F474808
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 680 | 242 | 679 | 280 |
Family's Representative Sequence
| Representative Sequence | 3300049669|Ga0501235_016889|Ga0501235_016889_461_1393 |
| Length | 310 |
| Sequence | LKLFIDAKLMSEKATKSKETKTPPPPTSKVHLVFQEADVAVLTGAIELDETLQGEVIQIKDDYAVGPIENIFDAEGWQQRKQWWTNLLQQSPYNVELSDMIDDRMTVHNLKKRLDENEREEVWIWMGQNAHDVCGYYWLISQLKDYQGRVQVLYMNNLPFINEKGQLFYPTQLHEIQPKEFIKAKKLCRKVTLSEFEIDPDEWKRLAGENSMVRILEGGKKIASKGEDFYDADVLKGLTNEWQKGNKAMNSILSKMKIKTGDVFLLERMKRLAEEGRIEINGDTSKSWKDFEVKLKSAAPAEAPAEQPNM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 2 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 96 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 150 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 151 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 152 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 153 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 154 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 156 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 157 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 158 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 159 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 160 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 161 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 162 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 163 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 164 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 165 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 166 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 167 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 168 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 169 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 170 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 171 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 172 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 173 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 174 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 175 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 176 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 177 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 178 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 179 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 196 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 197 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 198 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 213 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 214 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 215 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 216 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 217 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 218 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 219 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 220 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 221 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 222 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 223 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 228 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 235 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 236 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 237 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 238 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 239 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 240 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 241 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 242 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.71 |
| Metatranscriptomes | 0 |
| Isolates | 0.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.91 |
| Nodule | 0 |
| Rhizoplane | 0.88 |
| Rhizosphere | 94.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1023873 | 3300001904 | Bacteria | 955 |
| 2 | rootH1_10107000 | 3300003316 | Bacteria | 2394 |
| 3 | rootH2_10074975 | 3300003320 | Bacteria | 4771 |
| 4 | rootH2_10169461 | 3300003320 | Bacteria | 1419 |
| 5 | rootH2_10232842 | 3300003320 | Bacteria | 1145 |
| 6 | rootH1_10000226 | 3300003316 | Bacteria | 5709 |
| 7 | rootH1_10000226 | 3300003323 | Bacteria | 32201 |
| 8 | rootH1_10285025 | 3300003323 | Bacteria | 1413 |
| 9 | rootH1_10328002 | 3300003323 | Bacteria | 1219 |
| 10 | JGI25160J50197_1003244 | 3300003354 | Bacteria | 7338 |
| 11 | Ga0065712_10006615 | 3300005290 | Bacteria | 3599 |
| 12 | Ga0065712_10072296 | 3300005290 | Bacteria | 4820 |
| 13 | Ga0070658_10013559 | 3300005327 | Bacteria | 6539 |
| 14 | Ga0070658_10171275 | 3300005327 | Bacteria | 1824 |
| 15 | Ga0070676_10004711 | 3300005328 | Bacteria | 7211 |
| 16 | Ga0070676_10006331 | 3300005328 | Bacteria | 6323 |
| 17 | Ga0070676_10040532 | 3300005328 | Bacteria | 2697 |
| 18 | Ga0070676_10160381 | 3300005328 | Bacteria | 1447 |
| 19 | Ga0070683_100014205 | 3300005329 | Bacteria | 6958 |
| 20 | Ga0070683_100031603 | 3300005329 | Bacteria | 4816 |
| 21 | Ga0070683_100047223 | 3300005329 | Bacteria | 3978 |
| 22 | Ga0070683_100126527 | 3300005329 | Bacteria | 2416 |
| 23 | Ga0070683_100288413 | 3300005329 | Bacteria | 1561 |
| 24 | Ga0070690_100025223 | 3300005330 | Bacteria | 3660 |
| 25 | Ga0070690_100062408 | 3300005330 | Bacteria | 2403 |
| 26 | Ga0070690_100126875 | 3300005330 | Unclassified | 1719 |
| 27 | Ga0070690_100366416 | 3300005330 | Bacteria | 1050 |
| 28 | Ga0070670_100023151 | 3300005331 | Bacteria | 5347 |
| 29 | Ga0070670_100033756 | 3300005331 | Bacteria | 4406 |
| 30 | Ga0070670_100035528 | 3300005331 | Bacteria | 4290 |
| 31 | Ga0070670_100063227 | 3300005331 | Bacteria | 3176 |
| 32 | Ga0070670_100099753 | 3300005331 | Bacteria | 2499 |
| 33 | Ga0070670_100119011 | 3300005331 | Unclassified | 2278 |
| 34 | Ga0070670_100169303 | 3300005331 | Bacteria | 1895 |
| 35 | Ga0068869_100005339 | 3300005334 | Bacteria | 8078 |
| 36 | Ga0068869_100006131 | 3300005334 | Bacteria | 7608 |
| 37 | Ga0068869_100012054 | 3300005334 | Bacteria | 5696 |
| 38 | Ga0068869_100016147 | 3300005334 | Bacteria | 5029 |
| 39 | Ga0068869_100034741 | 3300005334 | Bacteria | 3569 |
| 40 | Ga0068869_100054583 | 3300005334 | Bacteria | 2909 |
| 41 | Ga0068869_100143079 | 3300005334 | Bacteria | 1849 |
| 42 | Ga0068869_100265061 | 3300005334 | Bacteria | 1376 |
| 43 | Ga0070666_10000028 | 3300005335 | Bacteria | 144796 |
| 44 | Ga0070666_10019854 | 3300005335 | Bacteria | 4341 |
| 45 | Ga0070666_10020881 | 3300005335 | Bacteria | 4238 |
| 46 | Ga0070666_10048345 | 3300005335 | Bacteria | 2858 |
| 47 | Ga0070680_100082093 | 3300005336 | Bacteria | 2660 |
| 48 | Ga0070682_100070032 | 3300005337 | Bacteria | 2241 |
| 49 | Ga0070682_100286152 | 3300005337 | Bacteria | 1204 |
| 50 | Ga0068868_100024389 | 3300005338 | Bacteria | 4588 |
| 51 | Ga0068868_100110032 | 3300005338 | Bacteria | 2238 |
| 52 | Ga0068868_100115247 | 3300005338 | Bacteria | 2187 |
| 53 | Ga0068868_100133645 | 3300005338 | Bacteria | 2032 |
| 54 | Ga0068868_100169887 | 3300005338 | Bacteria | 1805 |
| 55 | Ga0070660_100048594 | 3300005339 | Bacteria | 3259 |
| 56 | Ga0070660_100130723 | 3300005339 | Unclassified | 2009 |
| 57 | Ga0070689_100006441 | 3300005340 | Bacteria | 8122 |
| 58 | Ga0070689_100010609 | 3300005340 | Bacteria | 6568 |
| 59 | Ga0070689_100062711 | 3300005340 | Bacteria | 2893 |
| 60 | Ga0070689_100375511 | 3300005340 | Bacteria | 1197 |
| 61 | Ga0070687_100057013 | 3300005343 | Bacteria | 2047 |
| 62 | Ga0070661_100008379 | 3300005344 | Bacteria | 7142 |
| 63 | Ga0070661_100104499 | 3300005344 | Bacteria | 2110 |
| 64 | Ga0070668_100010902 | 3300005347 | Bacteria | 6764 |
| 65 | Ga0070668_100053460 | 3300005347 | Bacteria | 3115 |
| 66 | Ga0070669_100015799 | 3300005353 | Bacteria | 5383 |
| 67 | Ga0070669_100205981 | 3300005353 | Bacteria | 1550 |
| 68 | Ga0070675_100022437 | 3300005354 | Bacteria | 5044 |
| 69 | Ga0070675_100037894 | 3300005354 | Bacteria | 3929 |
| 70 | Ga0070675_100074350 | 3300005354 | Bacteria | 2823 |
| 71 | Ga0070675_100099838 | 3300005354 | Bacteria | 2444 |
| 72 | Ga0070671_100025128 | 3300005355 | Bacteria | 4884 |
| 73 | Ga0070671_100116570 | 3300005355 | Bacteria | 2245 |
| 74 | Ga0070671_100129556 | 3300005355 | Bacteria | 2125 |
| 75 | Ga0070671_100180631 | 3300005355 | Bacteria | 1786 |
| 76 | Ga0070671_100228079 | 3300005355 | Bacteria | 1580 |
| 77 | Ga0070671_100263296 | 3300005355 | Bacteria | 1465 |
| 78 | Ga0070671_100317093 | 3300005355 | Bacteria | 1328 |
| 79 | Ga0070671_100345397 | 3300005355 | Bacteria | 1270 |
| 80 | Ga0070671_100645111 | 3300005355 | Bacteria | 916 |
| 81 | Ga0070674_100083880 | 3300005356 | Bacteria | 2283 |
| 82 | Ga0070674_100203555 | 3300005356 | Bacteria | 1530 |
| 83 | Ga0070674_100543509 | 3300005356 | Bacteria | 974 |
| 84 | Ga0070673_100030366 | 3300005364 | Bacteria | 4043 |
| 85 | Ga0070673_100065354 | 3300005364 | Bacteria | 2901 |
| 86 | Ga0070673_100088441 | 3300005364 | Bacteria | 2527 |
| 87 | Ga0070688_100007912 | 3300005365 | Bacteria | 5748 |
| 88 | Ga0070688_100173091 | 3300005365 | Bacteria | 1492 |
| 89 | Ga0070688_100290393 | 3300005365 | Bacteria | 1178 |
| 90 | Ga0070688_100387685 | 3300005365 | Bacteria | 1031 |
| 91 | Ga0070659_100005013 | 3300005366 | Bacteria | 9493 |
| 92 | Ga0070659_100108695 | 3300005366 | Bacteria | 2238 |
| 93 | Ga0070667_100008264 | 3300005367 | Bacteria | 8626 |
| 94 | Ga0070667_100008748 | 3300005367 | Bacteria | 8391 |
| 95 | Ga0070667_100011426 | 3300005367 | Bacteria | 7342 |
| 96 | Ga0070667_100034699 | 3300005367 | Bacteria | 4223 |
| 97 | Ga0070667_100157916 | 3300005367 | Bacteria | 1996 |
| 98 | Ga0070705_100198925 | 3300005440 | Bacteria | 1372 |
| 99 | Ga0070700_100239671 | 3300005441 | Bacteria | 1295 |
| 100 | Ga0070700_100247643 | 3300005441 | Bacteria | 1277 |
| 101 | Ga0070678_100015390 | 3300005456 | Bacteria | 4861 |
| 102 | Ga0070678_100136826 | 3300005456 | Bacteria | 1954 |
| 103 | Ga0070662_100019599 | 3300005457 | Bacteria | 4594 |
| 104 | Ga0070662_100087690 | 3300005457 | Bacteria | 2330 |
| 105 | Ga0070662_100097819 | 3300005457 | Bacteria | 2215 |
| 106 | Ga0070681_10063001 | 3300005458 | Bacteria | 3681 |
| 107 | Ga0070681_10078745 | 3300005458 | Bacteria | 3253 |
| 108 | Ga0070681_10257096 | 3300005458 | Bacteria | 1658 |
| 109 | Ga0068867_100015133 | 3300005459 | Bacteria | 5471 |
| 110 | Ga0068867_100032598 | 3300005459 | Bacteria | 3769 |
| 111 | Ga0068867_100077353 | 3300005459 | Bacteria | 2500 |
| 112 | Ga0068867_100114404 | 3300005459 | Bacteria | 2077 |
| 113 | Ga0068867_100320104 | 3300005459 | Bacteria | 1285 |
| 114 | Ga0068867_100443321 | 3300005459 | Bacteria | 1104 |
| 115 | Ga0070685_10002168 | 3300005466 | Bacteria | 10124 |
| 116 | Ga0070685_10052610 | 3300005466 | Bacteria | 2357 |
| 117 | Ga0070685_10107765 | 3300005466 | Unclassified | 1711 |
| 118 | Ga0070685_10324846 | 3300005466 | Bacteria | 1044 |
| 119 | Ga0070698_100002002 | 3300005471 | Bacteria | 22614 |
| 120 | Ga0070698_100035409 | 3300005471 | Bacteria | 5163 |
| 121 | Ga0070698_100112108 | 3300005471 | Bacteria | 2693 |
| 122 | Ga0070699_100106128 | 3300005518 | Bacteria | 2464 |
| 123 | Ga0070679_100000775 | 3300005530 | Bacteria | 27764 |
| 124 | Ga0070679_100403672 | 3300005530 | Bacteria | 1312 |
| 125 | Ga0070684_100004295 | 3300005535 | Bacteria | 10813 |
| 126 | Ga0070684_100012723 | 3300005535 | Bacteria | 6754 |
| 127 | Ga0070684_100324587 | 3300005535 | Bacteria | 1414 |
| 128 | Ga0068853_100029228 | 3300005539 | Bacteria | 4644 |
| 129 | Ga0068853_100090821 | 3300005539 | Bacteria | 2684 |
| 130 | Ga0068853_100422376 | 3300005539 | Bacteria | 1250 |
| 131 | Ga0070672_100024199 | 3300005543 | Bacteria | 4484 |
| 132 | Ga0070672_100084098 | 3300005543 | Bacteria | 2555 |
| 133 | Ga0070672_100091837 | 3300005543 | Bacteria | 2450 |
| 134 | Ga0070672_100159067 | 3300005543 | Bacteria | 1873 |
| 135 | Ga0070672_100218344 | 3300005543 | Bacteria | 1598 |
| 136 | Ga0070665_100009957 | 3300005548 | Bacteria | 9616 |
| 137 | Ga0068855_100169778 | 3300005563 | Bacteria | 2471 |
| 138 | Ga0070664_100016835 | 3300005564 | Bacteria | 6000 |
| 139 | Ga0070664_100030899 | 3300005564 | Bacteria | 4471 |
| 140 | Ga0070664_100080284 | 3300005564 | Bacteria | 2809 |
| 141 | Ga0070664_100108317 | 3300005564 | Bacteria | 2423 |
| 142 | Ga0070664_100161286 | 3300005564 | Bacteria | 1984 |
| 143 | Ga0068857_100014588 | 3300005577 | Bacteria | 6855 |
| 144 | Ga0068857_100125079 | 3300005577 | Bacteria | 2317 |
| 145 | Ga0068857_100388996 | 3300005577 | Bacteria | 1296 |
| 146 | Ga0068854_100013207 | 3300005578 | Bacteria | 5412 |
| 147 | Ga0068854_100134910 | 3300005578 | Bacteria | 1889 |
| 148 | Ga0068854_100169592 | 3300005578 | Unclassified | 1697 |
| 149 | Ga0068852_100000704 | 3300005616 | Bacteria | 21853 |
| 150 | Ga0068852_100004128 | 3300005616 | Bacteria | 10225 |
| 151 | Ga0068852_100124099 | 3300005616 | Bacteria | 2368 |
| 152 | Ga0068852_100198651 | 3300005616 | Bacteria | 1897 |
| 153 | Ga0068852_100310537 | 3300005616 | Bacteria | 1529 |
| 154 | Ga0068859_100000012 | 3300005617 | Bacteria | 300376 |
| 155 | Ga0068859_100022888 | 3300005617 | Bacteria | 6265 |
| 156 | Ga0068859_100087754 | 3300005617 | Unclassified | 3159 |
| 157 | Ga0068859_100134474 | 3300005617 | Bacteria | 2544 |
| 158 | Ga0068859_100189514 | 3300005617 | Bacteria | 2141 |
| 159 | Ga0068859_100217364 | 3300005617 | Bacteria | 1999 |
| 160 | Ga0068859_100313876 | 3300005617 | Bacteria | 1661 |
| 161 | Ga0068859_100405572 | 3300005617 | Bacteria | 1459 |
| 162 | Ga0068864_100004494 | 3300005618 | Bacteria | 11474 |
| 163 | Ga0068864_100011567 | 3300005618 | Bacteria | 7288 |
| 164 | Ga0068864_100221115 | 3300005618 | Bacteria | 1747 |
| 165 | Ga0068864_100385602 | 3300005618 | Bacteria | 1329 |
| 166 | Ga0068866_10053518 | 3300005718 | Bacteria | 2064 |
| 167 | Ga0068861_100004190 | 3300005719 | Bacteria | 9669 |
| 168 | Ga0068861_100333556 | 3300005719 | Bacteria | 1325 |
| 169 | Ga0068861_100485522 | 3300005719 | Bacteria | 1114 |
| 170 | Ga0068861_100737724 | 3300005719 | Bacteria | 919 |
| 171 | Ga0068851_10134010 | 3300005834 | Bacteria | 1342 |
| 172 | Ga0068851_10143706 | 3300005834 | Bacteria | 1299 |
| 173 | Ga0068863_100001512 | 3300005841 | Bacteria | 22973 |
| 174 | Ga0068863_100012212 | 3300005841 | Bacteria | 8295 |
| 175 | Ga0068863_100024031 | 3300005841 | Bacteria | 5816 |
| 176 | Ga0068863_100045074 | 3300005841 | Bacteria | 4185 |
| 177 | Ga0068863_100048701 | 3300005841 | Bacteria | 4018 |
| 178 | Ga0068863_100074658 | 3300005841 | Bacteria | 3208 |
| 179 | Ga0068863_100213815 | 3300005841 | Bacteria | 1857 |
| 180 | Ga0068863_100329996 | 3300005841 | Bacteria | 1483 |
| 181 | Ga0068863_100518719 | 3300005841 | Bacteria | 1175 |
| 182 | Ga0068863_100549508 | 3300005841 | Bacteria | 1140 |
| 183 | Ga0068858_100002978 | 3300005842 | Bacteria | 16996 |
| 184 | Ga0068858_100011998 | 3300005842 | Bacteria | 8168 |
| 185 | Ga0068858_100318253 | 3300005842 | Bacteria | 1486 |
| 186 | Ga0068860_100002797 | 3300005843 | Bacteria | 18148 |
| 187 | Ga0068860_100003548 | 3300005843 | Bacteria | 16042 |
| 188 | Ga0068860_100032839 | 3300005843 | Bacteria | 4985 |
| 189 | Ga0068860_100100892 | 3300005843 | Bacteria | 2754 |
| 190 | Ga0068860_100355876 | 3300005843 | Bacteria | 1442 |
| 191 | Ga0068862_100024052 | 3300005844 | Bacteria | 5107 |
| 192 | Ga0068862_100071715 | 3300005844 | Bacteria | 2991 |
| 193 | Ga0068862_100123684 | 3300005844 | Bacteria | 2282 |
| 194 | Ga0068862_100253057 | 3300005844 | Bacteria | 1606 |
| 195 | Ga0068862_100282414 | 3300005844 | Bacteria | 1522 |
| 196 | Ga0075366_10009549 | 3300006195 | Bacteria | 5419 |
| 197 | Ga0097621_100001409 | 3300006237 | Bacteria | 16566 |
| 198 | Ga0097621_100002163 | 3300006237 | Bacteria | 13450 |
| 199 | Ga0097621_100016881 | 3300006237 | Bacteria | 5532 |
| 200 | Ga0097621_100457072 | 3300006237 | Bacteria | 1151 |
| 201 | Ga0068871_100013859 | 3300006358 | Bacteria | 5994 |
| 202 | Ga0068871_100019444 | 3300006358 | Bacteria | 5185 |
| 203 | Ga0068871_100026349 | 3300006358 | Bacteria | 4535 |
| 204 | Ga0068871_100030255 | 3300006358 | Bacteria | 4262 |
| 205 | Ga0068871_100155161 | 3300006358 | Bacteria | 1955 |
| 206 | Ga0068871_100180271 | 3300006358 | Bacteria | 1815 |
| 207 | Ga0068871_100339752 | 3300006358 | Bacteria | 1326 |
| 208 | Ga0068871_100390039 | 3300006358 | Bacteria | 1238 |
| 209 | Ga0068871_100538224 | 3300006358 | Bacteria | 1056 |
| 210 | Ga0075428_100022471 | 3300006844 | Bacteria | 6985 |
| 211 | Ga0075428_100032601 | 3300006844 | Bacteria | 5754 |
| 212 | Ga0075428_100214831 | 3300006844 | Bacteria | 2078 |
| 213 | Ga0075430_100002260 | 3300006846 | Bacteria | 15962 |
| 214 | Ga0075430_100059017 | 3300006846 | Bacteria | 3225 |
| 215 | Ga0075431_100008390 | 3300006847 | Bacteria | 10338 |
| 216 | Ga0075429_100003601 | 3300006880 | Bacteria | 13205 |
| 217 | Ga0075429_100032473 | 3300006880 | Bacteria | 4537 |
| 218 | Ga0075429_100174503 | 3300006880 | Bacteria | 1883 |
| 219 | Ga0068865_100008908 | 3300006881 | Bacteria | 6206 |
| 220 | Ga0068865_100017895 | 3300006881 | Bacteria | 4564 |
| 221 | Ga0068865_100019539 | 3300006881 | Bacteria | 4385 |
| 222 | Ga0068865_100117880 | 3300006881 | Unclassified | 1969 |
| 223 | Ga0068865_100165884 | 3300006881 | Bacteria | 1689 |
| 224 | Ga0068865_100385459 | 3300006881 | Bacteria | 1144 |
| 225 | Ga0097620_100000012 | 3300006931 | Bacteria | 300376 |
| 226 | Ga0097620_100022888 | 3300006931 | Bacteria | 6265 |
| 227 | Ga0097620_100087759 | 3300006931 | Unclassified | 3159 |
| 228 | Ga0097620_100134478 | 3300006931 | Bacteria | 2544 |
| 229 | Ga0097620_100189514 | 3300006931 | Bacteria | 2141 |
| 230 | Ga0097620_100217370 | 3300006931 | Bacteria | 1999 |
| 231 | Ga0097620_100313910 | 3300006931 | Bacteria | 1661 |
| 232 | Ga0097620_100405590 | 3300006931 | Bacteria | 1459 |
| 233 | Ga0111539_10083796 | 3300009094 | Bacteria | 3749 |
| 234 | Ga0111539_10117098 | 3300009094 | Bacteria | 3123 |
| 235 | Ga0105247_10003345 | 3300009101 | Bacteria | 10493 |
| 236 | Ga0105247_10006796 | 3300009101 | Bacteria | 7054 |
| 237 | Ga0114129_10030026 | 3300009147 | Bacteria | 7696 |
| 238 | Ga0114129_10109610 | 3300009147 | Bacteria | 3811 |
| 239 | Ga0105243_10296311 | 3300009148 | Bacteria | 1464 |
| 240 | Ga0105241_10004934 | 3300009174 | Bacteria | 9837 |
| 241 | Ga0105241_10114009 | 3300009174 | Bacteria | 2167 |
| 242 | Ga0105241_10678953 | 3300009174 | Bacteria | 938 |
| 243 | Ga0105242_10023180 | 3300009176 | Bacteria | 4894 |
| 244 | Ga0105242_10103667 | 3300009176 | Bacteria | 2414 |
| 245 | Ga0105242_10118442 | 3300009176 | Bacteria | 2268 |
| 246 | Ga0105242_10119089 | 3300009176 | Bacteria | 2263 |
| 247 | Ga0105242_10312405 | 3300009176 | Bacteria | 1439 |
| 248 | Ga0105248_10042644 | 3300009177 | Bacteria | 5089 |
| 249 | Ga0105237_10004851 | 3300009545 | Bacteria | 15445 |
| 250 | Ga0105237_10021415 | 3300009545 | Bacteria | 6647 |
| 251 | Ga0105237_10129647 | 3300009545 | Bacteria | 2516 |
| 252 | Ga0105237_10163055 | 3300009545 | Bacteria | 2228 |
| 253 | Ga0105237_10179045 | 3300009545 | Bacteria | 2120 |
| 254 | Ga0105249_10000420 | 3300009553 | Bacteria | 40445 |
| 255 | Ga0105249_10002025 | 3300009553 | Bacteria | 17583 |
| 256 | Ga0105249_10007898 | 3300009553 | Bacteria | 9271 |
| 257 | Ga0105249_10025382 | 3300009553 | Bacteria | 5334 |
| 258 | Ga0105249_10049524 | 3300009553 | Bacteria | 3831 |
| 259 | Ga0105249_10087231 | 3300009553 | Bacteria | 2911 |
| 260 | Ga0105249_10095957 | 3300009553 | Bacteria | 2781 |
| 261 | Ga0105249_10204349 | 3300009553 | Bacteria | 1935 |
| 262 | Ga0105249_10224267 | 3300009553 | Bacteria | 1851 |
| 263 | Ga0105239_10019699 | 3300010375 | Bacteria | 7446 |
| 264 | Ga0105246_10014260 | 3300011119 | Bacteria | 4996 |
| 265 | Ga0105246_10101038 | 3300011119 | Bacteria | 2100 |
| 266 | Ga0105246_10110369 | 3300011119 | Bacteria | 2020 |
| 267 | Ga0157373_10002524 | 3300013100 | Bacteria | 13931 |
| 268 | Ga0157373_10024191 | 3300013100 | Bacteria | 4401 |
| 269 | Ga0157373_10087139 | 3300013100 | Bacteria | 2200 |
| 270 | Ga0157373_10121441 | 3300013100 | Bacteria | 1836 |
| 271 | Ga0157373_10200126 | 3300013100 | Bacteria | 1408 |
| 272 | Ga0157371_10001703 | 3300013102 | Bacteria | 22394 |
| 273 | Ga0157371_10028726 | 3300013102 | Bacteria | 4025 |
| 274 | Ga0157371_10028910 | 3300013102 | Bacteria | 4013 |
| 275 | Ga0157371_10058825 | 3300013102 | Unclassified | 2726 |
| 276 | Ga0157371_10061575 | 3300013102 | Bacteria | 2660 |
| 277 | Ga0157371_10201140 | 3300013102 | Bacteria | 1428 |
| 278 | Ga0157371_10264705 | 3300013102 | Bacteria | 1240 |
| 279 | Ga0157370_10008487 | 3300013104 | Bacteria | 11082 |
| 280 | Ga0157370_10160908 | 3300013104 | Bacteria | 2089 |
| 281 | Ga0157370_10311856 | 3300013104 | Bacteria | 1451 |
| 282 | Ga0157370_10314425 | 3300013104 | Bacteria | 1445 |
| 283 | Ga0157370_10408724 | 3300013104 | Bacteria | 1249 |
| 284 | Ga0157370_10412029 | 3300013104 | Bacteria | 1243 |
| 285 | Ga0157369_10015500 | 3300013105 | Bacteria | 8589 |
| 286 | Ga0157369_10065596 | 3300013105 | Bacteria | 3907 |
| 287 | Ga0157369_10075048 | 3300013105 | Bacteria | 3626 |
| 288 | Ga0157369_10171175 | 3300013105 | Bacteria | 2288 |
| 289 | Ga0157369_10337435 | 3300013105 | Bacteria | 1566 |
| 290 | Ga0157374_10012894 | 3300013296 | Bacteria | 7281 |
| 291 | Ga0157374_10063447 | 3300013296 | Bacteria | 3465 |
| 292 | Ga0157374_10101119 | 3300013296 | Unclassified | 2764 |
| 293 | Ga0157374_10125421 | 3300013296 | Bacteria | 2482 |
| 294 | Ga0157374_10137814 | 3300013296 | Bacteria | 2367 |
| 295 | Ga0157378_10009231 | 3300013297 | Bacteria | 8591 |
| 296 | Ga0157378_10024651 | 3300013297 | Bacteria | 5296 |
| 297 | Ga0157378_10035213 | 3300013297 | Bacteria | 4428 |
| 298 | Ga0157378_10059212 | 3300013297 | Bacteria | 3417 |
| 299 | Ga0157378_10062316 | 3300013297 | Bacteria | 3330 |
| 300 | Ga0157378_10067025 | 3300013297 | Bacteria | 3216 |
| 301 | Ga0157378_10315552 | 3300013297 | Bacteria | 1517 |
| 302 | Ga0157378_10337058 | 3300013297 | Bacteria | 1469 |
| 303 | Ga0163162_10000634 | 3300013306 | Bacteria | 32545 |
| 304 | Ga0163162_10002367 | 3300013306 | Bacteria | 17719 |
| 305 | Ga0163162_10005072 | 3300013306 | Bacteria | 12692 |
| 306 | Ga0163162_10005374 | 3300013306 | Bacteria | 12369 |
| 307 | Ga0163162_10008613 | 3300013306 | Bacteria | 9941 |
| 308 | Ga0163162_10084029 | 3300013306 | Bacteria | 3258 |
| 309 | Ga0163162_10266675 | 3300013306 | Bacteria | 1844 |
| 310 | Ga0163162_10473031 | 3300013306 | Bacteria | 1385 |
| 311 | Ga0163162_10618616 | 3300013306 | Unclassified | 1208 |
| 312 | Ga0157372_10001143 | 3300013307 | Bacteria | 28799 |
| 313 | Ga0157372_10077473 | 3300013307 | Bacteria | 3755 |
| 314 | Ga0157372_10080354 | 3300013307 | Bacteria | 3688 |
| 315 | Ga0157372_10136851 | 3300013307 | Bacteria | 2821 |
| 316 | Ga0157372_10159166 | 3300013307 | Bacteria | 2609 |
| 317 | Ga0157372_10207862 | 3300013307 | Bacteria | 2268 |
| 318 | Ga0157372_10212140 | 3300013307 | Bacteria | 2244 |
| 319 | Ga0157372_10267939 | 3300013307 | Bacteria | 1984 |
| 320 | Ga0157372_10328134 | 3300013307 | Bacteria | 1782 |
| 321 | Ga0157372_10488223 | 3300013307 | Bacteria | 1436 |
| 322 | Ga0157372_10494275 | 3300013307 | Bacteria | 1426 |
| 323 | Ga0157372_10574450 | 3300013307 | Bacteria | 1314 |
| 324 | Ga0157372_10919942 | 3300013307 | Bacteria | 1014 |
| 325 | Ga0157375_10001279 | 3300013308 | Bacteria | 21720 |
| 326 | Ga0157375_10004004 | 3300013308 | Bacteria | 12781 |
| 327 | Ga0157375_10009214 | 3300013308 | Bacteria | 8658 |
| 328 | Ga0157375_10012122 | 3300013308 | Bacteria | 7639 |
| 329 | Ga0157375_10013890 | 3300013308 | Bacteria | 7180 |
| 330 | Ga0157375_10037185 | 3300013308 | Bacteria | 4663 |
| 331 | Ga0157375_10085652 | 3300013308 | Bacteria | 3201 |
| 332 | Ga0157375_10153406 | 3300013308 | Bacteria | 2440 |
| 333 | Ga0157375_10173340 | 3300013308 | Bacteria | 2306 |
| 334 | Ga0157375_10342348 | 3300013308 | Unclassified | 1661 |
| 335 | Ga0157375_10457868 | 3300013308 | Bacteria | 1441 |
| 336 | Ga0157375_10485630 | 3300013308 | Bacteria | 1400 |
| 337 | Ga0163163_10003016 | 3300014325 | Bacteria | 14258 |
| 338 | Ga0163163_10004016 | 3300014325 | Bacteria | 12551 |
| 339 | Ga0163163_10013222 | 3300014325 | Bacteria | 7547 |
| 340 | Ga0163163_10024119 | 3300014325 | Bacteria | 5787 |
| 341 | Ga0163163_10035462 | 3300014325 | Bacteria | 4839 |
| 342 | Ga0163163_10178049 | 3300014325 | Bacteria | 2173 |
| 343 | Ga0163163_10302512 | 3300014325 | Bacteria | 1652 |
| 344 | Ga0163163_10333792 | 3300014325 | Bacteria | 1571 |
| 345 | Ga0163163_10569004 | 3300014325 | Bacteria | 1196 |
| 346 | Ga0163163_10599474 | 3300014325 | Bacteria | 1165 |
| 347 | Ga0157380_10001753 | 3300014326 | Bacteria | 14320 |
| 348 | Ga0157380_10020060 | 3300014326 | Bacteria | 4992 |
| 349 | Ga0157380_10025932 | 3300014326 | Bacteria | 4448 |
| 350 | Ga0157380_10702632 | 3300014326 | Bacteria | 1016 |
| 351 | Ga0157380_10794405 | 3300014326 | Bacteria | 963 |
| 352 | Ga0157377_10002265 | 3300014745 | Bacteria | 8464 |
| 353 | Ga0157377_10079694 | 3300014745 | Bacteria | 1911 |
| 354 | Ga0157377_10209909 | 3300014745 | Bacteria | 1241 |
| 355 | Ga0157379_10007518 | 3300014968 | Bacteria | 9431 |
| 356 | Ga0157379_10010845 | 3300014968 | Bacteria | 7947 |
| 357 | Ga0157379_10048815 | 3300014968 | Bacteria | 3778 |
| 358 | Ga0157379_10057804 | 3300014968 | Bacteria | 3466 |
| 359 | Ga0157379_10128810 | 3300014968 | Bacteria | 2277 |
| 360 | Ga0157376_10001014 | 3300014969 | Bacteria | 18321 |
| 361 | Ga0157376_10028372 | 3300014969 | Bacteria | 4448 |
| 362 | Ga0157376_10044898 | 3300014969 | Bacteria | 3635 |
| 363 | Ga0157376_10066103 | 3300014969 | Bacteria | 3055 |
| 364 | Ga0157376_10105699 | 3300014969 | Bacteria | 2469 |
| 365 | Ga0157376_10166362 | 3300014969 | Bacteria | 2004 |
| 366 | Ga0157376_10172549 | 3300014969 | Bacteria | 1970 |
| 367 | Ga0163161_10001416 | 3300017792 | Bacteria | 17702 |
| 368 | Ga0163161_10033985 | 3300017792 | Bacteria | 3646 |
| 369 | Ga0163161_10124070 | 3300017792 | Bacteria | 1943 |
| 370 | Ga0163161_10219020 | 3300017792 | Bacteria | 1473 |
| 371 | Ga0163161_10303062 | 3300017792 | Bacteria | 1259 |
| 372 | Ga0163161_10447991 | 3300017792 | Bacteria | 1043 |
| 373 | Ga0163161_10613831 | 3300017792 | Bacteria | 898 |
| 374 | Ga0213876_10009071 | 3300021384 | Bacteria | 5356 |
| 375 | Ga0207426_1000002 | 3300025302 | Bacteria | 1249660 |
| 376 | Ga0207697_10093954 | 3300025315 | Bacteria | 1273 |
| 377 | Ga0207642_10132374 | 3300025899 | Bacteria | 1303 |
| 378 | Ga0207710_10019874 | 3300025900 | Bacteria | 2867 |
| 379 | Ga0207680_10000181 | 3300025903 | Bacteria | 30852 |
| 380 | Ga0207680_10016078 | 3300025903 | Bacteria | 3920 |
| 381 | Ga0207680_10095024 | 3300025903 | Bacteria | 1904 |
| 382 | Ga0207680_10162292 | 3300025903 | Bacteria | 1500 |
| 383 | Ga0207647_10000208 | 3300025904 | Bacteria | 47976 |
| 384 | Ga0207647_10035608 | 3300025904 | Bacteria | 3171 |
| 385 | Ga0207685_10026162 | 3300025905 | Bacteria | 2025 |
| 386 | Ga0207645_10001091 | 3300025907 | Bacteria | 22388 |
| 387 | Ga0207645_10006223 | 3300025907 | Bacteria | 8576 |
| 388 | Ga0207645_10020263 | 3300025907 | Bacteria | 4355 |
| 389 | Ga0207705_10007370 | 3300025909 | Bacteria | 8088 |
| 390 | Ga0207705_10024925 | 3300025909 | Bacteria | 4269 |
| 391 | Ga0207705_10243934 | 3300025909 | Unclassified | 1369 |
| 392 | Ga0207707_10068042 | 3300025912 | Bacteria | 3103 |
| 393 | Ga0207707_10431204 | 3300025912 | Bacteria | 1129 |
| 394 | Ga0207695_10418759 | 3300025913 | Bacteria | 1224 |
| 395 | Ga0207695_10559335 | 3300025913 | Bacteria | 1025 |
| 396 | Ga0207671_10002860 | 3300025914 | Bacteria | 17911 |
| 397 | Ga0207671_10143506 | 3300025914 | Bacteria | 1841 |
| 398 | Ga0207662_10047644 | 3300025918 | Unclassified | 2539 |
| 399 | Ga0207662_10107084 | 3300025918 | Bacteria | 1739 |
| 400 | Ga0207662_10197560 | 3300025918 | Bacteria | 1300 |
| 401 | Ga0207657_10021786 | 3300025919 | Bacteria | 6021 |
| 402 | Ga0207657_10123459 | 3300025919 | Unclassified | 2129 |
| 403 | Ga0207649_10008073 | 3300025920 | Bacteria | 5728 |
| 404 | Ga0207652_10014484 | 3300025921 | Bacteria | 6389 |
| 405 | Ga0207652_10182049 | 3300025921 | Bacteria | 1888 |
| 406 | Ga0207652_10310610 | 3300025921 | Bacteria | 1423 |
| 407 | Ga0207681_10010679 | 3300025923 | Bacteria | 5634 |
| 408 | Ga0207681_10022786 | 3300025923 | Bacteria | 3998 |
| 409 | Ga0207681_10171000 | 3300025923 | Bacteria | 1647 |
| 410 | Ga0207650_10002225 | 3300025925 | Bacteria | 13543 |
| 411 | Ga0207650_10021549 | 3300025925 | Bacteria | 4554 |
| 412 | Ga0207650_10089271 | 3300025925 | Bacteria | 2352 |
| 413 | Ga0207650_10269440 | 3300025925 | Bacteria | 1383 |
| 414 | Ga0207659_10005057 | 3300025926 | Bacteria | 7996 |
| 415 | Ga0207659_10171516 | 3300025926 | Bacteria | 1712 |
| 416 | Ga0207659_10530138 | 3300025926 | Bacteria | 999 |
| 417 | Ga0207644_10020465 | 3300025931 | Bacteria | 4499 |
| 418 | Ga0207644_10032824 | 3300025931 | Bacteria | 3625 |
| 419 | Ga0207644_10079049 | 3300025931 | Bacteria | 2426 |
| 420 | Ga0207644_10188320 | 3300025931 | Bacteria | 1621 |
| 421 | Ga0207690_10014916 | 3300025932 | Bacteria | 4703 |
| 422 | Ga0207690_10208388 | 3300025932 | Bacteria | 1489 |
| 423 | Ga0207706_10004753 | 3300025933 | Bacteria | 12720 |
| 424 | Ga0207706_10006384 | 3300025933 | Bacteria | 10953 |
| 425 | Ga0207706_10009425 | 3300025933 | Bacteria | 8964 |
| 426 | Ga0207706_10041290 | 3300025933 | Bacteria | 4090 |
| 427 | Ga0207706_10059157 | 3300025933 | Bacteria | 3375 |
| 428 | Ga0207706_10225575 | 3300025933 | Bacteria | 1640 |
| 429 | Ga0207686_10006720 | 3300025934 | Bacteria | 6196 |
| 430 | Ga0207686_10098268 | 3300025934 | Bacteria | 1949 |
| 431 | Ga0207686_10121110 | 3300025934 | Bacteria | 1781 |
| 432 | Ga0207686_10176308 | 3300025934 | Bacteria | 1512 |
| 433 | Ga0207670_10022427 | 3300025936 | Bacteria | 3913 |
| 434 | Ga0207670_10105423 | 3300025936 | Bacteria | 2021 |
| 435 | Ga0207670_10133106 | 3300025936 | Bacteria | 1824 |
| 436 | Ga0207669_10071298 | 3300025937 | Bacteria | 2182 |
| 437 | Ga0207669_10177971 | 3300025937 | Bacteria | 1521 |
| 438 | Ga0207704_10035091 | 3300025938 | Bacteria | 2870 |
| 439 | Ga0207704_10044047 | 3300025938 | Bacteria | 2640 |
| 440 | Ga0207704_10052069 | 3300025938 | Bacteria | 2480 |
| 441 | Ga0207704_10078807 | 3300025938 | Bacteria | 2120 |
| 442 | Ga0207691_10031073 | 3300025940 | Bacteria | 4988 |
| 443 | Ga0207691_10035273 | 3300025940 | Bacteria | 4644 |
| 444 | Ga0207691_10115681 | 3300025940 | Bacteria | 2381 |
| 445 | Ga0207691_10229611 | 3300025940 | Bacteria | 1607 |
| 446 | Ga0207691_10428509 | 3300025940 | Bacteria | 1127 |
| 447 | Ga0207711_10591928 | 3300025941 | Bacteria | 1035 |
| 448 | Ga0207689_10001188 | 3300025942 | Bacteria | 25011 |
| 449 | Ga0207689_10003186 | 3300025942 | Bacteria | 15048 |
| 450 | Ga0207689_10005922 | 3300025942 | Bacteria | 10828 |
| 451 | Ga0207689_10007577 | 3300025942 | Bacteria | 9513 |
| 452 | Ga0207689_10013070 | 3300025942 | Bacteria | 7089 |
| 453 | Ga0207689_10020523 | 3300025942 | Bacteria | 5559 |
| 454 | Ga0207689_10049382 | 3300025942 | Bacteria | 3470 |
| 455 | Ga0207689_10051330 | 3300025942 | Bacteria | 3400 |
| 456 | Ga0207661_10025228 | 3300025944 | Bacteria | 4516 |
| 457 | Ga0207661_10236980 | 3300025944 | Bacteria | 1618 |
| 458 | Ga0207661_10410212 | 3300025944 | Bacteria | 1229 |
| 459 | Ga0207679_10001356 | 3300025945 | Bacteria | 15429 |
| 460 | Ga0207679_10019754 | 3300025945 | Bacteria | 4534 |
| 461 | Ga0207679_10357794 | 3300025945 | Bacteria | 1274 |
| 462 | Ga0207651_10008670 | 3300025960 | Bacteria | 5509 |
| 463 | Ga0207651_10085082 | 3300025960 | Bacteria | 2293 |
| 464 | Ga0207651_10132297 | 3300025960 | Bacteria | 1912 |
| 465 | Ga0207651_10167875 | 3300025960 | Bacteria | 1727 |
| 466 | Ga0207651_10174292 | 3300025960 | Bacteria | 1700 |
| 467 | Ga0207712_10003129 | 3300025961 | Bacteria | 10551 |
| 468 | Ga0207712_10029701 | 3300025961 | Bacteria | 3670 |
| 469 | Ga0207712_10037434 | 3300025961 | Bacteria | 3310 |
| 470 | Ga0207712_10050074 | 3300025961 | Bacteria | 2915 |
| 471 | Ga0207712_10237776 | 3300025961 | Bacteria | 1466 |
| 472 | Ga0207712_10261264 | 3300025961 | Bacteria | 1404 |
| 473 | Ga0207668_10055478 | 3300025972 | Bacteria | 2754 |
| 474 | Ga0207668_10271638 | 3300025972 | Unclassified | 1386 |
| 475 | Ga0207640_10016162 | 3300025981 | Bacteria | 4335 |
| 476 | Ga0207658_10007974 | 3300025986 | Bacteria | 7210 |
| 477 | Ga0207658_10057520 | 3300025986 | Bacteria | 2890 |
| 478 | Ga0207658_10075328 | 3300025986 | Bacteria | 2567 |
| 479 | Ga0207658_10594561 | 3300025986 | Bacteria | 994 |
| 480 | Ga0207677_10008388 | 3300026023 | Bacteria | 5768 |
| 481 | Ga0207677_10032967 | 3300026023 | Bacteria | 3335 |
| 482 | Ga0207677_10090832 | 3300026023 | Bacteria | 2220 |
| 483 | Ga0207677_10096301 | 3300026023 | Bacteria | 2165 |
| 484 | Ga0207677_10155902 | 3300026023 | Bacteria | 1768 |
| 485 | Ga0207677_10160430 | 3300026023 | Bacteria | 1746 |
| 486 | Ga0207703_10028265 | 3300026035 | Bacteria | 4419 |
| 487 | Ga0207703_10300363 | 3300026035 | Bacteria | 1464 |
| 488 | Ga0207639_10124368 | 3300026041 | Bacteria | 2125 |
| 489 | Ga0207639_10316485 | 3300026041 | Bacteria | 1384 |
| 490 | Ga0207639_10608369 | 3300026041 | Bacteria | 1008 |
| 491 | Ga0207678_10329828 | 3300026067 | Bacteria | 1314 |
| 492 | Ga0207708_10065822 | 3300026075 | Bacteria | 2770 |
| 493 | Ga0207708_10091909 | 3300026075 | Bacteria | 2341 |
| 494 | Ga0207702_10257557 | 3300026078 | Bacteria | 1641 |
| 495 | Ga0207702_10262361 | 3300026078 | Bacteria | 1627 |
| 496 | Ga0207641_10000152 | 3300026088 | Bacteria | 98311 |
| 497 | Ga0207641_10003763 | 3300026088 | Bacteria | 13321 |
| 498 | Ga0207641_10016956 | 3300026088 | Bacteria | 5963 |
| 499 | Ga0207641_10050686 | 3300026088 | Bacteria | 3513 |
| 500 | Ga0207641_10113805 | 3300026088 | Bacteria | 2403 |
| 501 | Ga0207641_10279641 | 3300026088 | Bacteria | 1569 |
| 502 | Ga0207641_10315992 | 3300026088 | Bacteria | 1480 |
| 503 | Ga0207648_10008111 | 3300026089 | Bacteria | 10224 |
| 504 | Ga0207648_10030958 | 3300026089 | Bacteria | 4733 |
| 505 | Ga0207648_10071234 | 3300026089 | Bacteria | 3029 |
| 506 | Ga0207648_10295467 | 3300026089 | Bacteria | 1451 |
| 507 | Ga0207648_10419658 | 3300026089 | Bacteria | 1215 |
| 508 | Ga0207676_10001860 | 3300026095 | Bacteria | 15459 |
| 509 | Ga0207676_10012147 | 3300026095 | Bacteria | 6164 |
| 510 | Ga0207676_10083029 | 3300026095 | Bacteria | 2608 |
| 511 | Ga0207676_10197961 | 3300026095 | Bacteria | 1773 |
| 512 | Ga0207676_10282425 | 3300026095 | Bacteria | 1508 |
| 513 | Ga0207676_10620464 | 3300026095 | Bacteria | 1041 |
| 514 | Ga0207674_10013230 | 3300026116 | Bacteria | 9172 |
| 515 | Ga0207674_10026708 | 3300026116 | Bacteria | 6125 |
| 516 | Ga0207674_10062174 | 3300026116 | Bacteria | 3771 |
| 517 | Ga0207674_10148325 | 3300026116 | Bacteria | 2303 |
| 518 | Ga0207674_10190757 | 3300026116 | Bacteria | 1999 |
| 519 | Ga0207675_100034613 | 3300026118 | Bacteria | 4710 |
| 520 | Ga0207675_100035632 | 3300026118 | Bacteria | 4641 |
| 521 | Ga0207675_100120456 | 3300026118 | Bacteria | 2482 |
| 522 | Ga0207675_100432725 | 3300026118 | Bacteria | 1301 |
| 523 | Ga0207683_10001620 | 3300026121 | Bacteria | 20185 |
| 524 | Ga0207683_10061304 | 3300026121 | Bacteria | 3310 |
| 525 | Ga0207683_10133219 | 3300026121 | Bacteria | 2236 |
| 526 | Ga0207698_10001677 | 3300026142 | Bacteria | 12912 |
| 527 | Ga0207698_10007763 | 3300026142 | Bacteria | 6739 |
| 528 | Ga0207698_10097345 | 3300026142 | Bacteria | 2428 |
| 529 | Ga0207698_10153393 | 3300026142 | Bacteria | 2003 |
| 530 | Ga0207698_10531641 | 3300026142 | Bacteria | 1149 |
| 531 | Ga0207428_10117749 | 3300027907 | Bacteria | 2039 |
| 532 | Ga0268266_10044700 | 3300028379 | Bacteria | 3786 |
| 533 | Ga0268266_10113814 | 3300028379 | Bacteria | 2400 |
| 534 | Ga0268265_10023262 | 3300028380 | Bacteria | 4367 |
| 535 | Ga0268265_10035735 | 3300028380 | Bacteria | 3634 |
| 536 | Ga0268265_10100208 | 3300028380 | Bacteria | 2338 |
| 537 | Ga0268265_10157733 | 3300028380 | Bacteria | 1923 |
| 538 | Ga0268264_10002534 | 3300028381 | Bacteria | 16047 |
| 539 | Ga0268264_10007566 | 3300028381 | Bacteria | 9059 |
| 540 | Ga0268264_10012154 | 3300028381 | Bacteria | 7087 |
| 541 | Ga0268264_10016471 | 3300028381 | Bacteria | 6052 |
| 542 | Ga0268264_10459737 | 3300028381 | Bacteria | 1235 |
| 543 | Ga0268264_10481353 | 3300028381 | Bacteria | 1207 |
| 544 | Ga0268264_10516366 | 3300028381 | Bacteria | 1167 |
| 545 | Ga0268264_10618604 | 3300028381 | Unclassified | 1069 |
| 546 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 547 | Ga0307515_10000039 | 3300028794 | Bacteria | 323229 |
| 548 | Ga0265327_10000383 | 3300031251 | Bacteria | 83372 |
| 549 | Ga0265327_10062371 | 3300031251 | Bacteria | 1898 |
| 550 | Ga0265327_10077826 | 3300031251 | Bacteria | 1644 |
| 551 | Ga0307509_10140026 | 3300031507 | Bacteria | 2357 |
| 552 | Ga0307408_100108412 | 3300031548 | Bacteria | 2129 |
| 553 | Ga0307508_10003392 | 3300031616 | Bacteria | 16151 |
| 554 | Ga0307405_10106405 | 3300031731 | Bacteria | 1892 |
| 555 | Ga0307413_10340193 | 3300031824 | Bacteria | 1154 |
| 556 | Ga0307411_10186619 | 3300032005 | Bacteria | 1579 |
| 557 | Ga0307415_100130341 | 3300032126 | Bacteria | 1902 |
| 558 | Ga0373943_0122291 | 3300035170 | Bacteria | 1384 |
| 559 | Ga0373955_0023419 | 3300035172 | Bacteria | 3145 |
| 560 | Ga0373933_0307821 | 3300035724 | Bacteria | 1026 |
| 561 | Ga0373947_0053004 | 3300035725 | Bacteria | 2445 |
| 562 | Ga0373947_0128168 | 3300035725 | Bacteria | 1618 |
| 563 | Ga0373947_0402773 | 3300035725 | Bacteria | 923 |
| 564 | Ga0395905_0002824 | 3300037471 | Bacteria | 19029 |
| 565 | Ga0395905_0060659 | 3300037471 | Bacteria | 3537 |
| 566 | Ga0395905_0081041 | 3300037471 | Bacteria | 3042 |
| 567 | Ga0436365_0057606 | 3300039437 | Bacteria | 895 |
| 568 | Ga0436365_0219322 | 3300039437 | Bacteria | 12459 |
| 569 | Ga0436363_0254581 | 3300039450 | Bacteria | 1206 |
| 570 | Ga0439438_031985 | 3300041405 | Bacteria | 1397 |
| 571 | Ga0451793_0070710 | 3300041452 | Bacteria | 1510 |
| 572 | Ga0451849_0597552 | 3300041505 | Bacteria | 1597 |
| 573 | Ga0439431_0011949 | 3300041997 | Bacteria | 1990 |
| 574 | Ga0439441_001337 | 3300042001 | Bacteria | 3186 |
| 575 | Ga0439457_011408 | 3300042014 | Bacteria | 2022 |
| 576 | Ga0451577_0041242 | 3300042876 | Bacteria | 4143 |
| 577 | Ga0451577_0309292 | 3300042876 | Bacteria | 1432 |
| 578 | Ga0466972_0000020 | 3300044658 | Bacteria | 197336 |
| 579 | Ga0453683_0089965 | 3300044673 | Bacteria | 1924 |
| 580 | Ga0453684_0043874 | 3300044712 | Bacteria | 6000 |
| 581 | Ga0453684_0275808 | 3300044712 | Bacteria | 1919 |
| 582 | Ga0466970_0000117 | 3300044765 | Bacteria | 35460 |
| 583 | Ga0466957_0000351 | 3300044842 | Bacteria | 22557 |
| 584 | Ga0466959_0056211 | 3300045049 | Bacteria | 2872 |
| 585 | Ga0451576_0190376 | 3300045051 | Bacteria | 2143 |
| 586 | Ga0495592_0064026 | 3300046454 | Bacteria | 2696 |
| 587 | Ga0495638_0129623 | 3300046460 | Bacteria | 1483 |
| 588 | Ga0495651_0262767 | 3300046462 | Bacteria | 1174 |
| 589 | Ga0495664_0141661 | 3300046477 | Bacteria | 1458 |
| 590 | Ga0495628_0047488 | 3300046516 | Bacteria | 3406 |
| 591 | Ga0495621_0035434 | 3300046539 | Bacteria | 1729 |
| 592 | Ga0495667_0042473 | 3300046559 | Bacteria | 3015 |
| 593 | Ga0495668_0003256 | 3300046616 | Bacteria | 12342 |
| 594 | Ga0495611_0068844 | 3300046648 | Bacteria | 1616 |
| 595 | Ga0495635_0171317 | 3300046663 | Bacteria | 1476 |
| 596 | Ga0495600_0044009 | 3300046809 | Bacteria | 2913 |
| 597 | Ga0495672_0024735 | 3300047320 | Bacteria | 3863 |
| 598 | Ga0495686_0046602 | 3300047472 | Bacteria | 2740 |
| 599 | Ga0496100_0016463 | 3300048903 | Bacteria | 4343 |
| 600 | Ga0496101_0382935 | 3300048904 | Unclassified | 1107 |
| 601 | Ga0496109_0607776 | 3300048912 | Bacteria | 1030 |
| 602 | Ga0496111_0057955 | 3300048914 | Bacteria | 2804 |
| 603 | Ga0496114_0072026 | 3300048917 | Bacteria | 2906 |
| 604 | Ga0496124_0135773 | 3300048927 | Bacteria | 1948 |
| 605 | Ga0501031_0005264 | 3300049568 | Bacteria | 8434 |
| 606 | Ga0501031_0251202 | 3300049568 | Bacteria | 1149 |
| 607 | Ga0501032_0018919 | 3300049569 | Bacteria | 4819 |
| 608 | Ga0501032_0117182 | 3300049569 | Bacteria | 1761 |
| 609 | Ga0501033_0076083 | 3300049570 | Bacteria | 2464 |
| 610 | Ga0501033_0212297 | 3300049570 | Bacteria | 1380 |
| 611 | Ga0501034_0005345 | 3300049571 | Bacteria | 14069 |
| 612 | Ga0501034_0006218 | 3300049571 | Bacteria | 12854 |
| 613 | Ga0501034_0060040 | 3300049571 | Bacteria | 3819 |
| 614 | Ga0501034_0068903 | 3300049571 | Bacteria | 3548 |
| 615 | Ga0501034_0387032 | 3300049571 | Bacteria | 1323 |
| 616 | Ga0501034_0493678 | 3300049571 | Bacteria | 1138 |
| 617 | Ga0501036_0001937 | 3300049572 | Bacteria | 16063 |
| 618 | Ga0501036_0044844 | 3300049572 | Bacteria | 3746 |
| 619 | Ga0501036_0167575 | 3300049572 | Bacteria | 1851 |
| 620 | Ga0501037_0010859 | 3300049573 | Bacteria | 6692 |
| 621 | Ga0501037_0017452 | 3300049573 | Bacteria | 5283 |
| 622 | Ga0501038_0017596 | 3300049574 | Bacteria | 6458 |
| 623 | Ga0501038_0125516 | 3300049574 | Bacteria | 2113 |
| 624 | Ga0501039_0021513 | 3300049575 | Bacteria | 4947 |
| 625 | Ga0501039_0061333 | 3300049575 | Bacteria | 2912 |
| 626 | Ga0501043_0001561 | 3300049579 | Bacteria | 19946 |
| 627 | Ga0501043_0017653 | 3300049579 | Bacteria | 5596 |
| 628 | Ga0501046_0025302 | 3300049580 | Bacteria | 4859 |
| 629 | Ga0501046_0227448 | 3300049580 | Bacteria | 1379 |
| 630 | Ga0501047_0065912 | 3300049581 | Bacteria | 3490 |
| 631 | Ga0501047_0093543 | 3300049581 | Bacteria | 2885 |
| 632 | Ga0501072_0346248 | 3300049588 | Bacteria | 1180 |
| 633 | Ga0501073_0017109 | 3300049589 | Bacteria | 5251 |
| 634 | Ga0501074_0002078 | 3300049590 | Bacteria | 13840 |
| 635 | Ga0501202_000361 | 3300049652 | Bacteria | 6321 |
| 636 | Ga0501206_000286 | 3300049653 | Bacteria | 5921 |
| 637 | Ga0501217_004485 | 3300049661 | Bacteria | 2874 |
| 638 | Ga0501222_006594 | 3300049662 | Bacteria | 1558 |
| 639 | Ga0501233_000938 | 3300049668 | Bacteria | 4936 |
| 640 | Ga0501233_029508 | 3300049668 | Bacteria | 1231 |
| 641 | Ga0501235_000670 | 3300049669 | Bacteria | 6919 |
| 642 | Ga0501235_016889 | 3300049669 | Bacteria | 1614 |
| 643 | Ga0501243_000661 | 3300049675 | Bacteria | 4720 |
| 644 | Ga0501243_029034 | 3300049675 | Unclassified | 938 |
| 645 | Ga0501259_000248 | 3300049688 | Bacteria | 8465 |
| 646 | Ga0501221_005253 | 3300049704 | Bacteria | 2160 |
| 647 | Ga0501225_0010585 | 3300049705 | Bacteria | 2611 |
| 648 | Ga0501234_007821 | 3300049707 | Bacteria | 1671 |
| 649 | Ga0501080_0145178 | 3300049742 | Bacteria | 2193 |
| 650 | Ga0501080_0308308 | 3300049742 | Unclassified | 1435 |
| 651 | Ga0501080_0431664 | 3300049742 | Bacteria | 1182 |
| 652 | Ga0501080_0546649 | 3300049742 | Bacteria | 1032 |
| 653 | Ga0501083_0049687 | 3300049744 | Bacteria | 2827 |
| 654 | Ga0501035_0067220 | 3300049822 | Bacteria | 3181 |
| 655 | Ga0501035_0095872 | 3300049822 | Bacteria | 2607 |
| 656 | Ga0501035_0213421 | 3300049822 | Unclassified | 1651 |
| 657 | Ga0501044_0019190 | 3300049823 | Bacteria | 7319 |
| 658 | Ga0501044_0020812 | 3300049823 | Bacteria | 7002 |
| 659 | Ga0501044_0193019 | 3300049823 | Bacteria | 1998 |
| 660 | nmdc:mga0k408_10779_c1 | 3300050493 | Bacteria | 4954 |
| 661 | nmdc:mga05p37_180002_c1 | 3300050507 | Bacteria | 2572 |
| 662 | nmdc:mga05p37_216342_c1 | 3300050507 | Bacteria | 2314 |
| 663 | nmdc:mga09592_233360_c1 | 3300050508 | Bacteria | 1594 |
| 664 | nmdc:mga09592_26508_c1 | 3300050508 | Bacteria | 4802 |
| 665 | nmdc:mga09592_6436_c1 | 3300050508 | Bacteria | 9567 |
| 666 | nmdc:mga0qj67_23497_c1 | 3300050509 | Bacteria | 4744 |
| 667 | nmdc:mga06r32_30211_c1 | 3300050510 | Bacteria | 5084 |
| 668 | nmdc:mga08y16_224434_c1 | 3300050511 | Bacteria | 1944 |
| 669 | nmdc:mga08y16_5986_c1 | 3300050511 | Bacteria | 12753 |
| 670 | Ga0495619_0088244 | 3300053085 | Bacteria | 2098 |
| 671 | Ga0500644_0050728 | 3300053088 | Bacteria | 1422 |
| 672 | Ga0500562_000014 | 3300053108 | Bacteria | 146262 |
| 673 | Ga0500568_0000699 | 3300053139 | Bacteria | 24055 |
| 674 | Ga0500588_0028583 | 3300053146 | Bacteria | 1582 |
| 675 | Ga0500616_0028391 | 3300053153 | Bacteria | 3083 |
| 676 | Ga0500622_0001206 | 3300053156 | Bacteria | 21242 |
| 677 | Ga0500611_000007 | 3300053727 | Bacteria | 210964 |
| 678 | Ga0500645_014489 | 3300053730 | Bacteria | 2510 |
| 679 | Ga0500661_010932 | 3300055283 | Bacteria | 1647 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025986 | Ga0207658_10594561 | Ga0207658_105945612 | 235 |
| 2 | 3300026078 | Ga0207702_10257557 | Ga0207702_102575572 | 247 |
| 3 | 3300039437 | Ga0436365_0057606 | Ga0436365_0057606_69_839 | 255 |
| 4 | 3300046462 | Ga0495651_0262767 | Ga0495651_0262767_26_802 | 256 |
| 5 | 3300013100 | Ga0157373_10200126 | Ga0157373_102001262 | 257 |
| 6 | 3300049662 | Ga0501222_006594 | Ga0501222_006594_10_783 | 257 |
| 7 | 3300005339 | Ga0070660_100130723 | Ga0070660_1001307232 | 258 |
| 8 | 3300005458 | Ga0070681_10078745 | Ga0070681_100787453 | 258 |
| 9 | 3300013104 | Ga0157370_10160908 | Ga0157370_101609082 | 258 |
| 10 | 3300017792 | Ga0163161_10613831 | Ga0163161_106138311 | 258 |
| 11 | 3300025909 | Ga0207705_10243934 | Ga0207705_102439343 | 258 |
| 12 | 3300025912 | Ga0207707_10431204 | Ga0207707_104312041 | 258 |
| 13 | 3300025919 | Ga0207657_10123459 | Ga0207657_101234592 | 258 |
| 14 | 3300025921 | Ga0207652_10182049 | Ga0207652_101820491 | 258 |
| 15 | 3300013102 | Ga0157371_10061575 | Ga0157371_100615752 | 259 |
| 16 | 3300013105 | Ga0157369_10065596 | Ga0157369_100655962 | 261 |
| 17 | 3300014969 | Ga0157376_10172549 | Ga0157376_101725492 | 263 |
| 18 | 3300049569 | Ga0501032_0117182 | Ga0501032_0117182_130_924 | 263 |
| 19 | 3300049742 | Ga0501080_0431664 | Ga0501080_0431664_13_807 | 263 |
| 20 | 3300049744 | Ga0501083_0049687 | Ga0501083_0049687_23_817 | 263 |
| 21 | 3300013104 | Ga0157370_10008487 | Ga0157370_100084873 | 264 |
| 22 | 3300013306 | Ga0163162_10084029 | Ga0163162_100840293 | 264 |
| 23 | 3300013308 | Ga0157375_10004004 | Ga0157375_100040046 | 264 |
| 24 | 3300014325 | Ga0163163_10569004 | Ga0163163_105690041 | 264 |
| 25 | 3300014968 | Ga0157379_10128810 | Ga0157379_101288102 | 264 |
| 26 | 3300028794 | Ga0307515_10000039 | Ga0307515_10000039128 | 265 |
| 27 | 3300005331 | Ga0070670_100169303 | Ga0070670_1001693032 | 266 |
| 28 | 3300011119 | Ga0105246_10101038 | Ga0105246_101010382 | 266 |
| 29 | 3300014326 | Ga0157380_10702632 | Ga0157380_107026321 | 266 |
| 30 | 3300048912 | Ga0496109_0607776 | Ga0496109_0607776_210_1013 | 266 |
| 31 | 3300049574 | Ga0501038_0125516 | Ga0501038_0125516_331_1155 | 266 |
| 32 | 3300003320 | rootH2_10232842 | rootH2_102328421 | 267 |
| 33 | 3300005329 | Ga0070683_100288413 | Ga0070683_1002884132 | 267 |
| 34 | 3300005336 | Ga0070680_100082093 | Ga0070680_1000820932 | 267 |
| 35 | 3300005337 | Ga0070682_100286152 | Ga0070682_1002861522 | 267 |
| 36 | 3300005339 | Ga0070660_100048594 | Ga0070660_1000485942 | 267 |
| 37 | 3300005458 | Ga0070681_10063001 | Ga0070681_100630012 | 267 |
| 38 | 3300005459 | Ga0068867_100114404 | Ga0068867_1001144042 | 267 |
| 39 | 3300005459 | Ga0068867_100320104 | Ga0068867_1003201042 | 267 |
| 40 | 3300005530 | Ga0070679_100000775 | Ga0070679_1000007756 | 267 |
| 41 | 3300005563 | Ga0068855_100169778 | Ga0068855_1001697782 | 267 |
| 42 | 3300005616 | Ga0068852_100000704 | Ga0068852_1000007044 | 267 |
| 43 | 3300006237 | Ga0097621_100002163 | Ga0097621_1000021638 | 267 |
| 44 | 3300006881 | Ga0068865_100017895 | Ga0068865_1000178952 | 267 |
| 45 | 3300013306 | Ga0163162_10618616 | Ga0163162_106186162 | 267 |
| 46 | 3300013307 | Ga0157372_10136851 | Ga0157372_101368512 | 267 |
| 47 | 3300013307 | Ga0157372_10267939 | Ga0157372_102679392 | 267 |
| 48 | 3300013308 | Ga0157375_10342348 | Ga0157375_103423482 | 267 |
| 49 | 3300014326 | Ga0157380_10794405 | Ga0157380_107944051 | 267 |
| 50 | 3300017792 | Ga0163161_10124070 | Ga0163161_101240702 | 267 |
| 51 | 3300017792 | Ga0163161_10303062 | Ga0163161_103030622 | 267 |
| 52 | 3300025909 | Ga0207705_10007370 | Ga0207705_100073702 | 267 |
| 53 | 3300025912 | Ga0207707_10068042 | Ga0207707_100680421 | 267 |
| 54 | 3300025919 | Ga0207657_10021786 | Ga0207657_100217863 | 267 |
| 55 | 3300025921 | Ga0207652_10014484 | Ga0207652_100144842 | 267 |
| 56 | 3300025938 | Ga0207704_10052069 | Ga0207704_100520692 | 267 |
| 57 | 3300025944 | Ga0207661_10236980 | Ga0207661_102369802 | 267 |
| 58 | 3300026035 | Ga0207703_10300363 | Ga0207703_103003632 | 267 |
| 59 | 3300026041 | Ga0207639_10608369 | Ga0207639_106083691 | 267 |
| 60 | 3300026088 | Ga0207641_10279641 | Ga0207641_102796411 | 267 |
| 61 | 3300026142 | Ga0207698_10001677 | Ga0207698_100016776 | 267 |
| 62 | 3300028381 | Ga0268264_10481353 | Ga0268264_104813532 | 267 |
| 63 | 3300031251 | Ga0265327_10000383 | Ga0265327_1000038322 | 267 |
| 64 | 3300049742 | Ga0501080_0546649 | Ga0501080_0546649_33_884 | 267 |
| 65 | 3300049822 | Ga0501035_0213421 | Ga0501035_0213421_604_1413 | 267 |
| 66 | 3300005458 | Ga0070681_10257096 | Ga0070681_102570962 | 268 |
| 67 | 3300005530 | Ga0070679_100403672 | Ga0070679_1004036721 | 268 |
| 68 | 3300005539 | Ga0068853_100090821 | Ga0068853_1000908211 | 268 |
| 69 | 3300005539 | Ga0068853_100422376 | Ga0068853_1004223762 | 268 |
| 70 | 3300005616 | Ga0068852_100310537 | Ga0068852_1003105373 | 268 |
| 71 | 3300009545 | Ga0105237_10129647 | Ga0105237_101296473 | 268 |
| 72 | 3300013100 | Ga0157373_10121441 | Ga0157373_101214413 | 268 |
| 73 | 3300013102 | Ga0157371_10201140 | Ga0157371_102011402 | 268 |
| 74 | 3300013104 | Ga0157370_10408724 | Ga0157370_104087242 | 268 |
| 75 | 3300013105 | Ga0157369_10171175 | Ga0157369_101711753 | 268 |
| 76 | 3300013307 | Ga0157372_10574450 | Ga0157372_105744502 | 268 |
| 77 | 3300025905 | Ga0207685_10026162 | Ga0207685_100261622 | 268 |
| 78 | 3300025909 | Ga0207705_10024925 | Ga0207705_100249252 | 268 |
| 79 | 3300025913 | Ga0207695_10418759 | Ga0207695_104187592 | 268 |
| 80 | 3300025921 | Ga0207652_10310610 | Ga0207652_103106102 | 268 |
| 81 | 3300005459 | Ga0068867_100032598 | Ga0068867_1000325982 | 269 |
| 82 | 3300006195 | Ga0075366_10009549 | Ga0075366_100095493 | 269 |
| 83 | 3300026089 | Ga0207648_10071234 | Ga0207648_100712343 | 269 |
| 84 | 3300028794 | Ga0307515_10000002 | Ga0307515_10000002888 | 269 |
| 85 | 3300031251 | Ga0265327_10062371 | Ga0265327_100623712 | 269 |
| 86 | 3300049570 | Ga0501033_0076083 | Ga0501033_0076083_135_947 | 269 |
| 87 | 3300049571 | Ga0501034_0493678 | Ga0501034_0493678_103_915 | 269 |
| 88 | 3300005834 | Ga0068851_10134010 | Ga0068851_101340101 | 270 |
| 89 | 3300028381 | Ga0268264_10012154 | Ga0268264_100121542 | 270 |
| 90 | 3300035170 | Ga0373943_0122291 | Ga0373943_0122291_404_1222 | 270 |
| 91 | 3300035172 | Ga0373955_0023419 | Ga0373955_0023419_932_1750 | 270 |
| 92 | 3300035725 | Ga0373947_0402773 | Ga0373947_0402773_25_840 | 270 |
| 93 | 3300046454 | Ga0495592_0064026 | Ga0495592_0064026_1390_2208 | 270 |
| 94 | 3300046559 | Ga0495667_0042473 | Ga0495667_0042473_424_1242 | 270 |
| 95 | 3300046809 | Ga0495600_0044009 | Ga0495600_0044009_1426_2244 | 270 |
| 96 | 3300049675 | Ga0501243_029034 | Ga0501243_029034_20_832 | 270 |
| 97 | 3300006847 | Ga0075431_100008390 | Ga0075431_1000083907 | 271 |
| 98 | 3300006880 | Ga0075429_100032473 | Ga0075429_1000324732 | 271 |
| 99 | 3300009147 | Ga0114129_10030026 | Ga0114129_100300268 | 271 |
| 100 | 3300050507 | nmdc:mga05p37_216342_c1 | nmdc:mga05p37_216342_c1_1186_2013 | 271 |
| 101 | 3300050508 | nmdc:mga09592_26508_c1 | nmdc:mga09592_26508_c1_47_874 | 271 |
| 102 | 3300050510 | nmdc:mga06r32_30211_c1 | nmdc:mga06r32_30211_c1_568_1395 | 271 |
| 103 | 3300003323 | rootH1_10285025 | rootH1_102850252 | 272 |
| 104 | 3300005543 | Ga0070672_100159067 | Ga0070672_1001590672 | 272 |
| 105 | 3300014326 | Ga0157380_10025932 | Ga0157380_100259323 | 272 |
| 106 | 3300025940 | Ga0207691_10428509 | Ga0207691_104285092 | 272 |
| 107 | 3300046616 | Ga0495668_0003256 | Ga0495668_0003256_7897_8724 | 272 |
| 108 | 3300049569 | Ga0501032_0018919 | Ga0501032_0018919_1268_2095 | 272 |
| 109 | 3300049571 | Ga0501034_0006218 | Ga0501034_0006218_5317_6144 | 272 |
| 110 | 3300049572 | Ga0501036_0167575 | Ga0501036_0167575_734_1561 | 272 |
| 111 | 3300049573 | Ga0501037_0010859 | Ga0501037_0010859_5325_6152 | 272 |
| 112 | 3300049575 | Ga0501039_0021513 | Ga0501039_0021513_2937_3764 | 272 |
| 113 | 3300049581 | Ga0501047_0093543 | Ga0501047_0093543_600_1427 | 272 |
| 114 | 3300049661 | Ga0501217_004485 | Ga0501217_004485_726_1544 | 272 |
| 115 | 3300049822 | Ga0501035_0095872 | Ga0501035_0095872_1304_2131 | 272 |
| 116 | 3300049823 | Ga0501044_0020812 | Ga0501044_0020812_5109_5936 | 272 |
| 117 | 3300005327 | Ga0070658_10171275 | Ga0070658_101712751 | 273 |
| 118 | 3300005334 | Ga0068869_100005339 | Ga0068869_1000053393 | 273 |
| 119 | 3300005335 | Ga0070666_10000028 | Ga0070666_1000002818 | 273 |
| 120 | 3300005355 | Ga0070671_100025128 | Ga0070671_1000251282 | 273 |
| 121 | 3300005355 | Ga0070671_100317093 | Ga0070671_1003170931 | 273 |
| 122 | 3300005364 | Ga0070673_100030366 | Ga0070673_1000303662 | 273 |
| 123 | 3300005365 | Ga0070688_100290393 | Ga0070688_1002903932 | 273 |
| 124 | 3300005365 | Ga0070688_100387685 | Ga0070688_1003876851 | 273 |
| 125 | 3300005367 | Ga0070667_100008748 | Ga0070667_1000087482 | 273 |
| 126 | 3300005367 | Ga0070667_100011426 | Ga0070667_1000114262 | 273 |
| 127 | 3300005617 | Ga0068859_100000012 | Ga0068859_100000012200 | 273 |
| 128 | 3300005618 | Ga0068864_100004494 | Ga0068864_1000044947 | 273 |
| 129 | 3300005841 | Ga0068863_100001512 | Ga0068863_1000015122 | 273 |
| 130 | 3300005842 | Ga0068858_100002978 | Ga0068858_1000029782 | 273 |
| 131 | 3300005843 | Ga0068860_100002797 | Ga0068860_10000279711 | 273 |
| 132 | 3300005843 | Ga0068860_100003548 | Ga0068860_1000035482 | 273 |
| 133 | 3300006358 | Ga0068871_100030255 | Ga0068871_1000302554 | 273 |
| 134 | 3300006358 | Ga0068871_100155161 | Ga0068871_1001551612 | 273 |
| 135 | 3300006881 | Ga0068865_100019539 | Ga0068865_1000195393 | 273 |
| 136 | 3300006881 | Ga0068865_100165884 | Ga0068865_1001658842 | 273 |
| 137 | 3300006931 | Ga0097620_100000012 | Ga0097620_100000012200 | 273 |
| 138 | 3300009101 | Ga0105247_10006796 | Ga0105247_100067964 | 273 |
| 139 | 3300009148 | Ga0105243_10296311 | Ga0105243_102963112 | 273 |
| 140 | 3300009174 | Ga0105241_10004934 | Ga0105241_100049346 | 273 |
| 141 | 3300009545 | Ga0105237_10004851 | Ga0105237_100048512 | 273 |
| 142 | 3300009553 | Ga0105249_10002025 | Ga0105249_1000202513 | 273 |
| 143 | 3300011119 | Ga0105246_10110369 | Ga0105246_101103692 | 273 |
| 144 | 3300013297 | Ga0157378_10059212 | Ga0157378_100592122 | 273 |
| 145 | 3300013297 | Ga0157378_10062316 | Ga0157378_100623164 | 273 |
| 146 | 3300013306 | Ga0163162_10000634 | Ga0163162_1000063424 | 273 |
| 147 | 3300013308 | Ga0157375_10085652 | Ga0157375_100856522 | 273 |
| 148 | 3300014325 | Ga0163163_10599474 | Ga0163163_105994742 | 273 |
| 149 | 3300014968 | Ga0157379_10057804 | Ga0157379_100578042 | 273 |
| 150 | 3300014969 | Ga0157376_10028372 | Ga0157376_100283723 | 273 |
| 151 | 3300014969 | Ga0157376_10066103 | Ga0157376_100661032 | 273 |
| 152 | 3300017792 | Ga0163161_10447991 | Ga0163161_104479911 | 273 |
| 153 | 3300025900 | Ga0207710_10019874 | Ga0207710_100198742 | 273 |
| 154 | 3300025903 | Ga0207680_10000181 | Ga0207680_100001816 | 273 |
| 155 | 3300025914 | Ga0207671_10002860 | Ga0207671_1000286014 | 273 |
| 156 | 3300025931 | Ga0207644_10032824 | Ga0207644_100328242 | 273 |
| 157 | 3300025938 | Ga0207704_10035091 | Ga0207704_100350913 | 273 |
| 158 | 3300025942 | Ga0207689_10001188 | Ga0207689_1000118815 | 273 |
| 159 | 3300025960 | Ga0207651_10132297 | Ga0207651_101322972 | 273 |
| 160 | 3300025961 | Ga0207712_10050074 | Ga0207712_100500742 | 273 |
| 161 | 3300025986 | Ga0207658_10075328 | Ga0207658_100753282 | 273 |
| 162 | 3300026035 | Ga0207703_10028265 | Ga0207703_100282652 | 273 |
| 163 | 3300026088 | Ga0207641_10000152 | Ga0207641_1000015239 | 273 |
| 164 | 3300026095 | Ga0207676_10012147 | Ga0207676_100121473 | 273 |
| 165 | 3300026095 | Ga0207676_10620464 | Ga0207676_106204641 | 273 |
| 166 | 3300028381 | Ga0268264_10002534 | Ga0268264_1000253414 | 273 |
| 167 | 3300028381 | Ga0268264_10007566 | Ga0268264_100075663 | 273 |
| 168 | 3300028381 | Ga0268264_10459737 | Ga0268264_104597372 | 273 |
| 169 | 3300041405 | Ga0439438_031985 | Ga0439438_031985_392_1249 | 273 |
| 170 | 3300041452 | Ga0451793_0070710 | Ga0451793_0070710_484_1311 | 273 |
| 171 | 3300046477 | Ga0495664_0141661 | Ga0495664_0141661_121_951 | 273 |
| 172 | 3300046663 | Ga0495635_0171317 | Ga0495635_0171317_289_1119 | 273 |
| 173 | 3300009545 | Ga0105237_10163055 | Ga0105237_101630551 | 274 |
| 174 | 3300009553 | Ga0105249_10049524 | Ga0105249_100495242 | 274 |
| 175 | 3300013306 | Ga0163162_10005374 | Ga0163162_100053748 | 274 |
| 176 | 3300013308 | Ga0157375_10457868 | Ga0157375_104578682 | 274 |
| 177 | 3300014968 | Ga0157379_10010845 | Ga0157379_100108453 | 274 |
| 178 | 3300025961 | Ga0207712_10037434 | Ga0207712_100374342 | 274 |
| 179 | 3300049571 | Ga0501034_0005345 | Ga0501034_0005345_7058_7894 | 274 |
| 180 | 3300049823 | Ga0501044_0193019 | Ga0501044_0193019_47_883 | 274 |
| 181 | 3300053146 | Ga0500588_0028583 | Ga0500588_0028583_268_1101 | 274 |
| 182 | 3300053153 | Ga0500616_0028391 | Ga0500616_0028391_1567_2400 | 274 |
| 183 | 3300005331 | Ga0070670_100063227 | Ga0070670_1000632273 | 275 |
| 184 | 3300005331 | Ga0070670_100099753 | Ga0070670_1000997533 | 275 |
| 185 | 3300005335 | Ga0070666_10048345 | Ga0070666_100483452 | 275 |
| 186 | 3300005355 | Ga0070671_100129556 | Ga0070671_1001295562 | 275 |
| 187 | 3300005355 | Ga0070671_100263296 | Ga0070671_1002632962 | 275 |
| 188 | 3300005367 | Ga0070667_100008264 | Ga0070667_1000082645 | 275 |
| 189 | 3300005841 | Ga0068863_100024031 | Ga0068863_1000240316 | 275 |
| 190 | 3300005841 | Ga0068863_100048701 | Ga0068863_1000487012 | 275 |
| 191 | 3300006237 | Ga0097621_100001409 | Ga0097621_10000140913 | 275 |
| 192 | 3300006358 | Ga0068871_100013859 | Ga0068871_1000138593 | 275 |
| 193 | 3300006358 | Ga0068871_100339752 | Ga0068871_1003397521 | 275 |
| 194 | 3300009177 | Ga0105248_10042644 | Ga0105248_100426443 | 275 |
| 195 | 3300013102 | Ga0157371_10058825 | Ga0157371_100588253 | 275 |
| 196 | 3300013104 | Ga0157370_10412029 | Ga0157370_104120292 | 275 |
| 197 | 3300013296 | Ga0157374_10063447 | Ga0157374_100634472 | 275 |
| 198 | 3300013297 | Ga0157378_10024651 | Ga0157378_100246511 | 275 |
| 199 | 3300013297 | Ga0157378_10035213 | Ga0157378_100352133 | 275 |
| 200 | 3300013306 | Ga0163162_10002367 | Ga0163162_1000236713 | 275 |
| 201 | 3300013306 | Ga0163162_10266675 | Ga0163162_102666752 | 275 |
| 202 | 3300013307 | Ga0157372_10494275 | Ga0157372_104942751 | 275 |
| 203 | 3300013308 | Ga0157375_10001279 | Ga0157375_1000127917 | 275 |
| 204 | 3300014325 | Ga0163163_10004016 | Ga0163163_100040167 | 275 |
| 205 | 3300014325 | Ga0163163_10035462 | Ga0163163_100354623 | 275 |
| 206 | 3300014969 | Ga0157376_10001014 | Ga0157376_1000101417 | 275 |
| 207 | 3300017792 | Ga0163161_10001416 | Ga0163161_1000141613 | 275 |
| 208 | 3300025925 | Ga0207650_10089271 | Ga0207650_100892712 | 275 |
| 209 | 3300025931 | Ga0207644_10020465 | Ga0207644_100204653 | 275 |
| 210 | 3300025986 | Ga0207658_10057520 | Ga0207658_100575202 | 275 |
| 211 | 3300026088 | Ga0207641_10113805 | Ga0207641_101138052 | 275 |
| 212 | 3300026095 | Ga0207676_10083029 | Ga0207676_100830292 | 275 |
| 213 | 3300031616 | Ga0307508_10003392 | Ga0307508_100033925 | 275 |
| 214 | 3300042876 | Ga0451577_0041242 | Ga0451577_0041242_333_1169 | 275 |
| 215 | 3300048903 | Ga0496100_0016463 | Ga0496100_0016463_1262_2098 | 275 |
| 216 | 3300048904 | Ga0496101_0382935 | Ga0496101_0382935_101_937 | 275 |
| 217 | 3300048917 | Ga0496114_0072026 | Ga0496114_0072026_2045_2881 | 275 |
| 218 | iso_pu_bacteria | 2818991444 | 2819590077 | 275 |
| 219 | 3300005334 | Ga0068869_100016147 | Ga0068869_1000161472 | 276 |
| 220 | 3300005354 | Ga0070675_100037894 | Ga0070675_1000378942 | 276 |
| 221 | 3300005543 | Ga0070672_100218344 | Ga0070672_1002183442 | 276 |
| 222 | 3300005719 | Ga0068861_100737724 | Ga0068861_1007377241 | 276 |
| 223 | 3300005844 | Ga0068862_100123684 | Ga0068862_1001236841 | 276 |
| 224 | 3300013100 | Ga0157373_10002524 | Ga0157373_100025249 | 276 |
| 225 | 3300013102 | Ga0157371_10001703 | Ga0157371_100017032 | 276 |
| 226 | 3300013105 | Ga0157369_10015500 | Ga0157369_100155009 | 276 |
| 227 | 3300013307 | Ga0157372_10001143 | Ga0157372_100011433 | 276 |
| 228 | 3300013308 | Ga0157375_10173340 | Ga0157375_101733402 | 276 |
| 229 | 3300025315 | Ga0207697_10093954 | Ga0207697_100939542 | 276 |
| 230 | 3300025931 | Ga0207644_10188320 | Ga0207644_101883201 | 276 |
| 231 | 3300026118 | Ga0207675_100432725 | Ga0207675_1004327252 | 276 |
| 232 | 3300026121 | Ga0207683_10133219 | Ga0207683_101332192 | 276 |
| 233 | 3300028380 | Ga0268265_10035735 | Ga0268265_100357351 | 276 |
| 234 | 3300028381 | Ga0268264_10016471 | Ga0268264_100164712 | 276 |
| 235 | 3300041505 | Ga0451849_0597552 | Ga0451849_0597552_379_1218 | 276 |
| 236 | 3300049570 | Ga0501033_0212297 | Ga0501033_0212297_146_988 | 277 |
| 237 | 3300049571 | Ga0501034_0387032 | Ga0501034_0387032_395_1237 | 277 |
| 238 | 3300003320 | rootH2_10169461 | rootH2_101694612 | 278 |
| 239 | 3300003323 | rootH1_10000226 | rootH1_100002262 | 278 |
| 240 | 3300005466 | Ga0070685_10324846 | Ga0070685_103248461 | 278 |
| 241 | 3300005616 | Ga0068852_100124099 | Ga0068852_1001240992 | 278 |
| 242 | 3300006358 | Ga0068871_100180271 | Ga0068871_1001802712 | 278 |
| 243 | 3300014745 | Ga0157377_10079694 | Ga0157377_100796942 | 278 |
| 244 | 3300026142 | Ga0207698_10531641 | Ga0207698_105316412 | 278 |
| 245 | 3300031251 | Ga0265327_10077826 | Ga0265327_100778262 | 278 |
| 246 | 3300031507 | Ga0307509_10140026 | Ga0307509_101400262 | 278 |
| 247 | 3300042014 | Ga0439457_011408 | Ga0439457_011408_707_1624 | 278 |
| 248 | 3300044658 | Ga0466972_0000020 | Ga0466972_0000020_107793_108833 | 278 |
| 249 | 3300044673 | Ga0453683_0089965 | Ga0453683_0089965_838_1683 | 278 |
| 250 | 3300044765 | Ga0466970_0000117 | Ga0466970_0000117_31615_32646 | 278 |
| 251 | 3300044842 | Ga0466957_0000351 | Ga0466957_0000351_4210_5055 | 278 |
| 252 | 3300003354 | JGI25160J50197_1003244 | JGI25160J50197_10032442 | 279 |
| 253 | 3300005843 | Ga0068860_100032839 | Ga0068860_1000328392 | 279 |
| 254 | 3300013307 | Ga0157372_10488223 | Ga0157372_104882231 | 279 |
| 255 | 3300021384 | Ga0213876_10009071 | Ga0213876_100090714 | 279 |
| 256 | 3300025302 | Ga0207426_1000002 | Ga0207426_1000002986 | 279 |
| 257 | 3300039437 | Ga0436365_0219322 | Ga0436365_0219322_8648_9490 | 279 |
| 258 | 3300048927 | Ga0496124_0135773 | Ga0496124_0135773_639_1544 | 279 |
| 259 | iso_pu_bacteria | 2929154850 | 2929155687 | 279 |
| 260 | 3300003320 | rootH2_10074975 | rootH2_100749755 | 280 |
| 261 | 3300005290 | Ga0065712_10006615 | Ga0065712_100066153 | 280 |
| 262 | 3300005340 | Ga0070689_100006441 | Ga0070689_1000064417 | 280 |
| 263 | 3300005353 | Ga0070669_100015799 | Ga0070669_1000157994 | 280 |
| 264 | 3300005355 | Ga0070671_100180631 | Ga0070671_1001806312 | 280 |
| 265 | 3300005364 | Ga0070673_100065354 | Ga0070673_1000653543 | 280 |
| 266 | 3300005440 | Ga0070705_100198925 | Ga0070705_1001989252 | 280 |
| 267 | 3300005457 | Ga0070662_100019599 | Ga0070662_1000195991 | 280 |
| 268 | 3300005543 | Ga0070672_100084098 | Ga0070672_1000840984 | 280 |
| 269 | 3300005577 | Ga0068857_100125079 | Ga0068857_1001250792 | 280 |
| 270 | 3300005578 | Ga0068854_100134910 | Ga0068854_1001349102 | 280 |
| 271 | 3300005617 | Ga0068859_100022888 | Ga0068859_1000228882 | 280 |
| 272 | 3300005719 | Ga0068861_100004190 | Ga0068861_1000041909 | 280 |
| 273 | 3300005844 | Ga0068862_100024052 | Ga0068862_1000240524 | 280 |
| 274 | 3300006881 | Ga0068865_100385459 | Ga0068865_1003854592 | 280 |
| 275 | 3300006931 | Ga0097620_100022888 | Ga0097620_1000228882 | 280 |
| 276 | 3300009094 | Ga0111539_10083796 | Ga0111539_100837964 | 280 |
| 277 | 3300009553 | Ga0105249_10007898 | Ga0105249_100078982 | 280 |
| 278 | 3300013306 | Ga0163162_10005072 | Ga0163162_100050725 | 280 |
| 279 | 3300013308 | Ga0157375_10009214 | Ga0157375_100092143 | 280 |
| 280 | 3300014326 | Ga0157380_10001753 | Ga0157380_100017535 | 280 |
| 281 | 3300025926 | Ga0207659_10171516 | Ga0207659_101715163 | 280 |
| 282 | 3300025933 | Ga0207706_10009425 | Ga0207706_1000942510 | 280 |
| 283 | 3300025936 | Ga0207670_10133106 | Ga0207670_101331061 | 280 |
| 284 | 3300025940 | Ga0207691_10115681 | Ga0207691_101156813 | 280 |
| 285 | 3300025960 | Ga0207651_10085082 | Ga0207651_100850823 | 280 |
| 286 | 3300025961 | Ga0207712_10237776 | Ga0207712_102377761 | 280 |
| 287 | 3300026075 | Ga0207708_10065822 | Ga0207708_100658223 | 280 |
| 288 | 3300026116 | Ga0207674_10190757 | Ga0207674_101907572 | 280 |
| 289 | 3300026118 | Ga0207675_100035632 | Ga0207675_1000356324 | 280 |
| 290 | 3300028380 | Ga0268265_10023262 | Ga0268265_100232623 | 280 |
| 291 | 3300042876 | Ga0451577_0309292 | Ga0451577_0309292_446_1303 | 280 |
| 292 | 3300044712 | Ga0453684_0275808 | Ga0453684_0275808_82_939 | 280 |
| 293 | 3300049742 | Ga0501080_0308308 | Ga0501080_0308308_307_1152 | 280 |
| 294 | 3300050511 | nmdc:mga08y16_5986_c1 | nmdc:mga08y16_5986_c1_7602_8453 | 280 |
| 295 | 3300053088 | Ga0500644_0050728 | Ga0500644_0050728_171_1067 | 280 |
| 296 | 3300053108 | Ga0500562_000014 | Ga0500562_000014_42547_43443 | 280 |
| 297 | 3300053730 | Ga0500645_014489 | Ga0500645_014489_1364_2260 | 280 |
| 298 | 3300055283 | Ga0500661_010932 | Ga0500661_010932_648_1544 | 280 |
| 299 | 3300003316 | rootH1_10107000 | rootH1_101070001 | 281 |
| 300 | 3300005327 | Ga0070658_10013559 | Ga0070658_100135594 | 281 |
| 301 | 3300005330 | Ga0070690_100025223 | Ga0070690_1000252233 | 281 |
| 302 | 3300005338 | Ga0068868_100115247 | Ga0068868_1001152472 | 281 |
| 303 | 3300005356 | Ga0070674_100083880 | Ga0070674_1000838802 | 281 |
| 304 | 3300005459 | Ga0068867_100077353 | Ga0068867_1000773531 | 281 |
| 305 | 3300005578 | Ga0068854_100013207 | Ga0068854_1000132072 | 281 |
| 306 | 3300005617 | Ga0068859_100087754 | Ga0068859_1000877542 | 281 |
| 307 | 3300005718 | Ga0068866_10053518 | Ga0068866_100535183 | 281 |
| 308 | 3300005843 | Ga0068860_100100892 | Ga0068860_1001008923 | 281 |
| 309 | 3300006237 | Ga0097621_100457072 | Ga0097621_1004570722 | 281 |
| 310 | 3300006931 | Ga0097620_100087759 | Ga0097620_1000877592 | 281 |
| 311 | 3300009174 | Ga0105241_10678953 | Ga0105241_106789531 | 281 |
| 312 | 3300009545 | Ga0105237_10021415 | Ga0105237_100214156 | 281 |
| 313 | 3300009553 | Ga0105249_10224267 | Ga0105249_102242672 | 281 |
| 314 | 3300010375 | Ga0105239_10019699 | Ga0105239_100196997 | 281 |
| 315 | 3300013100 | Ga0157373_10024191 | Ga0157373_100241911 | 281 |
| 316 | 3300013297 | Ga0157378_10009231 | Ga0157378_100092312 | 281 |
| 317 | 3300025914 | Ga0207671_10143506 | Ga0207671_101435062 | 281 |
| 318 | 3300025918 | Ga0207662_10107084 | Ga0207662_101070842 | 281 |
| 319 | 3300025933 | Ga0207706_10004753 | Ga0207706_100047532 | 281 |
| 320 | 3300025937 | Ga0207669_10071298 | Ga0207669_100712983 | 281 |
| 321 | 3300026023 | Ga0207677_10032967 | Ga0207677_100329673 | 281 |
| 322 | 3300026078 | Ga0207702_10262361 | Ga0207702_102623612 | 281 |
| 323 | 3300026089 | Ga0207648_10295467 | Ga0207648_102954672 | 281 |
| 324 | 3300028381 | Ga0268264_10516366 | Ga0268264_105163661 | 281 |
| 325 | 3300037471 | Ga0395905_0081041 | Ga0395905_0081041_14_862 | 281 |
| 326 | 3300041997 | Ga0439431_0011949 | Ga0439431_0011949_949_1806 | 281 |
| 327 | 3300046460 | Ga0495638_0129623 | Ga0495638_0129623_409_1257 | 281 |
| 328 | 3300053727 | Ga0500611_000007 | Ga0500611_000007_134733_135581 | 281 |
| 329 | 3300003323 | rootH1_10328002 | rootH1_103280022 | 282 |
| 330 | 3300005328 | Ga0070676_10004711 | Ga0070676_100047114 | 282 |
| 331 | 3300005328 | Ga0070676_10006331 | Ga0070676_100063312 | 282 |
| 332 | 3300005328 | Ga0070676_10040532 | Ga0070676_100405322 | 282 |
| 333 | 3300005328 | Ga0070676_10160381 | Ga0070676_101603812 | 282 |
| 334 | 3300005329 | Ga0070683_100014205 | Ga0070683_1000142058 | 282 |
| 335 | 3300005329 | Ga0070683_100126527 | Ga0070683_1001265273 | 282 |
| 336 | 3300005330 | Ga0070690_100062408 | Ga0070690_1000624083 | 282 |
| 337 | 3300005331 | Ga0070670_100033756 | Ga0070670_1000337563 | 282 |
| 338 | 3300005331 | Ga0070670_100119011 | Ga0070670_1001190113 | 282 |
| 339 | 3300005334 | Ga0068869_100006131 | Ga0068869_1000061315 | 282 |
| 340 | 3300005334 | Ga0068869_100012054 | Ga0068869_1000120543 | 282 |
| 341 | 3300005334 | Ga0068869_100034741 | Ga0068869_1000347413 | 282 |
| 342 | 3300005334 | Ga0068869_100054583 | Ga0068869_1000545832 | 282 |
| 343 | 3300005334 | Ga0068869_100143079 | Ga0068869_1001430792 | 282 |
| 344 | 3300005335 | Ga0070666_10019854 | Ga0070666_100198543 | 282 |
| 345 | 3300005338 | Ga0068868_100024389 | Ga0068868_1000243893 | 282 |
| 346 | 3300005338 | Ga0068868_100110032 | Ga0068868_1001100323 | 282 |
| 347 | 3300005338 | Ga0068868_100169887 | Ga0068868_1001698872 | 282 |
| 348 | 3300005340 | Ga0070689_100010609 | Ga0070689_1000106094 | 282 |
| 349 | 3300005344 | Ga0070661_100104499 | Ga0070661_1001044993 | 282 |
| 350 | 3300005347 | Ga0070668_100010902 | Ga0070668_1000109024 | 282 |
| 351 | 3300005347 | Ga0070668_100053460 | Ga0070668_1000534603 | 282 |
| 352 | 3300005353 | Ga0070669_100205981 | Ga0070669_1002059812 | 282 |
| 353 | 3300005354 | Ga0070675_100022437 | Ga0070675_1000224372 | 282 |
| 354 | 3300005354 | Ga0070675_100074350 | Ga0070675_1000743502 | 282 |
| 355 | 3300005355 | Ga0070671_100345397 | Ga0070671_1003453972 | 282 |
| 356 | 3300005355 | Ga0070671_100645111 | Ga0070671_1006451111 | 282 |
| 357 | 3300005356 | Ga0070674_100203555 | Ga0070674_1002035552 | 282 |
| 358 | 3300005365 | Ga0070688_100007912 | Ga0070688_1000079125 | 282 |
| 359 | 3300005366 | Ga0070659_100108695 | Ga0070659_1001086953 | 282 |
| 360 | 3300005367 | Ga0070667_100034699 | Ga0070667_1000346992 | 282 |
| 361 | 3300005367 | Ga0070667_100157916 | Ga0070667_1001579163 | 282 |
| 362 | 3300005456 | Ga0070678_100015390 | Ga0070678_1000153903 | 282 |
| 363 | 3300005457 | Ga0070662_100087690 | Ga0070662_1000876903 | 282 |
| 364 | 3300005459 | Ga0068867_100015133 | Ga0068867_1000151334 | 282 |
| 365 | 3300005459 | Ga0068867_100443321 | Ga0068867_1004433211 | 282 |
| 366 | 3300005466 | Ga0070685_10052610 | Ga0070685_100526101 | 282 |
| 367 | 3300005466 | Ga0070685_10107765 | Ga0070685_101077652 | 282 |
| 368 | 3300005471 | Ga0070698_100002002 | Ga0070698_10000200212 | 282 |
| 369 | 3300005471 | Ga0070698_100035409 | Ga0070698_1000354095 | 282 |
| 370 | 3300005471 | Ga0070698_100112108 | Ga0070698_1001121082 | 282 |
| 371 | 3300005518 | Ga0070699_100106128 | Ga0070699_1001061283 | 282 |
| 372 | 3300005535 | Ga0070684_100004295 | Ga0070684_10000429515 | 282 |
| 373 | 3300005543 | Ga0070672_100024199 | Ga0070672_1000241992 | 282 |
| 374 | 3300005543 | Ga0070672_100091837 | Ga0070672_1000918371 | 282 |
| 375 | 3300005548 | Ga0070665_100009957 | Ga0070665_1000099576 | 282 |
| 376 | 3300005564 | Ga0070664_100016835 | Ga0070664_1000168352 | 282 |
| 377 | 3300005564 | Ga0070664_100108317 | Ga0070664_1001083172 | 282 |
| 378 | 3300005578 | Ga0068854_100169592 | Ga0068854_1001695923 | 282 |
| 379 | 3300005617 | Ga0068859_100134474 | Ga0068859_1001344742 | 282 |
| 380 | 3300005617 | Ga0068859_100189514 | Ga0068859_1001895142 | 282 |
| 381 | 3300005617 | Ga0068859_100217364 | Ga0068859_1002173643 | 282 |
| 382 | 3300005617 | Ga0068859_100313876 | Ga0068859_1003138763 | 282 |
| 383 | 3300005617 | Ga0068859_100405572 | Ga0068859_1004055722 | 282 |
| 384 | 3300005618 | Ga0068864_100011567 | Ga0068864_1000115676 | 282 |
| 385 | 3300005719 | Ga0068861_100333556 | Ga0068861_1003335562 | 282 |
| 386 | 3300005719 | Ga0068861_100485522 | Ga0068861_1004855222 | 282 |
| 387 | 3300005834 | Ga0068851_10143706 | Ga0068851_101437062 | 282 |
| 388 | 3300005841 | Ga0068863_100012212 | Ga0068863_1000122122 | 282 |
| 389 | 3300005841 | Ga0068863_100045074 | Ga0068863_1000450743 | 282 |
| 390 | 3300005841 | Ga0068863_100074658 | Ga0068863_1000746582 | 282 |
| 391 | 3300005841 | Ga0068863_100213815 | Ga0068863_1002138152 | 282 |
| 392 | 3300005841 | Ga0068863_100329996 | Ga0068863_1003299962 | 282 |
| 393 | 3300005841 | Ga0068863_100518719 | Ga0068863_1005187191 | 282 |
| 394 | 3300005842 | Ga0068858_100011998 | Ga0068858_1000119988 | 282 |
| 395 | 3300005843 | Ga0068860_100355876 | Ga0068860_1003558763 | 282 |
| 396 | 3300005844 | Ga0068862_100071715 | Ga0068862_1000717152 | 282 |
| 397 | 3300005844 | Ga0068862_100253057 | Ga0068862_1002530572 | 282 |
| 398 | 3300005844 | Ga0068862_100282414 | Ga0068862_1002824143 | 282 |
| 399 | 3300006237 | Ga0097621_100016881 | Ga0097621_1000168813 | 282 |
| 400 | 3300006358 | Ga0068871_100019444 | Ga0068871_1000194442 | 282 |
| 401 | 3300006358 | Ga0068871_100026349 | Ga0068871_1000263493 | 282 |
| 402 | 3300006358 | Ga0068871_100538224 | Ga0068871_1005382241 | 282 |
| 403 | 3300006844 | Ga0075428_100032601 | Ga0075428_1000326013 | 282 |
| 404 | 3300006846 | Ga0075430_100059017 | Ga0075430_1000590172 | 282 |
| 405 | 3300006880 | Ga0075429_100003601 | Ga0075429_10000360111 | 282 |
| 406 | 3300006880 | Ga0075429_100174503 | Ga0075429_1001745032 | 282 |
| 407 | 3300006881 | Ga0068865_100008908 | Ga0068865_1000089085 | 282 |
| 408 | 3300006881 | Ga0068865_100117880 | Ga0068865_1001178803 | 282 |
| 409 | 3300006931 | Ga0097620_100134478 | Ga0097620_1001344782 | 282 |
| 410 | 3300006931 | Ga0097620_100189514 | Ga0097620_1001895143 | 282 |
| 411 | 3300006931 | Ga0097620_100217370 | Ga0097620_1002173702 | 282 |
| 412 | 3300006931 | Ga0097620_100313910 | Ga0097620_1003139103 | 282 |
| 413 | 3300006931 | Ga0097620_100405590 | Ga0097620_1004055902 | 282 |
| 414 | 3300009101 | Ga0105247_10003345 | Ga0105247_100033452 | 282 |
| 415 | 3300009174 | Ga0105241_10114009 | Ga0105241_101140091 | 282 |
| 416 | 3300009176 | Ga0105242_10023180 | Ga0105242_100231801 | 282 |
| 417 | 3300009176 | Ga0105242_10118442 | Ga0105242_101184422 | 282 |
| 418 | 3300009176 | Ga0105242_10119089 | Ga0105242_101190892 | 282 |
| 419 | 3300009176 | Ga0105242_10312405 | Ga0105242_103124052 | 282 |
| 420 | 3300009553 | Ga0105249_10000420 | Ga0105249_100004207 | 282 |
| 421 | 3300009553 | Ga0105249_10087231 | Ga0105249_100872312 | 282 |
| 422 | 3300009553 | Ga0105249_10095957 | Ga0105249_100959573 | 282 |
| 423 | 3300011119 | Ga0105246_10014260 | Ga0105246_100142604 | 282 |
| 424 | 3300013102 | Ga0157371_10264705 | Ga0157371_102647051 | 282 |
| 425 | 3300013296 | Ga0157374_10012894 | Ga0157374_100128946 | 282 |
| 426 | 3300013296 | Ga0157374_10101119 | Ga0157374_101011192 | 282 |
| 427 | 3300013296 | Ga0157374_10137814 | Ga0157374_101378142 | 282 |
| 428 | 3300013297 | Ga0157378_10067025 | Ga0157378_100670252 | 282 |
| 429 | 3300013297 | Ga0157378_10315552 | Ga0157378_103155523 | 282 |
| 430 | 3300013306 | Ga0163162_10008613 | Ga0163162_100086136 | 282 |
| 431 | 3300013306 | Ga0163162_10473031 | Ga0163162_104730312 | 282 |
| 432 | 3300013307 | Ga0157372_10212140 | Ga0157372_102121403 | 282 |
| 433 | 3300013307 | Ga0157372_10919942 | Ga0157372_109199421 | 282 |
| 434 | 3300013308 | Ga0157375_10012122 | Ga0157375_100121222 | 282 |
| 435 | 3300013308 | Ga0157375_10037185 | Ga0157375_100371854 | 282 |
| 436 | 3300013308 | Ga0157375_10485630 | Ga0157375_104856302 | 282 |
| 437 | 3300014325 | Ga0163163_10003016 | Ga0163163_100030168 | 282 |
| 438 | 3300014325 | Ga0163163_10178049 | Ga0163163_101780492 | 282 |
| 439 | 3300014325 | Ga0163163_10302512 | Ga0163163_103025122 | 282 |
| 440 | 3300014325 | Ga0163163_10333792 | Ga0163163_103337922 | 282 |
| 441 | 3300014326 | Ga0157380_10020060 | Ga0157380_100200604 | 282 |
| 442 | 3300014745 | Ga0157377_10002265 | Ga0157377_100022657 | 282 |
| 443 | 3300014968 | Ga0157379_10007518 | Ga0157379_100075187 | 282 |
| 444 | 3300014968 | Ga0157379_10048815 | Ga0157379_100488153 | 282 |
| 445 | 3300014969 | Ga0157376_10044898 | Ga0157376_100448983 | 282 |
| 446 | 3300014969 | Ga0157376_10105699 | Ga0157376_101056992 | 282 |
| 447 | 3300014969 | Ga0157376_10166362 | Ga0157376_101663621 | 282 |
| 448 | 3300017792 | Ga0163161_10219020 | Ga0163161_102190202 | 282 |
| 449 | 3300025899 | Ga0207642_10132374 | Ga0207642_101323742 | 282 |
| 450 | 3300025903 | Ga0207680_10016078 | Ga0207680_100160783 | 282 |
| 451 | 3300025903 | Ga0207680_10162292 | Ga0207680_101622922 | 282 |
| 452 | 3300025904 | Ga0207647_10035608 | Ga0207647_100356082 | 282 |
| 453 | 3300025907 | Ga0207645_10001091 | Ga0207645_100010918 | 282 |
| 454 | 3300025907 | Ga0207645_10006223 | Ga0207645_100062237 | 282 |
| 455 | 3300025907 | Ga0207645_10020263 | Ga0207645_100202632 | 282 |
| 456 | 3300025923 | Ga0207681_10010679 | Ga0207681_100106793 | 282 |
| 457 | 3300025923 | Ga0207681_10171000 | Ga0207681_101710002 | 282 |
| 458 | 3300025925 | Ga0207650_10021549 | Ga0207650_100215491 | 282 |
| 459 | 3300025925 | Ga0207650_10269440 | Ga0207650_102694402 | 282 |
| 460 | 3300025926 | Ga0207659_10005057 | Ga0207659_100050577 | 282 |
| 461 | 3300025932 | Ga0207690_10208388 | Ga0207690_102083882 | 282 |
| 462 | 3300025933 | Ga0207706_10041290 | Ga0207706_100412904 | 282 |
| 463 | 3300025933 | Ga0207706_10059157 | Ga0207706_100591573 | 282 |
| 464 | 3300025933 | Ga0207706_10225575 | Ga0207706_102255752 | 282 |
| 465 | 3300025934 | Ga0207686_10006720 | Ga0207686_100067204 | 282 |
| 466 | 3300025934 | Ga0207686_10098268 | Ga0207686_100982682 | 282 |
| 467 | 3300025934 | Ga0207686_10176308 | Ga0207686_101763082 | 282 |
| 468 | 3300025936 | Ga0207670_10022427 | Ga0207670_100224274 | 282 |
| 469 | 3300025937 | Ga0207669_10177971 | Ga0207669_101779712 | 282 |
| 470 | 3300025938 | Ga0207704_10044047 | Ga0207704_100440472 | 282 |
| 471 | 3300025940 | Ga0207691_10031073 | Ga0207691_100310732 | 282 |
| 472 | 3300025940 | Ga0207691_10035273 | Ga0207691_100352733 | 282 |
| 473 | 3300025940 | Ga0207691_10229611 | Ga0207691_102296112 | 282 |
| 474 | 3300025942 | Ga0207689_10003186 | Ga0207689_100031869 | 282 |
| 475 | 3300025942 | Ga0207689_10005922 | Ga0207689_1000592212 | 282 |
| 476 | 3300025942 | Ga0207689_10007577 | Ga0207689_100075773 | 282 |
| 477 | 3300025942 | Ga0207689_10013070 | Ga0207689_100130707 | 282 |
| 478 | 3300025942 | Ga0207689_10020523 | Ga0207689_100205236 | 282 |
| 479 | 3300025942 | Ga0207689_10049382 | Ga0207689_100493823 | 282 |
| 480 | 3300025944 | Ga0207661_10025228 | Ga0207661_100252284 | 282 |
| 481 | 3300025945 | Ga0207679_10019754 | Ga0207679_100197543 | 282 |
| 482 | 3300025960 | Ga0207651_10008670 | Ga0207651_100086703 | 282 |
| 483 | 3300025960 | Ga0207651_10174292 | Ga0207651_101742922 | 282 |
| 484 | 3300025961 | Ga0207712_10029701 | Ga0207712_100297013 | 282 |
| 485 | 3300025961 | Ga0207712_10261264 | Ga0207712_102612641 | 282 |
| 486 | 3300025972 | Ga0207668_10055478 | Ga0207668_100554782 | 282 |
| 487 | 3300025972 | Ga0207668_10271638 | Ga0207668_102716382 | 282 |
| 488 | 3300025981 | Ga0207640_10016162 | Ga0207640_100161623 | 282 |
| 489 | 3300025986 | Ga0207658_10007974 | Ga0207658_100079742 | 282 |
| 490 | 3300026023 | Ga0207677_10008388 | Ga0207677_100083882 | 282 |
| 491 | 3300026023 | Ga0207677_10096301 | Ga0207677_100963014 | 282 |
| 492 | 3300026023 | Ga0207677_10160430 | Ga0207677_101604302 | 282 |
| 493 | 3300026041 | Ga0207639_10316485 | Ga0207639_103164852 | 282 |
| 494 | 3300026067 | Ga0207678_10329828 | Ga0207678_103298282 | 282 |
| 495 | 3300026088 | Ga0207641_10003763 | Ga0207641_100037639 | 282 |
| 496 | 3300026088 | Ga0207641_10016956 | Ga0207641_100169563 | 282 |
| 497 | 3300026088 | Ga0207641_10050686 | Ga0207641_100506862 | 282 |
| 498 | 3300026088 | Ga0207641_10315992 | Ga0207641_103159922 | 282 |
| 499 | 3300026089 | Ga0207648_10008111 | Ga0207648_100081117 | 282 |
| 500 | 3300026089 | Ga0207648_10030958 | Ga0207648_100309581 | 282 |
| 501 | 3300026095 | Ga0207676_10001860 | Ga0207676_1000186010 | 282 |
| 502 | 3300026095 | Ga0207676_10197961 | Ga0207676_101979612 | 282 |
| 503 | 3300026116 | Ga0207674_10026708 | Ga0207674_100267086 | 282 |
| 504 | 3300026116 | Ga0207674_10148325 | Ga0207674_101483252 | 282 |
| 505 | 3300026118 | Ga0207675_100034613 | Ga0207675_1000346134 | 282 |
| 506 | 3300026121 | Ga0207683_10001620 | Ga0207683_100016208 | 282 |
| 507 | 3300028379 | Ga0268266_10044700 | Ga0268266_100447002 | 282 |
| 508 | 3300028379 | Ga0268266_10113814 | Ga0268266_101138143 | 282 |
| 509 | 3300028380 | Ga0268265_10100208 | Ga0268265_101002083 | 282 |
| 510 | 3300028380 | Ga0268265_10157733 | Ga0268265_101577332 | 282 |
| 511 | 3300028381 | Ga0268264_10618604 | Ga0268264_106186042 | 282 |
| 512 | 3300031548 | Ga0307408_100108412 | Ga0307408_1001084122 | 282 |
| 513 | 3300031731 | Ga0307405_10106405 | Ga0307405_101064052 | 282 |
| 514 | 3300032005 | Ga0307411_10186619 | Ga0307411_101866192 | 282 |
| 515 | 3300032126 | Ga0307415_100130341 | Ga0307415_1001303412 | 282 |
| 516 | 3300035725 | Ga0373947_0053004 | Ga0373947_0053004_1339_2193 | 282 |
| 517 | 3300039450 | Ga0436363_0254581 | Ga0436363_0254581_33_881 | 282 |
| 518 | 3300042001 | Ga0439441_001337 | Ga0439441_001337_1310_2161 | 282 |
| 519 | 3300047472 | Ga0495686_0046602 | Ga0495686_0046602_398_1249 | 282 |
| 520 | 3300048914 | Ga0496111_0057955 | Ga0496111_0057955_387_1238 | 282 |
| 521 | 3300049568 | Ga0501031_0005264 | Ga0501031_0005264_7304_8158 | 282 |
| 522 | 3300049568 | Ga0501031_0251202 | Ga0501031_0251202_50_901 | 282 |
| 523 | 3300049571 | Ga0501034_0060040 | Ga0501034_0060040_117_971 | 282 |
| 524 | 3300049571 | Ga0501034_0068903 | Ga0501034_0068903_840_1691 | 282 |
| 525 | 3300049572 | Ga0501036_0001937 | Ga0501036_0001937_132_983 | 282 |
| 526 | 3300049572 | Ga0501036_0044844 | Ga0501036_0044844_382_1236 | 282 |
| 527 | 3300049573 | Ga0501037_0017452 | Ga0501037_0017452_3900_4754 | 282 |
| 528 | 3300049574 | Ga0501038_0017596 | Ga0501038_0017596_4369_5223 | 282 |
| 529 | 3300049575 | Ga0501039_0061333 | Ga0501039_0061333_1109_1963 | 282 |
| 530 | 3300049579 | Ga0501043_0001561 | Ga0501043_0001561_3903_4754 | 282 |
| 531 | 3300049579 | Ga0501043_0017653 | Ga0501043_0017653_130_984 | 282 |
| 532 | 3300049580 | Ga0501046_0025302 | Ga0501046_0025302_400_1251 | 282 |
| 533 | 3300049580 | Ga0501046_0227448 | Ga0501046_0227448_248_1102 | 282 |
| 534 | 3300049581 | Ga0501047_0065912 | Ga0501047_0065912_1254_2105 | 282 |
| 535 | 3300049588 | Ga0501072_0346248 | Ga0501072_0346248_74_928 | 282 |
| 536 | 3300049589 | Ga0501073_0017109 | Ga0501073_0017109_3354_4205 | 282 |
| 537 | 3300049590 | Ga0501074_0002078 | Ga0501074_0002078_12892_13743 | 282 |
| 538 | 3300049668 | Ga0501233_029508 | Ga0501233_029508_16_921 | 282 |
| 539 | 3300049669 | Ga0501235_016889 | Ga0501235_016889_461_1393 | 282 |
| 540 | 3300049705 | Ga0501225_0010585 | Ga0501225_0010585_820_1752 | 282 |
| 541 | 3300049742 | Ga0501080_0145178 | Ga0501080_0145178_48_899 | 282 |
| 542 | 3300049822 | Ga0501035_0067220 | Ga0501035_0067220_382_1236 | 282 |
| 543 | 3300049823 | Ga0501044_0019190 | Ga0501044_0019190_4595_5449 | 282 |
| 544 | 3300050493 | nmdc:mga0k408_10779_c1 | nmdc:mga0k408_10779_c1_3564_4415 | 282 |
| 545 | 3300050508 | nmdc:mga09592_233360_c1 | nmdc:mga09592_233360_c1_27_878 | 282 |
| 546 | 3300050508 | nmdc:mga09592_6436_c1 | nmdc:mga09592_6436_c1_3587_4441 | 282 |
| 547 | 3300050509 | nmdc:mga0qj67_23497_c1 | nmdc:mga0qj67_23497_c1_2675_3529 | 282 |
| 548 | 3300053139 | Ga0500568_0000699 | Ga0500568_0000699_22360_23214 | 282 |
| 549 | 3300005290 | Ga0065712_10072296 | Ga0065712_100722963 | 283 |
| 550 | 3300005329 | Ga0070683_100031603 | Ga0070683_1000316033 | 283 |
| 551 | 3300005329 | Ga0070683_100047223 | Ga0070683_1000472232 | 283 |
| 552 | 3300005330 | Ga0070690_100126875 | Ga0070690_1001268751 | 283 |
| 553 | 3300005330 | Ga0070690_100366416 | Ga0070690_1003664161 | 283 |
| 554 | 3300005331 | Ga0070670_100023151 | Ga0070670_1000231512 | 283 |
| 555 | 3300005331 | Ga0070670_100035528 | Ga0070670_1000355283 | 283 |
| 556 | 3300005334 | Ga0068869_100265061 | Ga0068869_1002650611 | 283 |
| 557 | 3300005335 | Ga0070666_10020881 | Ga0070666_100208815 | 283 |
| 558 | 3300005337 | Ga0070682_100070032 | Ga0070682_1000700323 | 283 |
| 559 | 3300005338 | Ga0068868_100133645 | Ga0068868_1001336453 | 283 |
| 560 | 3300005340 | Ga0070689_100062711 | Ga0070689_1000627112 | 283 |
| 561 | 3300005340 | Ga0070689_100375511 | Ga0070689_1003755112 | 283 |
| 562 | 3300005343 | Ga0070687_100057013 | Ga0070687_1000570131 | 283 |
| 563 | 3300005344 | Ga0070661_100008379 | Ga0070661_1000083794 | 283 |
| 564 | 3300005354 | Ga0070675_100099838 | Ga0070675_1000998381 | 283 |
| 565 | 3300005355 | Ga0070671_100116570 | Ga0070671_1001165703 | 283 |
| 566 | 3300005355 | Ga0070671_100228079 | Ga0070671_1002280792 | 283 |
| 567 | 3300005356 | Ga0070674_100543509 | Ga0070674_1005435092 | 283 |
| 568 | 3300005364 | Ga0070673_100088441 | Ga0070673_1000884411 | 283 |
| 569 | 3300005365 | Ga0070688_100173091 | Ga0070688_1001730912 | 283 |
| 570 | 3300005366 | Ga0070659_100005013 | Ga0070659_1000050137 | 283 |
| 571 | 3300005441 | Ga0070700_100247643 | Ga0070700_1002476432 | 283 |
| 572 | 3300005456 | Ga0070678_100136826 | Ga0070678_1001368261 | 283 |
| 573 | 3300005457 | Ga0070662_100097819 | Ga0070662_1000978192 | 283 |
| 574 | 3300005466 | Ga0070685_10002168 | Ga0070685_100021685 | 283 |
| 575 | 3300005535 | Ga0070684_100012723 | Ga0070684_1000127233 | 283 |
| 576 | 3300005535 | Ga0070684_100324587 | Ga0070684_1003245871 | 283 |
| 577 | 3300005539 | Ga0068853_100029228 | Ga0068853_1000292282 | 283 |
| 578 | 3300005564 | Ga0070664_100030899 | Ga0070664_1000308992 | 283 |
| 579 | 3300005564 | Ga0070664_100080284 | Ga0070664_1000802843 | 283 |
| 580 | 3300005564 | Ga0070664_100161286 | Ga0070664_1001612862 | 283 |
| 581 | 3300005577 | Ga0068857_100014588 | Ga0068857_1000145882 | 283 |
| 582 | 3300005616 | Ga0068852_100198651 | Ga0068852_1001986512 | 283 |
| 583 | 3300005618 | Ga0068864_100221115 | Ga0068864_1002211151 | 283 |
| 584 | 3300005618 | Ga0068864_100385602 | Ga0068864_1003856021 | 283 |
| 585 | 3300005841 | Ga0068863_100549508 | Ga0068863_1005495082 | 283 |
| 586 | 3300005842 | Ga0068858_100318253 | Ga0068858_1003182533 | 283 |
| 587 | 3300006358 | Ga0068871_100390039 | Ga0068871_1003900392 | 283 |
| 588 | 3300006844 | Ga0075428_100022471 | Ga0075428_1000224714 | 283 |
| 589 | 3300006844 | Ga0075428_100214831 | Ga0075428_1002148312 | 283 |
| 590 | 3300006846 | Ga0075430_100002260 | Ga0075430_10000226012 | 283 |
| 591 | 3300009094 | Ga0111539_10117098 | Ga0111539_101170983 | 283 |
| 592 | 3300009147 | Ga0114129_10109610 | Ga0114129_101096104 | 283 |
| 593 | 3300009176 | Ga0105242_10103667 | Ga0105242_101036673 | 283 |
| 594 | 3300009545 | Ga0105237_10179045 | Ga0105237_101790453 | 283 |
| 595 | 3300009553 | Ga0105249_10025382 | Ga0105249_100253824 | 283 |
| 596 | 3300009553 | Ga0105249_10204349 | Ga0105249_102043492 | 283 |
| 597 | 3300013100 | Ga0157373_10087139 | Ga0157373_100871393 | 283 |
| 598 | 3300013102 | Ga0157371_10028910 | Ga0157371_100289102 | 283 |
| 599 | 3300013104 | Ga0157370_10314425 | Ga0157370_103144252 | 283 |
| 600 | 3300013296 | Ga0157374_10125421 | Ga0157374_101254214 | 283 |
| 601 | 3300013297 | Ga0157378_10337058 | Ga0157378_103370582 | 283 |
| 602 | 3300013307 | Ga0157372_10077473 | Ga0157372_100774733 | 283 |
| 603 | 3300013307 | Ga0157372_10080354 | Ga0157372_100803543 | 283 |
| 604 | 3300013307 | Ga0157372_10159166 | Ga0157372_101591662 | 283 |
| 605 | 3300013308 | Ga0157375_10013890 | Ga0157375_100138903 | 283 |
| 606 | 3300013308 | Ga0157375_10153406 | Ga0157375_101534062 | 283 |
| 607 | 3300014325 | Ga0163163_10013222 | Ga0163163_100132222 | 283 |
| 608 | 3300014325 | Ga0163163_10024119 | Ga0163163_100241197 | 283 |
| 609 | 3300014745 | Ga0157377_10209909 | Ga0157377_102099092 | 283 |
| 610 | 3300017792 | Ga0163161_10033985 | Ga0163161_100339852 | 283 |
| 611 | 3300025903 | Ga0207680_10095024 | Ga0207680_100950243 | 283 |
| 612 | 3300025913 | Ga0207695_10559335 | Ga0207695_105593352 | 283 |
| 613 | 3300025918 | Ga0207662_10047644 | Ga0207662_100476444 | 283 |
| 614 | 3300025918 | Ga0207662_10197560 | Ga0207662_101975601 | 283 |
| 615 | 3300025920 | Ga0207649_10008073 | Ga0207649_100080735 | 283 |
| 616 | 3300025923 | Ga0207681_10022786 | Ga0207681_100227864 | 283 |
| 617 | 3300025925 | Ga0207650_10002225 | Ga0207650_1000222512 | 283 |
| 618 | 3300025926 | Ga0207659_10530138 | Ga0207659_105301382 | 283 |
| 619 | 3300025931 | Ga0207644_10079049 | Ga0207644_100790492 | 283 |
| 620 | 3300025932 | Ga0207690_10014916 | Ga0207690_100149164 | 283 |
| 621 | 3300025933 | Ga0207706_10006384 | Ga0207706_100063843 | 283 |
| 622 | 3300025934 | Ga0207686_10121110 | Ga0207686_101211103 | 283 |
| 623 | 3300025936 | Ga0207670_10105423 | Ga0207670_101054232 | 283 |
| 624 | 3300025938 | Ga0207704_10078807 | Ga0207704_100788073 | 283 |
| 625 | 3300025941 | Ga0207711_10591928 | Ga0207711_105919282 | 283 |
| 626 | 3300025942 | Ga0207689_10051330 | Ga0207689_100513302 | 283 |
| 627 | 3300025944 | Ga0207661_10410212 | Ga0207661_104102122 | 283 |
| 628 | 3300025945 | Ga0207679_10001356 | Ga0207679_100013564 | 283 |
| 629 | 3300025945 | Ga0207679_10357794 | Ga0207679_103577942 | 283 |
| 630 | 3300025960 | Ga0207651_10167875 | Ga0207651_101678752 | 283 |
| 631 | 3300025961 | Ga0207712_10003129 | Ga0207712_100031295 | 283 |
| 632 | 3300026023 | Ga0207677_10090832 | Ga0207677_100908322 | 283 |
| 633 | 3300026023 | Ga0207677_10155902 | Ga0207677_101559022 | 283 |
| 634 | 3300026041 | Ga0207639_10124368 | Ga0207639_101243682 | 283 |
| 635 | 3300026075 | Ga0207708_10091909 | Ga0207708_100919093 | 283 |
| 636 | 3300026089 | Ga0207648_10419658 | Ga0207648_104196582 | 283 |
| 637 | 3300026095 | Ga0207676_10282425 | Ga0207676_102824252 | 283 |
| 638 | 3300026116 | Ga0207674_10013230 | Ga0207674_100132302 | 283 |
| 639 | 3300026118 | Ga0207675_100120456 | Ga0207675_1001204562 | 283 |
| 640 | 3300026121 | Ga0207683_10061304 | Ga0207683_100613043 | 283 |
| 641 | 3300026142 | Ga0207698_10097345 | Ga0207698_100973451 | 283 |
| 642 | 3300027907 | Ga0207428_10117749 | Ga0207428_101177493 | 283 |
| 643 | 3300031824 | Ga0307413_10340193 | Ga0307413_103401932 | 283 |
| 644 | 3300035724 | Ga0373933_0307821 | Ga0373933_0307821_99_1010 | 283 |
| 645 | 3300035725 | Ga0373947_0128168 | Ga0373947_0128168_482_1393 | 283 |
| 646 | 3300037471 | Ga0395905_0002824 | Ga0395905_0002824_2897_3748 | 283 |
| 647 | 3300037471 | Ga0395905_0060659 | Ga0395905_0060659_2669_3520 | 283 |
| 648 | 3300044712 | Ga0453684_0043874 | Ga0453684_0043874_2595_3446 | 283 |
| 649 | 3300045049 | Ga0466959_0056211 | Ga0466959_0056211_1198_2049 | 283 |
| 650 | 3300045051 | Ga0451576_0190376 | Ga0451576_0190376_171_1022 | 283 |
| 651 | 3300046516 | Ga0495628_0047488 | Ga0495628_0047488_1304_2215 | 283 |
| 652 | 3300046539 | Ga0495621_0035434 | Ga0495621_0035434_266_1123 | 283 |
| 653 | 3300046648 | Ga0495611_0068844 | Ga0495611_0068844_473_1330 | 283 |
| 654 | 3300047320 | Ga0495672_0024735 | Ga0495672_0024735_1690_2544 | 283 |
| 655 | 3300050507 | nmdc:mga05p37_180002_c1 | nmdc:mga05p37_180002_c1_146_1003 | 283 |
| 656 | 3300050511 | nmdc:mga08y16_224434_c1 | nmdc:mga08y16_224434_c1_785_1642 | 283 |
| 657 | 3300053085 | Ga0495619_0088244 | Ga0495619_0088244_250_1107 | 283 |
| 658 | 3300053156 | Ga0500622_0001206 | Ga0500622_0001206_753_1661 | 283 |
| 659 | 3300005441 | Ga0070700_100239671 | Ga0070700_1002396711 | 284 |
| 660 | 3300013307 | Ga0157372_10207862 | Ga0157372_102078622 | 284 |
| 661 | 3300026142 | Ga0207698_10153393 | Ga0207698_101533932 | 284 |
| 662 | 3300001904 | JGI24736J21556_1023873 | JGI24736J21556_10238731 | 285 |
| 663 | 3300005577 | Ga0068857_100388996 | Ga0068857_1003889962 | 285 |
| 664 | 3300005616 | Ga0068852_100004128 | Ga0068852_1000041285 | 285 |
| 665 | 3300013102 | Ga0157371_10028726 | Ga0157371_100287262 | 285 |
| 666 | 3300013104 | Ga0157370_10311856 | Ga0157370_103118562 | 285 |
| 667 | 3300013105 | Ga0157369_10075048 | Ga0157369_100750482 | 285 |
| 668 | 3300013105 | Ga0157369_10337435 | Ga0157369_103374352 | 285 |
| 669 | 3300013307 | Ga0157372_10328134 | Ga0157372_103281342 | 285 |
| 670 | 3300025904 | Ga0207647_10000208 | Ga0207647_1000020829 | 285 |
| 671 | 3300026116 | Ga0207674_10062174 | Ga0207674_100621742 | 285 |
| 672 | 3300026142 | Ga0207698_10007763 | Ga0207698_100077634 | 285 |
| 673 | 3300049652 | Ga0501202_000361 | Ga0501202_000361_4725_5582 | 285 |
| 674 | 3300049653 | Ga0501206_000286 | Ga0501206_000286_2162_3019 | 285 |
| 675 | 3300049668 | Ga0501233_000938 | Ga0501233_000938_399_1256 | 285 |
| 676 | 3300049669 | Ga0501235_000670 | Ga0501235_000670_84_941 | 285 |
| 677 | 3300049675 | Ga0501243_000661 | Ga0501243_000661_3580_4437 | 285 |
| 678 | 3300049688 | Ga0501259_000248 | Ga0501259_000248_5374_6258 | 285 |
| 679 | 3300049704 | Ga0501221_005253 | Ga0501221_005253_1057_1914 | 285 |
| 680 | 3300049707 | Ga0501234_007821 | Ga0501234_007821_164_1021 | 285 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hs7-assembly1.cif.gz_A | reduced form of the transcriptional regulator yodb from b. subtilis | 0.7102 | 206 | 283 |
| 2fsw-assembly1.cif.gz_A | crystal structure of the putative transcriptional regualator, marr family from porphyromonas gingivalis w83 | 0.7038 | 201 | 283 |
| 3pno-assembly2.cif.gz_D | crystal structure of e.coli dha kinase dhak (h56n) | 0.6972 | 89 | 128 |
| 3pnm-assembly1.cif.gz_B | crystal structure of e.coli dha kinase dhak (h56a) | 0.6966 | 89 | 128 |
| 5x11-assembly3.cif.gz_D | crystal structure of bacillus subtilis padr in complex with operator dna | 0.6893 | 205 | 279 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q26454_780_865_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8126 | 214 | 264 | 1.10.10.10 |
| af_A4I3U0_697_766_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.7877 | 202 | 268 | 1.10.10.10 |
| af_P9WN87_5_83_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.7848 | 202 | 266 | 1.10.10.10 |
| af_P41411_476_572_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.7611 | 202 | 280 | 1.10.10.10 |
| af_Q7X7L0_458_587_1.10.10.1420 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DNA replication factor Cdt1, C-terminal WH domain | 0.7589 | 214 | 269 | 1.10.10.1420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5Z693-F1-model_v4 | DUF1835 domain-containing protein | 0.9889 | 1 | 122 |
|
| AF-A0A4V1UUL4-F1-model_v4 | DUF1835 domain-containing protein | 0.9767 | 1 | 236 |
|
| AF-A0A4Q3RAT1-F1-model_v4 | DUF1835 domain-containing protein | 0.9755 | 55 | 269 |
|
| AF-A0A4R4E8N4-F1-model_v4 | DUF1835 domain-containing protein | 0.9693 | 1 | 269 |
|
| AF-A0A2W5FAJ5-F1-model_v4 | DUF1835 domain-containing protein | 0.9692 | 1 | 161 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar