608 306
426 iso_pu_bacteria 2599185236 2599718361 306
427 iso_pu_bacteria 2615840624 2616294599 306
428 iso_pu_bacteria 2615840626 2616313142 306
429 iso_pu_bacteria 2615840698 2616551385 306
430 iso_pu_bacteria 2617270742 2617383978 306
431 iso_pu_bacteria 2643221599 2644003961 306
432 iso_pu_bacteria 2643221634 2644193870 306
433 iso_pu_bacteria 2643221643 2644237737 306
434 iso_pu_bacteria 2667528174 2671115006 306
435 iso_pu_bacteria 2724679232 2725947812 306
436 iso_pu_bacteria 2738541293 2738801732 306
437 iso_pu_bacteria 2738541317 2738946890 306
438 iso_pu_bacteria 2751185800 2753357102 306
439 iso_pu_bacteria 2758568016 2758639388 306
440 iso_pu_bacteria 2765235942 2766065087 306
441 iso_pu_bacteria 2775507266 2778178030 306
442 iso_pu_bacteria 2791355253 2793280385 306
443 iso_pu_bacteria 2818991448 2819607432 306
444 iso_pu_bacteria 2818991453 2819642222 306
445 iso_pu_bacteria 2837651117 2837652799 306
446 iso_pu_bacteria 2838029111 2838031919 306
447 iso_pu_bacteria 2838035591 2838036715 306
448 iso_pu_bacteria 2838661181 2838662250 306
449 iso_pu_bacteria 2838686498 2838687452 306
450 iso_pu_bacteria 2838729681 2838734136 306
451 iso_pu_bacteria 2838742623 2838746588 306
452 iso_pu_bacteria 2841851746 2841854002 306
453 iso_pu_bacteria 2842110456 2842116755 306
454 iso_pu_bacteria 2842156927 2842159631 306
455 iso_pu_bacteria 2842163707 2842164080 306
456 iso_pu_bacteria 2842180545 2842182799 306
457 iso_pu_bacteria 2842217011 2842221569 306
458 iso_pu_bacteria 2842229732 2842232510 306
459 iso_pu_bacteria 2842243621 2842247247 306
460 iso_pu_bacteria 2842257432 2842259066 306
461 iso_pu_bacteria 2842271015 2842272514 306
462 iso_pu_bacteria 2842304105 2842309848 306
463 iso_pu_bacteria 2842475841 2842478651 306
464 iso_pu_bacteria 2842482326 2842486377 306
465 iso_pu_bacteria 2842502639 2842506030 306
466 iso_pu_bacteria 2842509118 2842511979 306
467 iso_pu_bacteria 2842922631 2842922872 306
468 iso_pu_bacteria 2844454524 2844460448 306
469 iso_pu_bacteria 2852387548 2852394974 306
470 iso_pu_bacteria 2854911287 2854914847 306
471 iso_pu_bacteria 2857516855 2857518007 306
472 iso_pu_bacteria 2876369609 2876373799 306
473 iso_pu_bacteria 2885305155 2885309248 306
474 iso_pu_bacteria 2885326080 2885326344 306
475 iso_pu_bacteria 2885334103 2885338776 306
476 iso_pu_bacteria 2891373044 2891376048 306
477 iso_pu_bacteria 2899275550 2899278353 306
478 iso_pu_bacteria 2909042592 2909046309 306
479 iso_pu_bacteria 2913308742 2913311750 306
480 iso_pu_bacteria 2915650412 2915652405 306
481 iso_pu_bacteria 2919100787 2919103235 306
482 iso_pu_bacteria 2919408235 2919411916 306
483 iso_pu_bacteria 2933016740 2933023341 306
484 iso_pu_bacteria 2933570622 2933576290 306
485 iso_pu_bacteria 2933586486 2933592971 306
486 iso_pu_bacteria 2935901341 2935903181 306
487 iso_pu_bacteria 2936367885 2936374421 306
488 iso_pu_bacteria 2936375103 2936378737 306
489 iso_pu_bacteria 2965062239 2965067974 306
490 iso_pu_bacteria 2968091066 2968095215 306
491 iso_pu_bacteria 2977858184 2977862222 306
492 iso_pu_bacteria 2989349275 2989354421 306
493 iso_pu_bacteria 2989771324 2989775102 306
494 iso_pu_bacteria 3005409236 3005412802 306
495 iso_pu_bacteria 3005416602 3005418139 306
496 iso_pu_bacteria 3005445848 3005451621 306
497 iso_pu_bacteria 3005452660 3005456714 306
498 iso_pu_bacteria 3005452660 3005458541 306
499 iso_pu_bacteria 639633055 639644966 306
500 iso_pu_bacteria 8002745576 8002748545 306
501 iso_pu_bacteria 8004445564 8004446137 306
502 iso_pu_bacteria 8004640170 8004643663 306
503 iso_pu_bacteria 8005301065 8005306204 306
504 iso_pu_bacteria 8005307578 8005307950 306
505 iso_pu_bacteria 8005314921 8005316581 306
506 iso_pu_bacteria 8005376324 8005379775 306
507 iso_pu_bacteria 8005460587 8005467185 306
508 iso_pu_bacteria 8005484373 8005487278 306
509 iso_pu_bacteria 8005542996 8005547457 306
510 iso_pu_bacteria 8005556819 8005562382 306
511 iso_pu_bacteria 8005563573 8005565544 306
512 iso_pu_bacteria 8005645114 8005651003 306
513 iso_pu_bacteria 8005658619 8005661333 306
514 iso_pu_bacteria 8005682033 8005683380 306
515 iso_pu_bacteria 8005688590 8005694098 306
516 iso_pu_bacteria 8018127388 8018132033 306
517 iso_pu_bacteria 8018163183 8018165481 306
518 iso_pu_bacteria 8023680758 8023688100 306
519 iso_pu_bacteria 8024479707 8024485063 306
520 iso_pu_bacteria 8055431914 8055435463 306
521 iso_pu_bacteria 8057132660 8057134304 306
522 iso_pu_bacteria 8057575449 8057576242 306
523 iso_pu_bacteria 8057874678 8057878037 306
524 3300002987 JGI25159J45721_1000169 JGI25159J45721_100016913 307
525 3300003354 JGI25160J50197_1000018 JGI25160J50197_1000018216 307
526 3300003374 JGI25161J50226_1000020 JGI25161J50226_100002013 307
527 3300003762 Ga0055542_1001656 Ga0055542_10016564 307
528 3300003763 Ga0055529_1005248 Ga0055529_10052481 307
529 3300004625 Ga0055543_1000004 Ga0055543_1000004217 307
530 3300005262 Ga0065165_1000429 Ga0065165_100042953 307
531 3300005327 Ga0070658_10114583 Ga0070658_101145833 307
532 3300005339 Ga0070660_100352792 Ga0070660_1003527921 307
533 3300005548 Ga0070665_100056042 Ga0070665_1000560425 307
534 3300006038 Ga0075365_10001834 Ga0075365_100018349 307
535 3300006038 Ga0075365_10076694 Ga0075365_100766942 307
536 3300006051 Ga0075364_10039739 Ga0075364_100397392 307
537 3300006051 Ga0075364_10042342 Ga0075364_100423423 307
538 3300006178 Ga0075367_10021668 Ga0075367_100216682 307
539 3300006178 Ga0075367_10221371 Ga0075367_102213711 307
540 3300006186 Ga0075369_10049672 Ga0075369_100496722 307
541 3300006353 Ga0075370_10035775 Ga0075370_100357751 307
542 3300009036 Ga0105244_10000695 Ga0105244_1000069517 307
543 3300009545 Ga0105237_10318639 Ga0105237_103186392 307
544 3300010375 Ga0105239_10045549 Ga0105239_100455496 307
545 3300010375 Ga0105239_10491146 Ga0105239_104911462 307
546 3300013104 Ga0157370_10317823 Ga0157370_103178231 307
547 3300013105 Ga0157369_10270404 Ga0157369_102704042 307
548 3300013296 Ga0157374_10332745 Ga0157374_103327452 307
549 3300013307 Ga0157372_10043514 Ga0157372_100435143 307
550 3300025254 Ga0209148_1000128 Ga0209148_1000128105 307
551 3300025272 Ga0209455_1000174 Ga0209455_100017474 307
552 3300025284 Ga0209130_1000035 Ga0209130_100003513 307
553 3300025302 Ga0207426_1000017 Ga0207426_100001713 307
554 3300025728 Ga0207655_1000069 Ga0207655_1000069129 307
555 3300025904 Ga0207647_10051642 Ga0207647_100516422 307
556 3300025909 Ga0207705_10026135 Ga0207705_100261353 307
557 3300025909 Ga0207705_10030752 Ga0207705_100307523 307
558 3300025911 Ga0207654_10057999 Ga0207654_100579991 307
559 3300025919 Ga0207657_10191206 Ga0207657_101912062 307
560 3300028379 Ga0268266_10128985 Ga0268266_101289852 307
561 3300028379 Ga0268266_10174480 Ga0268266_101744801 307
562 3300033180 Ga0307510_10173761 Ga0307510_101737612 307
563 3300048905 Ga0496102_0146839 Ga0496102_0146839_654_1610 307
564 3300048913 Ga0496110_0407367 Ga0496110_0407367_16_969 307
565 3300048915 Ga0496112_0173946 Ga0496112_0173946_658_1611 307
566 3300048919 Ga0496116_0001490 Ga0496116_0001490_22764_23708 307
567 3300048922 Ga0496119_0009697 Ga0496119_0009697_24_968 307
568 3300048923 Ga0496120_0000123 Ga0496120_0000123_55558_56502 307
569 3300048924 Ga0496121_0098908 Ga0496121_0098908_1086_2036 307
570 3300048927 Ga0496124_0002497 Ga0496124_0002497_14977_15921 307
571 3300050491 nmdc:mga00v17_21568_c1 nmdc:mga00v17_21568_c1_2173_3123 307
572 3300050491 nmdc:mga00v17_80258_c1 nmdc:mga00v17_80258_c1_865_1818 307
573 3300050494 nmdc:mga06z11_170292_c1 nmdc:mga06z11_170292_c1_179_1108 307
574 3300050516 nmdc:mga0sz30_74958_c1 nmdc:mga0sz30_74958_c1_25_954 307
575 iso_pu_bacteria 2588253730 2588517220 307
576 iso_pu_bacteria 2977986579 2977986834 307
577 3300003856 Ga0058692_1000710 Ga0058692_10007106 308
578 3300006051 Ga0075364_10041608 Ga0075364_100416083 308
579 3300009036 Ga0105244_10001298 Ga0105244_1000129814 308
580 3300009036 Ga0105244_10017656 Ga0105244_100176563 308
581 3300009092 Ga0105250_10000003 Ga0105250_10000003393 308
582 3300009092 Ga0105250_10008267 Ga0105250_100082673 308
583 3300013100 Ga0157373_10000219 Ga0157373_1000021920 308
584 3300013102 Ga0157371_10000823 Ga0157371_1000082315 308
585 3300013306 Ga0163162_10033092 Ga0163162_100330926 308
586 3300025711 Ga0207696_1000004 Ga0207696_1000004240 308
587 3300025711 Ga0207696_1000042 Ga0207696_1000042144 308
588 3300025728 Ga0207655_1009964 Ga0207655_10099642 308
589 3300025728 Ga0207655_1036050 Ga0207655_10360502 308
590 3300027312 Ga0209371_1001461 Ga0209371_10014617 308
591 3300030500 Ga0268256_1001246 Ga0268256_10012469 308
592 3300046458 Ga0495591_000007 Ga0495591_000007_34188_35135 308
593 3300046530 Ga0495654_0000007 Ga0495654_0000007_68477_69424 308
594 3300046616 Ga0495668_0030743 Ga0495668_0030743_1167_2114 308
595 3300046794 Ga0495589_0056607 Ga0495589_0056607_421_1374 308
596 3300048904 Ga0496101_0000083 Ga0496101_0000083_53096_54043 308
597 3300048920 Ga0496117_0051776 Ga0496117_0051776_286_1233 308
598 3300048921 Ga0496118_0087862 Ga0496118_0087862_239_1186 308
599 3300048923 Ga0496120_0001513 Ga0496120_0001513_14585_15532 308
600 3300048925 Ga0496122_0011506 Ga0496122_0011506_7653_8600 308
601 3300048926 Ga0496123_0003776 Ga0496123_0003776_14401_15348 308
602 3300048927 Ga0496124_0006816 Ga0496124_0006816_9280_10227 308
603 3300048927 Ga0496124_0011490 Ga0496124_0011490_2113_3060 308
604 3300048929 Ga0496126_0092580 Ga0496126_0092580_39_986 308
605 iso_pu_bacteria 2501025501 2501075609 308
606 iso_pu_bacteria 2501025504 2501407501 308
607 iso_pu_bacteria 2510917014 2511097373 308
608 iso_pu_bacteria 2510917015 2511105684 308
609 iso_pu_bacteria 2511231025 2511379524 308
610 iso_pu_bacteria 2511231035 2511434546 308
611 iso_pu_bacteria 2582581283 2585167139 308
612 iso_pu_bacteria 2643221689 2644498006 308
613 iso_pu_bacteria 2876601092 2876604185 308
614 iso_pu_bacteria 2883087390 2883089665 308
615 iso_pu_bacteria 2891670763 2891674444 308
616 iso_pu_bacteria 2904504865 2904505593 308
617 iso_pu_bacteria 2939602548 2939603270 308
618 iso_pu_bacteria 8016733728 8016735871 308
619 iso_pu_bacteria 8019499862 8019500730 308
620 3300039437 Ga0436365_0533423 Ga0436365_0533423_42_998 309
621 3300039437 Ga0436365_1270426 Ga0436365_1270426_808_1743 309
622 iso_pu_bacteria 2508501127 2509142523 309
623 iso_pu_bacteria 2513237305 2514421576 309
624 iso_pu_bacteria 2687453129 2687578390 309
625 iso_pu_bacteria 2721755686 2723575476 309
626 iso_pu_bacteria 2869162929 2869163760 309
627 iso_pu_bacteria 2882632389 2882636371 309
628 iso_pu_bacteria 2952252522 2952255710 309
629 iso_pu_bacteria 8055617313 8055619513 309
630 3300003215 JGI25153J46596_10000087 JGI25153J46596_1000008729 310
631 3300003794 Ga0055531_10010506 Ga0055531_100105064 310
632 3300005844 Ga0068862_100006734 Ga0068862_1000067347 310
633 3300009545 Ga0105237_10232524 Ga0105237_102325242 310
634 3300025297 Ga0209758_1000110 Ga0209758_100011069 310
635 3300025297 Ga0209758_1009156 Ga0209758_10091564 310
636 3300025303 Ga0209051_1039509 Ga0209051_10395092 310
637 3300025304 Ga0209257_1000376 Ga0209257_100037672 310
638 3300025925 Ga0207650_10001166 Ga0207650_100011666 310
639 3300028380 Ga0268265_10018412 Ga0268265_100184122 310
640 3300031235 Ga0265330_10038188 Ga0265330_100381882 310
641 3300031241 Ga0265325_10011321 Ga0265325_100113215 310
642 3300031456 Ga0307513_10271364 Ga0307513_102713642 310
643 3300046454 Ga0495592_0033250 Ga0495592_0033250_2412_3371 310
644 3300046459 Ga0495629_0048188 Ga0495629_0048188_1063_2022 310
645 3300046460 Ga0495638_0000255 Ga0495638_0000255_53334_54290 310
646 3300046462 Ga0495651_0045985 Ga0495651_0045985_1579_2538 310
647 3300046476 Ga0495662_0063546 Ga0495662_0063546_323_1282 310
648 3300046492 Ga0495585_0005063 Ga0495585_0005063_2185_3141 310
649 3300046506 Ga0495583_0019629 Ga0495583_0019629_945_1880 310
650 3300046507 Ga0495606_0011198 Ga0495606_0011198_2407_3360 310
651 3300046514 Ga0495618_0050514 Ga0495618_0050514_850_1809 310
652 3300046536 Ga0495587_0016718 Ga0495587_0016718_1983_2942 310
653 3300046660 Ga0495625_0015345 Ga0495625_0015345_4775_5731 310
654 3300046663 Ga0495635_0028276 Ga0495635_0028276_2198_3157 310
655 3300046674 Ga0495588_0020295 Ga0495588_0020295_2087_3046 310
656 3300046675 Ga0495657_0003107 Ga0495657_0003107_7855_8814 310
657 3300046691 Ga0495670_0095956 Ga0495670_0095956_56_1012 310
658 3300046809 Ga0495600_0006506 Ga0495600_0006506_1878_2837 310
659 3300047317 Ga0495604_0005585 Ga0495604_0005585_2329_3288 310
660 3300047320 Ga0495672_0011579 Ga0495672_0011579_3373_4329 310
661 3300047472 Ga0495686_0000090 Ga0495686_0000090_118616_119569 310
662 3300047472 Ga0495686_0008679 Ga0495686_0008679_3833_4786 310
663 3300048924 Ga0496121_0027101 Ga0496121_0027101_2989_3942 310
664 3300049459 Ga0495678_033358 Ga0495678_033358_541_1497 310
665 3300053093 Ga0500651_0005532 Ga0500651_0005532_2671_3612 310
666 3300053103 Ga0500555_005923 Ga0500555_005923_850_1791 310
667 3300053104 Ga0500556_0071632 Ga0500556_0071632_32_967 310
668 3300053130 Ga0500642_0002456 Ga0500642_0002456_3732_4694 310
669 3300053134 Ga0500658_0034412 Ga0500658_0034412_460_1422 310
670 3300053139 Ga0500568_0000119 Ga0500568_0000119_19655_20611 310
671 3300053148 Ga0500590_005028 Ga0500590_005028_2370_3329 310
672 3300053153 Ga0500616_0001232 Ga0500616_0001232_19679_20635 310
673 3300053153 Ga0500616_0023591 Ga0500616_0023591_44_1006 310
674 3300053158 Ga0500627_0037871 Ga0500627_0037871_1000_1956 310
675 iso_pu_bacteria 8024486573 8024487425 311
676 iso_pu_bacteria 2883821847 2883824473 317
677 iso_pu_bacteria 2848551377 2848553917 318
678 iso_pu_bacteria 2945968032 2945970511 318
679 iso_pu_bacteria 2852646457 2852647531 321
680 3300000549 LJQas_1000155 LJQas_10001558 328

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

25

282

0.96

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

22

271

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ry0-assembly1.cif.gz_A crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose 0.9895 39 327
4ry0-assembly1.cif.gz_A crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose 0.9826 39 327
7qsp-assembly1.cif.gz_A permutated c-terminal lobe of the ribose binding protein from thermotoga maritima 0.9824 162 252
2ioy-assembly2.cif.gz_B crystal structure of thermoanaerobacter tengcongensis ribose binding protein 0.9759 40 317
1drk-assembly1.cif.gz_A probing protein-protein interactions: the ribose-binding protein in bacterial transport and chemotaxis 0.9722 40 313
ID Description Score Start End Superfamily
2fn9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.986 41 139 3.40.50.2300
5ibqA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9839 143 327 3.40.50.2300
5ibqA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9776 143 327 3.40.50.2300
1dbpA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9755 141 276 3.40.50.2300
af_P02925_131_294_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9638 147 312 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3S1Z5X0-F1-model_v4 D-ribose ABC transporter substrate-binding protein 0.984 119 328 GO:0030246
GO:0030313
AF-A0A5F2HWL8-F1-model_v4 D-ribose ABC transporter substrate-binding protein 0.9814 96 204 GO:0030246
GO:0030313
AF-A0A3S1Z5X0-F1-model_v4 D-ribose ABC transporter substrate-binding protein 0.9747 119 328 GO:0030246
GO:0030313
AF-A0A5F2HWL8-F1-model_v4 D-ribose ABC transporter substrate-binding protein 0.9726 96 204 GO:0030246
GO:0030313
AF-A0A644TMP6-F1-model_v4 Ribose import binding protein RbsB 0.9633 40 313 GO:0030246
GO:0030313

Feature Viewer

pLDDT pTM Quality
90.32 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map