F474808

General Info

Members Datasets Scaffolds Average Seq Length
680 242 679 280

Family's Representative Sequence

Representative Sequence 3300049669|Ga0501235_016889|Ga0501235_016889_461_1393
Length 310
Sequence LKLFIDAKLMSEKATKSKETKTPPPPTSKVHLVFQEADVAVLTGAIELDETLQGEVIQIKDDYAVGPIENIFDAEGWQQRKQWWTNLLQQSPYNVELSDMIDDRMTVHNLKKRLDENEREEVWIWMGQNAHDVCGYYWLISQLKDYQGRVQVLYMNNLPFINEKGQLFYPTQLHEIQPKEFIKAKKLCRKVTLSEFEIDPDEWKRLAGENSMVRILEGGKKIASKGEDFYDADVLKGLTNEWQKGNKAMNSILSKMKIKTGDVFLLERMKRLAEEGRIEINGDTSKSWKDFEVKLKSAAPAEAPAEQPNM

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
166 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
167 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
168 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
169 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
170 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
173 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
213 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
214 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
215 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
216 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
217 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
218 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
219 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
220 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
221 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
222 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
235 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
236 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
237 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
240 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
241 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
242 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.91
Nodule 0
Rhizoplane 0.88
Rhizosphere 94.41
Stem 0
Stem Tuber 0
Unclassified 2.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1023873 3300001904 Bacteria 955
2 rootH1_10107000 3300003316 Bacteria 2394
3 rootH2_10074975 3300003320 Bacteria 4771
4 rootH2_10169461 3300003320 Bacteria 1419
5 rootH2_10232842 3300003320 Bacteria 1145
6 rootH1_10000226 3300003316 Bacteria 5709
7 rootH1_10000226 3300003323 Bacteria 32201
8 rootH1_10285025 3300003323 Bacteria 1413
9 rootH1_10328002 3300003323 Bacteria 1219
10 JGI25160J50197_1003244 3300003354 Bacteria 7338
11 Ga0065712_10006615 3300005290 Bacteria 3599
12 Ga0065712_10072296 3300005290 Bacteria 4820
13 Ga0070658_10013559 3300005327 Bacteria 6539
14 Ga0070658_10171275 3300005327 Bacteria 1824
15 Ga0070676_10004711 3300005328 Bacteria 7211
16 Ga0070676_10006331 3300005328 Bacteria 6323
17 Ga0070676_10040532 3300005328 Bacteria 2697
18 Ga0070676_10160381 3300005328 Bacteria 1447
19 Ga0070683_100014205 3300005329 Bacteria 6958
20 Ga0070683_100031603 3300005329 Bacteria 4816
21 Ga0070683_100047223 3300005329 Bacteria 3978
22 Ga0070683_100126527 3300005329 Bacteria 2416
23 Ga0070683_100288413 3300005329 Bacteria 1561
24 Ga0070690_100025223 3300005330 Bacteria 3660
25 Ga0070690_100062408 3300005330 Bacteria 2403
26 Ga0070690_100126875 3300005330 Unclassified 1719
27 Ga0070690_100366416 3300005330 Bacteria 1050
28 Ga0070670_100023151 3300005331 Bacteria 5347
29 Ga0070670_100033756 3300005331 Bacteria 4406
30 Ga0070670_100035528 3300005331 Bacteria 4290
31 Ga0070670_100063227 3300005331 Bacteria 3176
32 Ga0070670_100099753 3300005331 Bacteria 2499
33 Ga0070670_100119011 3300005331 Unclassified 2278
34 Ga0070670_100169303 3300005331 Bacteria 1895
35 Ga0068869_100005339 3300005334 Bacteria 8078
36 Ga0068869_100006131 3300005334 Bacteria 7608
37 Ga0068869_100012054 3300005334 Bacteria 5696
38 Ga0068869_100016147 3300005334 Bacteria 5029
39 Ga0068869_100034741 3300005334 Bacteria 3569
40 Ga0068869_100054583 3300005334 Bacteria 2909
41 Ga0068869_100143079 3300005334 Bacteria 1849
42 Ga0068869_100265061 3300005334 Bacteria 1376
43 Ga0070666_10000028 3300005335 Bacteria 144796
44 Ga0070666_10019854 3300005335 Bacteria 4341
45 Ga0070666_10020881 3300005335 Bacteria 4238
46 Ga0070666_10048345 3300005335 Bacteria 2858
47 Ga0070680_100082093 3300005336 Bacteria 2660
48 Ga0070682_100070032 3300005337 Bacteria 2241
49 Ga0070682_100286152 3300005337 Bacteria 1204
50 Ga0068868_100024389 3300005338 Bacteria 4588
51 Ga0068868_100110032 3300005338 Bacteria 2238
52 Ga0068868_100115247 3300005338 Bacteria 2187
53 Ga0068868_100133645 3300005338 Bacteria 2032
54 Ga0068868_100169887 3300005338 Bacteria 1805
55 Ga0070660_100048594 3300005339 Bacteria 3259
56 Ga0070660_100130723 3300005339 Unclassified 2009
57 Ga0070689_100006441 3300005340 Bacteria 8122
58 Ga0070689_100010609 3300005340 Bacteria 6568
59 Ga0070689_100062711 3300005340 Bacteria 2893
60 Ga0070689_100375511 3300005340 Bacteria 1197
61 Ga0070687_100057013 3300005343 Bacteria 2047
62 Ga0070661_100008379 3300005344 Bacteria 7142
63 Ga0070661_100104499 3300005344 Bacteria 2110
64 Ga0070668_100010902 3300005347 Bacteria 6764
65 Ga0070668_100053460 3300005347 Bacteria 3115
66 Ga0070669_100015799 3300005353 Bacteria 5383
67 Ga0070669_100205981 3300005353 Bacteria 1550
68 Ga0070675_100022437 3300005354 Bacteria 5044
69 Ga0070675_100037894 3300005354 Bacteria 3929
70 Ga0070675_100074350 3300005354 Bacteria 2823
71 Ga0070675_100099838 3300005354 Bacteria 2444
72 Ga0070671_100025128 3300005355 Bacteria 4884
73 Ga0070671_100116570 3300005355 Bacteria 2245
74 Ga0070671_100129556 3300005355 Bacteria 2125
75 Ga0070671_100180631 3300005355 Bacteria 1786
76 Ga0070671_100228079 3300005355 Bacteria 1580
77 Ga0070671_100263296 3300005355 Bacteria 1465
78 Ga0070671_100317093 3300005355 Bacteria 1328
79 Ga0070671_100345397 3300005355 Bacteria 1270
80 Ga0070671_100645111 3300005355 Bacteria 916
81 Ga0070674_100083880 3300005356 Bacteria 2283
82 Ga0070674_100203555 3300005356 Bacteria 1530
83 Ga0070674_100543509 3300005356 Bacteria 974
84 Ga0070673_100030366 3300005364 Bacteria 4043
85 Ga0070673_100065354 3300005364 Bacteria 2901
86 Ga0070673_100088441 3300005364 Bacteria 2527
87 Ga0070688_100007912 3300005365 Bacteria 5748
88 Ga0070688_100173091 3300005365 Bacteria 1492
89 Ga0070688_100290393 3300005365 Bacteria 1178
90 Ga0070688_100387685 3300005365 Bacteria 1031
91 Ga0070659_100005013 3300005366 Bacteria 9493
92 Ga0070659_100108695 3300005366 Bacteria 2238
93 Ga0070667_100008264 3300005367 Bacteria 8626
94 Ga0070667_100008748 3300005367 Bacteria 8391
95 Ga0070667_100011426 3300005367 Bacteria 7342
96 Ga0070667_100034699 3300005367 Bacteria 4223
97 Ga0070667_100157916 3300005367 Bacteria 1996
98 Ga0070705_100198925 3300005440 Bacteria 1372
99 Ga0070700_100239671 3300005441 Bacteria 1295
100 Ga0070700_100247643 3300005441 Bacteria 1277
101 Ga0070678_100015390 3300005456 Bacteria 4861
102 Ga0070678_100136826 3300005456 Bacteria 1954
103 Ga0070662_100019599 3300005457 Bacteria 4594
104 Ga0070662_100087690 3300005457 Bacteria 2330
105 Ga0070662_100097819 3300005457 Bacteria 2215
106 Ga0070681_10063001 3300005458 Bacteria 3681
107 Ga0070681_10078745 3300005458 Bacteria 3253
108 Ga0070681_10257096 3300005458 Bacteria 1658
109 Ga0068867_100015133 3300005459 Bacteria 5471
110 Ga0068867_100032598 3300005459 Bacteria 3769
111 Ga0068867_100077353 3300005459 Bacteria 2500
112 Ga0068867_100114404 3300005459 Bacteria 2077
113 Ga0068867_100320104 3300005459 Bacteria 1285
114 Ga0068867_100443321 3300005459 Bacteria 1104
115 Ga0070685_10002168 3300005466 Bacteria 10124
116 Ga0070685_10052610 3300005466 Bacteria 2357
117 Ga0070685_10107765 3300005466 Unclassified 1711
118 Ga0070685_10324846 3300005466 Bacteria 1044
119 Ga0070698_100002002 3300005471 Bacteria 22614
120 Ga0070698_100035409 3300005471 Bacteria 5163
121 Ga0070698_100112108 3300005471 Bacteria 2693
122 Ga0070699_100106128 3300005518 Bacteria 2464
123 Ga0070679_100000775 3300005530 Bacteria 27764
124 Ga0070679_100403672 3300005530 Bacteria 1312
125 Ga0070684_100004295 3300005535 Bacteria 10813
126 Ga0070684_100012723 3300005535 Bacteria 6754
127 Ga0070684_100324587 3300005535 Bacteria 1414
128 Ga0068853_100029228 3300005539 Bacteria 4644
129 Ga0068853_100090821 3300005539 Bacteria 2684
130 Ga0068853_100422376 3300005539 Bacteria 1250
131 Ga0070672_100024199 3300005543 Bacteria 4484
132 Ga0070672_100084098 3300005543 Bacteria 2555
133 Ga0070672_100091837 3300005543 Bacteria 2450
134 Ga0070672_100159067 3300005543 Bacteria 1873
135 Ga0070672_100218344 3300005543 Bacteria 1598
136 Ga0070665_100009957 3300005548 Bacteria 9616
137 Ga0068855_100169778 3300005563 Bacteria 2471
138 Ga0070664_100016835 3300005564 Bacteria 6000
139 Ga0070664_100030899 3300005564 Bacteria 4471
140 Ga0070664_100080284 3300005564 Bacteria 2809
141 Ga0070664_100108317 3300005564 Bacteria 2423
142 Ga0070664_100161286 3300005564 Bacteria 1984
143 Ga0068857_100014588 3300005577 Bacteria 6855
144 Ga0068857_100125079 3300005577 Bacteria 2317
145 Ga0068857_100388996 3300005577 Bacteria 1296
146 Ga0068854_100013207 3300005578 Bacteria 5412
147 Ga0068854_100134910 3300005578 Bacteria 1889
148 Ga0068854_100169592 3300005578 Unclassified 1697
149 Ga0068852_100000704 3300005616 Bacteria 21853
150 Ga0068852_100004128 3300005616 Bacteria 10225
151 Ga0068852_100124099 3300005616 Bacteria 2368
152 Ga0068852_100198651 3300005616 Bacteria 1897
153 Ga0068852_100310537 3300005616 Bacteria 1529
154 Ga0068859_100000012 3300005617 Bacteria 300376
155 Ga0068859_100022888 3300005617 Bacteria 6265
156 Ga0068859_100087754 3300005617 Unclassified 3159
157 Ga0068859_100134474 3300005617 Bacteria 2544
158 Ga0068859_100189514 3300005617 Bacteria 2141
159 Ga0068859_100217364 3300005617 Bacteria 1999
160 Ga0068859_100313876 3300005617 Bacteria 1661
161 Ga0068859_100405572 3300005617 Bacteria 1459
162 Ga0068864_100004494 3300005618 Bacteria 11474
163 Ga0068864_100011567 3300005618 Bacteria 7288
164 Ga0068864_100221115 3300005618 Bacteria 1747
165 Ga0068864_100385602 3300005618 Bacteria 1329
166 Ga0068866_10053518 3300005718 Bacteria 2064
167 Ga0068861_100004190 3300005719 Bacteria 9669
168 Ga0068861_100333556 3300005719 Bacteria 1325
169 Ga0068861_100485522 3300005719 Bacteria 1114
170 Ga0068861_100737724 3300005719 Bacteria 919
171 Ga0068851_10134010 3300005834 Bacteria 1342
172 Ga0068851_10143706 3300005834 Bacteria 1299
173 Ga0068863_100001512 3300005841 Bacteria 22973
174 Ga0068863_100012212 3300005841 Bacteria 8295
175 Ga0068863_100024031 3300005841 Bacteria 5816
176 Ga0068863_100045074 3300005841 Bacteria 4185
177 Ga0068863_100048701 3300005841 Bacteria 4018
178 Ga0068863_100074658 3300005841 Bacteria 3208
179 Ga0068863_100213815 3300005841 Bacteria 1857
180 Ga0068863_100329996 3300005841 Bacteria 1483
181 Ga0068863_100518719 3300005841 Bacteria 1175
182 Ga0068863_100549508 3300005841 Bacteria 1140
183 Ga0068858_100002978 3300005842 Bacteria 16996
184 Ga0068858_100011998 3300005842 Bacteria 8168
185 Ga0068858_100318253 3300005842 Bacteria 1486
186 Ga0068860_100002797 3300005843 Bacteria 18148
187 Ga0068860_100003548 3300005843 Bacteria 16042
188 Ga0068860_100032839 3300005843 Bacteria 4985
189 Ga0068860_100100892 3300005843 Bacteria 2754
190 Ga0068860_100355876 3300005843 Bacteria 1442
191 Ga0068862_100024052 3300005844 Bacteria 5107
192 Ga0068862_100071715 3300005844 Bacteria 2991
193 Ga0068862_100123684 3300005844 Bacteria 2282
194 Ga0068862_100253057 3300005844 Bacteria 1606
195 Ga0068862_100282414 3300005844 Bacteria 1522
196 Ga0075366_10009549 3300006195 Bacteria 5419
197 Ga0097621_100001409 3300006237 Bacteria 16566
198 Ga0097621_100002163 3300006237 Bacteria 13450
199 Ga0097621_100016881 3300006237 Bacteria 5532
200 Ga0097621_100457072 3300006237 Bacteria 1151
201 Ga0068871_100013859 3300006358 Bacteria 5994
202 Ga0068871_100019444 3300006358 Bacteria 5185
203 Ga0068871_100026349 3300006358 Bacteria 4535
204 Ga0068871_100030255 3300006358 Bacteria 4262
205 Ga0068871_100155161 3300006358 Bacteria 1955
206 Ga0068871_100180271 3300006358 Bacteria 1815
207 Ga0068871_100339752 3300006358 Bacteria 1326
208 Ga0068871_100390039 3300006358 Bacteria 1238
209 Ga0068871_100538224 3300006358 Bacteria 1056
210 Ga0075428_100022471 3300006844 Bacteria 6985
211 Ga0075428_100032601 3300006844 Bacteria 5754
212 Ga0075428_100214831 3300006844 Bacteria 2078
213 Ga0075430_100002260 3300006846 Bacteria 15962
214 Ga0075430_100059017 3300006846 Bacteria 3225
215 Ga0075431_100008390 3300006847 Bacteria 10338
216 Ga0075429_100003601 3300006880 Bacteria 13205
217 Ga0075429_100032473 3300006880 Bacteria 4537
218 Ga0075429_100174503 3300006880 Bacteria 1883
219 Ga0068865_100008908 3300006881 Bacteria 6206
220 Ga0068865_100017895 3300006881 Bacteria 4564
221 Ga0068865_100019539 3300006881 Bacteria 4385
222 Ga0068865_100117880 3300006881 Unclassified 1969
223 Ga0068865_100165884 3300006881 Bacteria 1689
224 Ga0068865_100385459 3300006881 Bacteria 1144
225 Ga0097620_100000012 3300006931 Bacteria 300376
226 Ga0097620_100022888 3300006931 Bacteria 6265
227 Ga0097620_100087759 3300006931 Unclassified 3159
228 Ga0097620_100134478 3300006931 Bacteria 2544
229 Ga0097620_100189514 3300006931 Bacteria 2141
230 Ga0097620_100217370 3300006931 Bacteria 1999
231 Ga0097620_100313910 3300006931 Bacteria 1661
232 Ga0097620_100405590 3300006931 Bacteria 1459
233 Ga0111539_10083796 3300009094 Bacteria 3749
234 Ga0111539_10117098 3300009094 Bacteria 3123
235 Ga0105247_10003345 3300009101 Bacteria 10493
236 Ga0105247_10006796 3300009101 Bacteria 7054
237 Ga0114129_10030026 3300009147 Bacteria 7696
238 Ga0114129_10109610 3300009147 Bacteria 3811
239 Ga0105243_10296311 3300009148 Bacteria 1464
240 Ga0105241_10004934 3300009174 Bacteria 9837
241 Ga0105241_10114009 3300009174 Bacteria 2167
242 Ga0105241_10678953 3300009174 Bacteria 938
243 Ga0105242_10023180 3300009176 Bacteria 4894
244 Ga0105242_10103667 3300009176 Bacteria 2414
245 Ga0105242_10118442 3300009176 Bacteria 2268
246 Ga0105242_10119089 3300009176 Bacteria 2263
247 Ga0105242_10312405 3300009176 Bacteria 1439
248 Ga0105248_10042644 3300009177 Bacteria 5089
249 Ga0105237_10004851 3300009545 Bacteria 15445
250 Ga0105237_10021415 3300009545 Bacteria 6647
251 Ga0105237_10129647 3300009545 Bacteria 2516
252 Ga0105237_10163055 3300009545 Bacteria 2228
253 Ga0105237_10179045 3300009545 Bacteria 2120
254 Ga0105249_10000420 3300009553 Bacteria 40445
255 Ga0105249_10002025 3300009553 Bacteria 17583
256 Ga0105249_10007898 3300009553 Bacteria 9271
257 Ga0105249_10025382 3300009553 Bacteria 5334
258 Ga0105249_10049524 3300009553 Bacteria 3831
259 Ga0105249_10087231 3300009553 Bacteria 2911
260 Ga0105249_10095957 3300009553 Bacteria 2781
261 Ga0105249_10204349 3300009553 Bacteria 1935
262 Ga0105249_10224267 3300009553 Bacteria 1851
263 Ga0105239_10019699 3300010375 Bacteria 7446
264 Ga0105246_10014260 3300011119 Bacteria 4996
265 Ga0105246_10101038 3300011119 Bacteria 2100
266 Ga0105246_10110369 3300011119 Bacteria 2020
267 Ga0157373_10002524 3300013100 Bacteria 13931
268 Ga0157373_10024191 3300013100 Bacteria 4401
269 Ga0157373_10087139 3300013100 Bacteria 2200
270 Ga0157373_10121441 3300013100 Bacteria 1836
271 Ga0157373_10200126 3300013100 Bacteria 1408
272 Ga0157371_10001703 3300013102 Bacteria 22394
273 Ga0157371_10028726 3300013102 Bacteria 4025
274 Ga0157371_10028910 3300013102 Bacteria 4013
275 Ga0157371_10058825 3300013102 Unclassified 2726
276 Ga0157371_10061575 3300013102 Bacteria 2660
277 Ga0157371_10201140 3300013102 Bacteria 1428
278 Ga0157371_10264705 3300013102 Bacteria 1240
279 Ga0157370_10008487 3300013104 Bacteria 11082
280 Ga0157370_10160908 3300013104 Bacteria 2089
281 Ga0157370_10311856 3300013104 Bacteria 1451
282 Ga0157370_10314425 3300013104 Bacteria 1445
283 Ga0157370_10408724 3300013104 Bacteria 1249
284 Ga0157370_10412029 3300013104 Bacteria 1243
285 Ga0157369_10015500 3300013105 Bacteria 8589
286 Ga0157369_10065596 3300013105 Bacteria 3907
287 Ga0157369_10075048 3300013105 Bacteria 3626
288 Ga0157369_10171175 3300013105 Bacteria 2288
289 Ga0157369_10337435 3300013105 Bacteria 1566
290 Ga0157374_10012894 3300013296 Bacteria 7281
291 Ga0157374_10063447 3300013296 Bacteria 3465
292 Ga0157374_10101119 3300013296 Unclassified 2764
293 Ga0157374_10125421 3300013296 Bacteria 2482
294 Ga0157374_10137814 3300013296 Bacteria 2367
295 Ga0157378_10009231 3300013297 Bacteria 8591
296 Ga0157378_10024651 3300013297 Bacteria 5296
297 Ga0157378_10035213 3300013297 Bacteria 4428
298 Ga0157378_10059212 3300013297 Bacteria 3417
299 Ga0157378_10062316 3300013297 Bacteria 3330
300 Ga0157378_10067025 3300013297 Bacteria 3216
301 Ga0157378_10315552 3300013297 Bacteria 1517
302 Ga0157378_10337058 3300013297 Bacteria 1469
303 Ga0163162_10000634 3300013306 Bacteria 32545
304 Ga0163162_10002367 3300013306 Bacteria 17719
305 Ga0163162_10005072 3300013306 Bacteria 12692
306 Ga0163162_10005374 3300013306 Bacteria 12369
307 Ga0163162_10008613 3300013306 Bacteria 9941
308 Ga0163162_10084029 3300013306 Bacteria 3258
309 Ga0163162_10266675 3300013306 Bacteria 1844
310 Ga0163162_10473031 3300013306 Bacteria 1385
311 Ga0163162_10618616 3300013306 Unclassified 1208
312 Ga0157372_10001143 3300013307 Bacteria 28799
313 Ga0157372_10077473 3300013307 Bacteria 3755
314 Ga0157372_10080354 3300013307 Bacteria 3688
315 Ga0157372_10136851 3300013307 Bacteria 2821
316 Ga0157372_10159166 3300013307 Bacteria 2609
317 Ga0157372_10207862 3300013307 Bacteria 2268
318 Ga0157372_10212140 3300013307 Bacteria 2244
319 Ga0157372_10267939 3300013307 Bacteria 1984
320 Ga0157372_10328134 3300013307 Bacteria 1782
321 Ga0157372_10488223 3300013307 Bacteria 1436
322 Ga0157372_10494275 3300013307 Bacteria 1426
323 Ga0157372_10574450 3300013307 Bacteria 1314
324 Ga0157372_10919942 3300013307 Bacteria 1014
325 Ga0157375_10001279 3300013308 Bacteria 21720
326 Ga0157375_10004004 3300013308 Bacteria 12781
327 Ga0157375_10009214 3300013308 Bacteria 8658
328 Ga0157375_10012122 3300013308 Bacteria 7639
329 Ga0157375_10013890 3300013308 Bacteria 7180
330 Ga0157375_10037185 3300013308 Bacteria 4663
331 Ga0157375_10085652 3300013308 Bacteria 3201
332 Ga0157375_10153406 3300013308 Bacteria 2440
333 Ga0157375_10173340 3300013308 Bacteria 2306
334 Ga0157375_10342348 3300013308 Unclassified 1661
335 Ga0157375_10457868 3300013308 Bacteria 1441
336 Ga0157375_10485630 3300013308 Bacteria 1400
337 Ga0163163_10003016 3300014325 Bacteria 14258
338 Ga0163163_10004016 3300014325 Bacteria 12551
339 Ga0163163_10013222 3300014325 Bacteria 7547
340 Ga0163163_10024119 3300014325 Bacteria 5787
341 Ga0163163_10035462 3300014325 Bacteria 4839
342 Ga0163163_10178049 3300014325 Bacteria 2173
343 Ga0163163_10302512 3300014325 Bacteria 1652
344 Ga0163163_10333792 3300014325 Bacteria 1571
345 Ga0163163_10569004 3300014325 Bacteria 1196
346 Ga0163163_10599474 3300014325 Bacteria 1165
347 Ga0157380_10001753 3300014326 Bacteria 14320
348 Ga0157380_10020060 3300014326 Bacteria 4992
349 Ga0157380_10025932 3300014326 Bacteria 4448
350 Ga0157380_10702632 3300014326 Bacteria 1016
351 Ga0157380_10794405 3300014326 Bacteria 963
352 Ga0157377_10002265 3300014745 Bacteria 8464
353 Ga0157377_10079694 3300014745 Bacteria 1911
354 Ga0157377_10209909 3300014745 Bacteria 1241
355 Ga0157379_10007518 3300014968 Bacteria 9431
356 Ga0157379_10010845 3300014968 Bacteria 7947
357 Ga0157379_10048815 3300014968 Bacteria 3778
358 Ga0157379_10057804 3300014968 Bacteria 3466
359 Ga0157379_10128810 3300014968 Bacteria 2277
360 Ga0157376_10001014 3300014969 Bacteria 18321
361 Ga0157376_10028372 3300014969 Bacteria 4448
362 Ga0157376_10044898 3300014969 Bacteria 3635
363 Ga0157376_10066103 3300014969 Bacteria 3055
364 Ga0157376_10105699 3300014969 Bacteria 2469
365 Ga0157376_10166362 3300014969 Bacteria 2004
366 Ga0157376_10172549 3300014969 Bacteria 1970
367 Ga0163161_10001416 3300017792 Bacteria 17702
368 Ga0163161_10033985 3300017792 Bacteria 3646
369 Ga0163161_10124070 3300017792 Bacteria 1943
370 Ga0163161_10219020 3300017792 Bacteria 1473
371 Ga0163161_10303062 3300017792 Bacteria 1259
372 Ga0163161_10447991 3300017792 Bacteria 1043
373 Ga0163161_10613831 3300017792 Bacteria 898
374 Ga0213876_10009071 3300021384 Bacteria 5356
375 Ga0207426_1000002 3300025302 Bacteria 1249660
376 Ga0207697_10093954 3300025315 Bacteria 1273
377 Ga0207642_10132374 3300025899 Bacteria 1303
378 Ga0207710_10019874 3300025900 Bacteria 2867
379 Ga0207680_10000181 3300025903 Bacteria 30852
380 Ga0207680_10016078 3300025903 Bacteria 3920
381 Ga0207680_10095024 3300025903 Bacteria 1904
382 Ga0207680_10162292 3300025903 Bacteria 1500
383 Ga0207647_10000208 3300025904 Bacteria 47976
384 Ga0207647_10035608 3300025904 Bacteria 3171
385 Ga0207685_10026162 3300025905 Bacteria 2025
386 Ga0207645_10001091 3300025907 Bacteria 22388
387 Ga0207645_10006223 3300025907 Bacteria 8576
388 Ga0207645_10020263 3300025907 Bacteria 4355
389 Ga0207705_10007370 3300025909 Bacteria 8088
390 Ga0207705_10024925 3300025909 Bacteria 4269
391 Ga0207705_10243934 3300025909 Unclassified 1369
392 Ga0207707_10068042 3300025912 Bacteria 3103
393 Ga0207707_10431204 3300025912 Bacteria 1129
394 Ga0207695_10418759 3300025913 Bacteria 1224
395 Ga0207695_10559335 3300025913 Bacteria 1025
396 Ga0207671_10002860 3300025914 Bacteria 17911
397 Ga0207671_10143506 3300025914 Bacteria 1841
398 Ga0207662_10047644 3300025918 Unclassified 2539
399 Ga0207662_10107084 3300025918 Bacteria 1739
400 Ga0207662_10197560 3300025918 Bacteria 1300
401 Ga0207657_10021786 3300025919 Bacteria 6021
402 Ga0207657_10123459 3300025919 Unclassified 2129
403 Ga0207649_10008073 3300025920 Bacteria 5728
404 Ga0207652_10014484 3300025921 Bacteria 6389
405 Ga0207652_10182049 3300025921 Bacteria 1888
406 Ga0207652_10310610 3300025921 Bacteria 1423
407 Ga0207681_10010679 3300025923 Bacteria 5634
408 Ga0207681_10022786 3300025923 Bacteria 3998
409 Ga0207681_10171000 3300025923 Bacteria 1647
410 Ga0207650_10002225 3300025925 Bacteria 13543
411 Ga0207650_10021549 3300025925 Bacteria 4554
412 Ga0207650_10089271 3300025925 Bacteria 2352
413 Ga0207650_10269440 3300025925 Bacteria 1383
414 Ga0207659_10005057 3300025926 Bacteria 7996
415 Ga0207659_10171516 3300025926 Bacteria 1712
416 Ga0207659_10530138 3300025926 Bacteria 999
417 Ga0207644_10020465 3300025931 Bacteria 4499
418 Ga0207644_10032824 3300025931 Bacteria 3625
419 Ga0207644_10079049 3300025931 Bacteria 2426
420 Ga0207644_10188320 3300025931 Bacteria 1621
421 Ga0207690_10014916 3300025932 Bacteria 4703
422 Ga0207690_10208388 3300025932 Bacteria 1489
423 Ga0207706_10004753 3300025933 Bacteria 12720
424 Ga0207706_10006384 3300025933 Bacteria 10953
425 Ga0207706_10009425 3300025933 Bacteria 8964
426 Ga0207706_10041290 3300025933 Bacteria 4090
427 Ga0207706_10059157 3300025933 Bacteria 3375
428 Ga0207706_10225575 3300025933 Bacteria 1640
429 Ga0207686_10006720 3300025934 Bacteria 6196
430 Ga0207686_10098268 3300025934 Bacteria 1949
431 Ga0207686_10121110 3300025934 Bacteria 1781
432 Ga0207686_10176308 3300025934 Bacteria 1512
433 Ga0207670_10022427 3300025936 Bacteria 3913
434 Ga0207670_10105423 3300025936 Bacteria 2021
435 Ga0207670_10133106 3300025936 Bacteria 1824
436 Ga0207669_10071298 3300025937 Bacteria 2182
437 Ga0207669_10177971 3300025937 Bacteria 1521
438 Ga0207704_10035091 3300025938 Bacteria 2870
439 Ga0207704_10044047 3300025938 Bacteria 2640
440 Ga0207704_10052069 3300025938 Bacteria 2480
441 Ga0207704_10078807 3300025938 Bacteria 2120
442 Ga0207691_10031073 3300025940 Bacteria 4988
443 Ga0207691_10035273 3300025940 Bacteria 4644
444 Ga0207691_10115681 3300025940 Bacteria 2381
445 Ga0207691_10229611 3300025940 Bacteria 1607
446 Ga0207691_10428509 3300025940 Bacteria 1127
447 Ga0207711_10591928 3300025941 Bacteria 1035
448 Ga0207689_10001188 3300025942 Bacteria 25011
449 Ga0207689_10003186 3300025942 Bacteria 15048
450 Ga0207689_10005922 3300025942 Bacteria 10828
451 Ga0207689_10007577 3300025942 Bacteria 9513
452 Ga0207689_10013070 3300025942 Bacteria 7089
453 Ga0207689_10020523 3300025942 Bacteria 5559
454 Ga0207689_10049382 3300025942 Bacteria 3470
455 Ga0207689_10051330 3300025942 Bacteria 3400
456 Ga0207661_10025228 3300025944 Bacteria 4516
457 Ga0207661_10236980 3300025944 Bacteria 1618
458 Ga0207661_10410212 3300025944 Bacteria 1229
459 Ga0207679_10001356 3300025945 Bacteria 15429
460 Ga0207679_10019754 3300025945 Bacteria 4534
461 Ga0207679_10357794 3300025945 Bacteria 1274
462 Ga0207651_10008670 3300025960 Bacteria 5509
463 Ga0207651_10085082 3300025960 Bacteria 2293
464 Ga0207651_10132297 3300025960 Bacteria 1912
465 Ga0207651_10167875 3300025960 Bacteria 1727
466 Ga0207651_10174292 3300025960 Bacteria 1700
467 Ga0207712_10003129 3300025961 Bacteria 10551
468 Ga0207712_10029701 3300025961 Bacteria 3670
469 Ga0207712_10037434 3300025961 Bacteria 3310
470 Ga0207712_10050074 3300025961 Bacteria 2915
471 Ga0207712_10237776 3300025961 Bacteria 1466
472 Ga0207712_10261264 3300025961 Bacteria 1404
473 Ga0207668_10055478 3300025972 Bacteria 2754
474 Ga0207668_10271638 3300025972 Unclassified 1386
475 Ga0207640_10016162 3300025981 Bacteria 4335
476 Ga0207658_10007974 3300025986 Bacteria 7210
477 Ga0207658_10057520 3300025986 Bacteria 2890
478 Ga0207658_10075328 3300025986 Bacteria 2567
479 Ga0207658_10594561 3300025986 Bacteria 994
480 Ga0207677_10008388 3300026023 Bacteria 5768
481 Ga0207677_10032967 3300026023 Bacteria 3335
482 Ga0207677_10090832 3300026023 Bacteria 2220
483 Ga0207677_10096301 3300026023 Bacteria 2165
484 Ga0207677_10155902 3300026023 Bacteria 1768
485 Ga0207677_10160430 3300026023 Bacteria 1746
486 Ga0207703_10028265 3300026035 Bacteria 4419
487 Ga0207703_10300363 3300026035 Bacteria 1464
488 Ga0207639_10124368 3300026041 Bacteria 2125
489 Ga0207639_10316485 3300026041 Bacteria 1384
490 Ga0207639_10608369 3300026041 Bacteria 1008
491 Ga0207678_10329828 3300026067 Bacteria 1314
492 Ga0207708_10065822 3300026075 Bacteria 2770
493 Ga0207708_10091909 3300026075 Bacteria 2341
494 Ga0207702_10257557 3300026078 Bacteria 1641
495 Ga0207702_10262361 3300026078 Bacteria 1627
496 Ga0207641_10000152 3300026088 Bacteria 98311
497 Ga0207641_10003763 3300026088 Bacteria 13321
498 Ga0207641_10016956 3300026088 Bacteria 5963
499 Ga0207641_10050686 3300026088 Bacteria 3513
500 Ga0207641_10113805 3300026088 Bacteria 2403
501 Ga0207641_10279641 3300026088 Bacteria 1569
502 Ga0207641_10315992 3300026088 Bacteria 1480
503 Ga0207648_10008111 3300026089 Bacteria 10224
504 Ga0207648_10030958 3300026089 Bacteria 4733
505 Ga0207648_10071234 3300026089 Bacteria 3029
506 Ga0207648_10295467 3300026089 Bacteria 1451
507 Ga0207648_10419658 3300026089 Bacteria 1215
508 Ga0207676_10001860 3300026095 Bacteria 15459
509 Ga0207676_10012147 3300026095 Bacteria 6164
510 Ga0207676_10083029 3300026095 Bacteria 2608
511 Ga0207676_10197961 3300026095 Bacteria 1773
512 Ga0207676_10282425 3300026095 Bacteria 1508
513 Ga0207676_10620464 3300026095 Bacteria 1041
514 Ga0207674_10013230 3300026116 Bacteria 9172
515 Ga0207674_10026708 3300026116 Bacteria 6125
516 Ga0207674_10062174 3300026116 Bacteria 3771
517 Ga0207674_10148325 3300026116 Bacteria 2303
518 Ga0207674_10190757 3300026116 Bacteria 1999
519 Ga0207675_100034613 3300026118 Bacteria 4710
520 Ga0207675_100035632 3300026118 Bacteria 4641
521 Ga0207675_100120456 3300026118 Bacteria 2482
522 Ga0207675_100432725 3300026118 Bacteria 1301
523 Ga0207683_10001620 3300026121 Bacteria 20185
524 Ga0207683_10061304 3300026121 Bacteria 3310
525 Ga0207683_10133219 3300026121 Bacteria 2236
526 Ga0207698_10001677 3300026142 Bacteria 12912
527 Ga0207698_10007763 3300026142 Bacteria 6739
528 Ga0207698_10097345 3300026142 Bacteria 2428
529 Ga0207698_10153393 3300026142 Bacteria 2003
530 Ga0207698_10531641 3300026142 Bacteria 1149
531 Ga0207428_10117749 3300027907 Bacteria 2039
532 Ga0268266_10044700 3300028379 Bacteria 3786
533 Ga0268266_10113814 3300028379 Bacteria 2400
534 Ga0268265_10023262 3300028380 Bacteria 4367
535 Ga0268265_10035735 3300028380 Bacteria 3634
536 Ga0268265_10100208 3300028380 Bacteria 2338
537 Ga0268265_10157733 3300028380 Bacteria 1923
538 Ga0268264_10002534 3300028381 Bacteria 16047
539 Ga0268264_10007566 3300028381 Bacteria 9059
540 Ga0268264_10012154 3300028381 Bacteria 7087
541 Ga0268264_10016471 3300028381 Bacteria 6052
542 Ga0268264_10459737 3300028381 Bacteria 1235
543 Ga0268264_10481353 3300028381 Bacteria 1207
544 Ga0268264_10516366 3300028381 Bacteria 1167
545 Ga0268264_10618604 3300028381 Unclassified 1069
546 Ga0307515_10000002 3300028794 Bacteria 1231751
547 Ga0307515_10000039 3300028794 Bacteria 323229
548 Ga0265327_10000383 3300031251 Bacteria 83372
549 Ga0265327_10062371 3300031251 Bacteria 1898
550 Ga0265327_10077826 3300031251 Bacteria 1644
551 Ga0307509_10140026 3300031507 Bacteria 2357
552 Ga0307408_100108412 3300031548 Bacteria 2129
553 Ga0307508_10003392 3300031616 Bacteria 16151
554 Ga0307405_10106405 3300031731 Bacteria 1892
555 Ga0307413_10340193 3300031824 Bacteria 1154
556 Ga0307411_10186619 3300032005 Bacteria 1579
557 Ga0307415_100130341 3300032126 Bacteria 1902
558 Ga0373943_0122291 3300035170 Bacteria 1384
559 Ga0373955_0023419 3300035172 Bacteria 3145
560 Ga0373933_0307821 3300035724 Bacteria 1026
561 Ga0373947_0053004 3300035725 Bacteria 2445
562 Ga0373947_0128168 3300035725 Bacteria 1618
563 Ga0373947_0402773 3300035725 Bacteria 923
564 Ga0395905_0002824 3300037471 Bacteria 19029
565 Ga0395905_0060659 3300037471 Bacteria 3537
566 Ga0395905_0081041 3300037471 Bacteria 3042
567 Ga0436365_0057606 3300039437 Bacteria 895
568 Ga0436365_0219322 3300039437 Bacteria 12459
569 Ga0436363_0254581 3300039450 Bacteria 1206
570 Ga0439438_031985 3300041405 Bacteria 1397
571 Ga0451793_0070710 3300041452 Bacteria 1510
572 Ga0451849_0597552 3300041505 Bacteria 1597
573 Ga0439431_0011949 3300041997 Bacteria 1990
574 Ga0439441_001337 3300042001 Bacteria 3186
575 Ga0439457_011408 3300042014 Bacteria 2022
576 Ga0451577_0041242 3300042876 Bacteria 4143
577 Ga0451577_0309292 3300042876 Bacteria 1432
578 Ga0466972_0000020 3300044658 Bacteria 197336
579 Ga0453683_0089965 3300044673 Bacteria 1924
580 Ga0453684_0043874 3300044712 Bacteria 6000
581 Ga0453684_0275808 3300044712 Bacteria 1919
582 Ga0466970_0000117 3300044765 Bacteria 35460
583 Ga0466957_0000351 3300044842 Bacteria 22557
584 Ga0466959_0056211 3300045049 Bacteria 2872
585 Ga0451576_0190376 3300045051 Bacteria 2143
586 Ga0495592_0064026 3300046454 Bacteria 2696
587 Ga0495638_0129623 3300046460 Bacteria 1483
588 Ga0495651_0262767 3300046462 Bacteria 1174
589 Ga0495664_0141661 3300046477 Bacteria 1458
590 Ga0495628_0047488 3300046516 Bacteria 3406
591 Ga0495621_0035434 3300046539 Bacteria 1729
592 Ga0495667_0042473 3300046559 Bacteria 3015
593 Ga0495668_0003256 3300046616 Bacteria 12342
594 Ga0495611_0068844 3300046648 Bacteria 1616
595 Ga0495635_0171317 3300046663 Bacteria 1476
596 Ga0495600_0044009 3300046809 Bacteria 2913
597 Ga0495672_0024735 3300047320 Bacteria 3863
598 Ga0495686_0046602 3300047472 Bacteria 2740
599 Ga0496100_0016463 3300048903 Bacteria 4343
600 Ga0496101_0382935 3300048904 Unclassified 1107
601 Ga0496109_0607776 3300048912 Bacteria 1030
602 Ga0496111_0057955 3300048914 Bacteria 2804
603 Ga0496114_0072026 3300048917 Bacteria 2906
604 Ga0496124_0135773 3300048927 Bacteria 1948
605 Ga0501031_0005264 3300049568 Bacteria 8434
606 Ga0501031_0251202 3300049568 Bacteria 1149
607 Ga0501032_0018919 3300049569 Bacteria 4819
608 Ga0501032_0117182 3300049569 Bacteria 1761
609 Ga0501033_0076083 3300049570 Bacteria 2464
610 Ga0501033_0212297 3300049570 Bacteria 1380
611 Ga0501034_0005345 3300049571 Bacteria 14069
612 Ga0501034_0006218 3300049571 Bacteria 12854
613 Ga0501034_0060040 3300049571 Bacteria 3819
614 Ga0501034_0068903 3300049571 Bacteria 3548
615 Ga0501034_0387032 3300049571 Bacteria 1323
616 Ga0501034_0493678 3300049571 Bacteria 1138
617 Ga0501036_0001937 3300049572 Bacteria 16063
618 Ga0501036_0044844 3300049572 Bacteria 3746
619 Ga0501036_0167575 3300049572 Bacteria 1851
620 Ga0501037_0010859 3300049573 Bacteria 6692
621 Ga0501037_0017452 3300049573 Bacteria 5283
622 Ga0501038_0017596 3300049574 Bacteria 6458
623 Ga0501038_0125516 3300049574 Bacteria 2113
624 Ga0501039_0021513 3300049575 Bacteria 4947
625 Ga0501039_0061333 3300049575 Bacteria 2912
626 Ga0501043_0001561 3300049579 Bacteria 19946
627 Ga0501043_0017653 3300049579 Bacteria 5596
628 Ga0501046_0025302 3300049580 Bacteria 4859
629 Ga0501046_0227448 3300049580 Bacteria 1379
630 Ga0501047_0065912 3300049581 Bacteria 3490
631 Ga0501047_0093543 3300049581 Bacteria 2885
632 Ga0501072_0346248 3300049588 Bacteria 1180
633 Ga0501073_0017109 3300049589 Bacteria 5251
634 Ga0501074_0002078 3300049590 Bacteria 13840
635 Ga0501202_000361 3300049652 Bacteria 6321
636 Ga0501206_000286 3300049653 Bacteria 5921
637 Ga0501217_004485 3300049661 Bacteria 2874
638 Ga0501222_006594 3300049662 Bacteria 1558
639 Ga0501233_000938 3300049668 Bacteria 4936
640 Ga0501233_029508 3300049668 Bacteria 1231
641 Ga0501235_000670 3300049669 Bacteria 6919
642 Ga0501235_016889 3300049669 Bacteria 1614
643 Ga0501243_000661 3300049675 Bacteria 4720
644 Ga0501243_029034 3300049675 Unclassified 938
645 Ga0501259_000248 3300049688 Bacteria 8465
646 Ga0501221_005253 3300049704 Bacteria 2160
647 Ga0501225_0010585 3300049705 Bacteria 2611
648 Ga0501234_007821 3300049707 Bacteria 1671
649 Ga0501080_0145178 3300049742 Bacteria 2193
650 Ga0501080_0308308 3300049742 Unclassified 1435
651 Ga0501080_0431664 3300049742 Bacteria 1182
652 Ga0501080_0546649 3300049742 Bacteria 1032
653 Ga0501083_0049687 3300049744 Bacteria 2827
654 Ga0501035_0067220 3300049822 Bacteria 3181
655 Ga0501035_0095872 3300049822 Bacteria 2607
656 Ga0501035_0213421 3300049822 Unclassified 1651
657 Ga0501044_0019190 3300049823 Bacteria 7319
658 Ga0501044_0020812 3300049823 Bacteria 7002
659 Ga0501044_0193019 3300049823 Bacteria 1998
660 nmdc:mga0k408_10779_c1 3300050493 Bacteria 4954
661 nmdc:mga05p37_180002_c1 3300050507 Bacteria 2572
662 nmdc:mga05p37_216342_c1 3300050507 Bacteria 2314
663 nmdc:mga09592_233360_c1 3300050508 Bacteria 1594
664 nmdc:mga09592_26508_c1 3300050508 Bacteria 4802
665 nmdc:mga09592_6436_c1 3300050508 Bacteria 9567
666 nmdc:mga0qj67_23497_c1 3300050509 Bacteria 4744
667 nmdc:mga06r32_30211_c1 3300050510 Bacteria 5084
668 nmdc:mga08y16_224434_c1 3300050511 Bacteria 1944
669 nmdc:mga08y16_5986_c1 3300050511 Bacteria 12753
670 Ga0495619_0088244 3300053085 Bacteria 2098
671 Ga0500644_0050728 3300053088 Bacteria 1422
672 Ga0500562_000014 3300053108 Bacteria 146262
673 Ga0500568_0000699 3300053139 Bacteria 24055
674 Ga0500588_0028583 3300053146 Bacteria 1582
675 Ga0500616_0028391 3300053153 Bacteria 3083
676 Ga0500622_0001206 3300053156 Bacteria 21242
677 Ga0500611_000007 3300053727 Bacteria 210964
678 Ga0500645_014489 3300053730 Bacteria 2510
679 Ga0500661_010932 3300055283 Bacteria 1647

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025986 Ga0207658_10594561 Ga0207658_105945612 235
2 3300026078 Ga0207702_10257557 Ga0207702_102575572 247
3 3300039437 Ga0436365_0057606 Ga0436365_0057606_69_839 255
4 3300046462 Ga0495651_0262767 Ga0495651_0262767_26_802 256
5 3300013100 Ga0157373_10200126 Ga0157373_102001262 257
6 3300049662 Ga0501222_006594 Ga0501222_006594_10_783 257
7 3300005339 Ga0070660_100130723 Ga0070660_1001307232 258
8 3300005458 Ga0070681_10078745 Ga0070681_100787453 258
9 3300013104 Ga0157370_10160908 Ga0157370_101609082 258
10 3300017792 Ga0163161_10613831 Ga0163161_106138311 258
11 3300025909 Ga0207705_10243934 Ga0207705_102439343 258
12 3300025912 Ga0207707_10431204 Ga0207707_104312041 258
13 3300025919 Ga0207657_10123459 Ga0207657_101234592 258
14 3300025921 Ga0207652_10182049 Ga0207652_101820491 258
15 3300013102 Ga0157371_10061575 Ga0157371_100615752 259
16 3300013105 Ga0157369_10065596 Ga0157369_100655962 261
17 3300014969 Ga0157376_10172549 Ga0157376_101725492 263
18 3300049569 Ga0501032_0117182 Ga0501032_0117182_130_924 263
19 3300049742 Ga0501080_0431664 Ga0501080_0431664_13_807 263
20 3300049744 Ga0501083_0049687 Ga0501083_0049687_23_817 263
21 3300013104 Ga0157370_10008487 Ga0157370_100084873 264
22 3300013306 Ga0163162_10084029 Ga0163162_100840293 264
23 3300013308 Ga0157375_10004004 Ga0157375_100040046 264
24 3300014325 Ga0163163_10569004 Ga0163163_105690041 264
25 3300014968 Ga0157379_10128810 Ga0157379_101288102 264
26 3300028794 Ga0307515_10000039 Ga0307515_10000039128 265
27 3300005331 Ga0070670_100169303 Ga0070670_1001693032 266
28 3300011119 Ga0105246_10101038 Ga0105246_101010382 266
29 3300014326 Ga0157380_10702632 Ga0157380_107026321 266
30 3300048912 Ga0496109_0607776 Ga0496109_0607776_210_1013 266
31 3300049574 Ga0501038_0125516 Ga0501038_0125516_331_1155 266
32 3300003320 rootH2_10232842 rootH2_102328421 267
33 3300005329 Ga0070683_100288413 Ga0070683_1002884132 267
34 3300005336 Ga0070680_100082093 Ga0070680_1000820932 267
35 3300005337 Ga0070682_100286152 Ga0070682_1002861522 267
36 3300005339 Ga0070660_100048594 Ga0070660_1000485942 267
37 3300005458 Ga0070681_10063001 Ga0070681_100630012 267
38 3300005459 Ga0068867_100114404 Ga0068867_1001144042 267
39 3300005459 Ga0068867_100320104 Ga0068867_1003201042 267
40 3300005530 Ga0070679_100000775 Ga0070679_1000007756 267
41 3300005563 Ga0068855_100169778 Ga0068855_1001697782 267
42 3300005616 Ga0068852_100000704 Ga0068852_1000007044 267
43 3300006237 Ga0097621_100002163 Ga0097621_1000021638 267
44 3300006881 Ga0068865_100017895 Ga0068865_1000178952 267
45 3300013306 Ga0163162_10618616 Ga0163162_106186162 267
46 3300013307 Ga0157372_10136851 Ga0157372_101368512 267
47 3300013307 Ga0157372_10267939 Ga0157372_102679392 267
48 3300013308 Ga0157375_10342348 Ga0157375_103423482 267
49 3300014326 Ga0157380_10794405 Ga0157380_107944051 267
50 3300017792 Ga0163161_10124070 Ga0163161_101240702 267
51 3300017792 Ga0163161_10303062 Ga0163161_103030622 267
52 3300025909 Ga0207705_10007370 Ga0207705_100073702 267
53 3300025912 Ga0207707_10068042 Ga0207707_100680421 267
54 3300025919 Ga0207657_10021786 Ga0207657_100217863 267
55 3300025921 Ga0207652_10014484 Ga0207652_100144842 267
56 3300025938 Ga0207704_10052069 Ga0207704_100520692 267
57 3300025944 Ga0207661_10236980 Ga0207661_102369802 267
58 3300026035 Ga0207703_10300363 Ga0207703_103003632 267
59 3300026041 Ga0207639_10608369 Ga0207639_106083691 267
60 3300026088 Ga0207641_10279641 Ga0207641_102796411 267
61 3300026142 Ga0207698_10001677 Ga0207698_100016776 267
62 3300028381 Ga0268264_10481353 Ga0268264_104813532 267
63 3300031251 Ga0265327_10000383 Ga0265327_1000038322 267
64 3300049742 Ga0501080_0546649 Ga0501080_0546649_33_884 267
65 3300049822 Ga0501035_0213421 Ga0501035_0213421_604_1413 267
66 3300005458 Ga0070681_10257096 Ga0070681_102570962 268
67 3300005530 Ga0070679_100403672 Ga0070679_1004036721 268
68 3300005539 Ga0068853_100090821 Ga0068853_1000908211 268
69 3300005539 Ga0068853_100422376 Ga0068853_1004223762 268
70 3300005616 Ga0068852_100310537 Ga0068852_1003105373 268
71 3300009545 Ga0105237_10129647 Ga0105237_101296473 268
72 3300013100 Ga0157373_10121441 Ga0157373_101214413 268
73 3300013102 Ga0157371_10201140 Ga0157371_102011402 268
74 3300013104 Ga0157370_10408724 Ga0157370_104087242 268
75 3300013105 Ga0157369_10171175 Ga0157369_101711753 268
76 3300013307 Ga0157372_10574450 Ga0157372_105744502 268
77 3300025905 Ga0207685_10026162 Ga0207685_100261622 268
78 3300025909 Ga0207705_10024925 Ga0207705_100249252 268
79 3300025913 Ga0207695_10418759 Ga0207695_104187592 268
80 3300025921 Ga0207652_10310610 Ga0207652_103106102 268
81 3300005459 Ga0068867_100032598 Ga0068867_1000325982 269
82 3300006195 Ga0075366_10009549 Ga0075366_100095493 269
83 3300026089 Ga0207648_10071234 Ga0207648_100712343 269
84 3300028794 Ga0307515_10000002 Ga0307515_10000002888 269
85 3300031251 Ga0265327_10062371 Ga0265327_100623712 269
86 3300049570 Ga0501033_0076083 Ga0501033_0076083_135_947 269
87 3300049571 Ga0501034_0493678 Ga0501034_0493678_103_915 269
88 3300005834 Ga0068851_10134010 Ga0068851_101340101 270
89 3300028381 Ga0268264_10012154 Ga0268264_100121542 270
90 3300035170 Ga0373943_0122291 Ga0373943_0122291_404_1222 270
91 3300035172 Ga0373955_0023419 Ga0373955_0023419_932_1750 270
92 3300035725 Ga0373947_0402773 Ga0373947_0402773_25_840 270
93 3300046454 Ga0495592_0064026 Ga0495592_0064026_1390_2208 270
94 3300046559 Ga0495667_0042473 Ga0495667_0042473_424_1242 270
95 3300046809 Ga0495600_0044009 Ga0495600_0044009_1426_2244 270
96 3300049675 Ga0501243_029034 Ga0501243_029034_20_832 270
97 3300006847 Ga0075431_100008390 Ga0075431_1000083907 271
98 3300006880 Ga0075429_100032473 Ga0075429_1000324732 271
99 3300009147 Ga0114129_10030026 Ga0114129_100300268 271
100 3300050507 nmdc:mga05p37_216342_c1 nmdc:mga05p37_216342_c1_1186_2013 271
101 3300050508 nmdc:mga09592_26508_c1 nmdc:mga09592_26508_c1_47_874 271
102 3300050510 nmdc:mga06r32_30211_c1 nmdc:mga06r32_30211_c1_568_1395 271
103 3300003323 rootH1_10285025 rootH1_102850252 272
104 3300005543 Ga0070672_100159067 Ga0070672_1001590672 272
105 3300014326 Ga0157380_10025932 Ga0157380_100259323 272
106 3300025940 Ga0207691_10428509 Ga0207691_104285092 272
107 3300046616 Ga0495668_0003256 Ga0495668_0003256_7897_8724 272
108 3300049569 Ga0501032_0018919 Ga0501032_0018919_1268_2095 272
109 3300049571 Ga0501034_0006218 Ga0501034_0006218_5317_6144 272
110 3300049572 Ga0501036_0167575 Ga0501036_0167575_734_1561 272
111 3300049573 Ga0501037_0010859 Ga0501037_0010859_5325_6152 272
112 3300049575 Ga0501039_0021513 Ga0501039_0021513_2937_3764 272
113 3300049581 Ga0501047_0093543 Ga0501047_0093543_600_1427 272
114 3300049661 Ga0501217_004485 Ga0501217_004485_726_1544 272
115 3300049822 Ga0501035_0095872 Ga0501035_0095872_1304_2131 272
116 3300049823 Ga0501044_0020812 Ga0501044_0020812_5109_5936 272
117 3300005327 Ga0070658_10171275 Ga0070658_101712751 273
118 3300005334 Ga0068869_100005339 Ga0068869_1000053393 273
119 3300005335 Ga0070666_10000028 Ga0070666_1000002818 273
120 3300005355 Ga0070671_100025128 Ga0070671_1000251282 273
121 3300005355 Ga0070671_100317093 Ga0070671_1003170931 273
122 3300005364 Ga0070673_100030366 Ga0070673_1000303662 273
123 3300005365 Ga0070688_100290393 Ga0070688_1002903932 273
124 3300005365 Ga0070688_100387685 Ga0070688_1003876851 273
125 3300005367 Ga0070667_100008748 Ga0070667_1000087482 273
126 3300005367 Ga0070667_100011426 Ga0070667_1000114262 273
127 3300005617 Ga0068859_100000012 Ga0068859_100000012200 273
128 3300005618 Ga0068864_100004494 Ga0068864_1000044947 273
129 3300005841 Ga0068863_100001512 Ga0068863_1000015122 273
130 3300005842 Ga0068858_100002978 Ga0068858_1000029782 273
131 3300005843 Ga0068860_100002797 Ga0068860_10000279711 273
132 3300005843 Ga0068860_100003548 Ga0068860_1000035482 273
133 3300006358 Ga0068871_100030255 Ga0068871_1000302554 273
134 3300006358 Ga0068871_100155161 Ga0068871_1001551612 273
135 3300006881 Ga0068865_100019539 Ga0068865_1000195393 273
136 3300006881 Ga0068865_100165884 Ga0068865_1001658842 273
137 3300006931 Ga0097620_100000012 Ga0097620_100000012200 273
138 3300009101 Ga0105247_10006796 Ga0105247_100067964 273
139 3300009148 Ga0105243_10296311 Ga0105243_102963112 273
140 3300009174 Ga0105241_10004934 Ga0105241_100049346 273
141 3300009545 Ga0105237_10004851 Ga0105237_100048512 273
142 3300009553 Ga0105249_10002025 Ga0105249_1000202513 273
143 3300011119 Ga0105246_10110369 Ga0105246_101103692 273
144 3300013297 Ga0157378_10059212 Ga0157378_100592122 273
145 3300013297 Ga0157378_10062316 Ga0157378_100623164 273
146 3300013306 Ga0163162_10000634 Ga0163162_1000063424 273
147 3300013308 Ga0157375_10085652 Ga0157375_100856522 273
148 3300014325 Ga0163163_10599474 Ga0163163_105994742 273
149 3300014968 Ga0157379_10057804 Ga0157379_100578042 273
150 3300014969 Ga0157376_10028372 Ga0157376_100283723 273
151 3300014969 Ga0157376_10066103 Ga0157376_100661032 273
152 3300017792 Ga0163161_10447991 Ga0163161_104479911 273
153 3300025900 Ga0207710_10019874 Ga0207710_100198742 273
154 3300025903 Ga0207680_10000181 Ga0207680_100001816 273
155 3300025914 Ga0207671_10002860 Ga0207671_1000286014 273
156 3300025931 Ga0207644_10032824 Ga0207644_100328242 273
157 3300025938 Ga0207704_10035091 Ga0207704_100350913 273
158 3300025942 Ga0207689_10001188 Ga0207689_1000118815 273
159 3300025960 Ga0207651_10132297 Ga0207651_101322972 273
160 3300025961 Ga0207712_10050074 Ga0207712_100500742 273
161 3300025986 Ga0207658_10075328 Ga0207658_100753282 273
162 3300026035 Ga0207703_10028265 Ga0207703_100282652 273
163 3300026088 Ga0207641_10000152 Ga0207641_1000015239 273
164 3300026095 Ga0207676_10012147 Ga0207676_100121473 273
165 3300026095 Ga0207676_10620464 Ga0207676_106204641 273
166 3300028381 Ga0268264_10002534 Ga0268264_1000253414 273
167 3300028381 Ga0268264_10007566 Ga0268264_100075663 273
168 3300028381 Ga0268264_10459737 Ga0268264_104597372 273
169 3300041405 Ga0439438_031985 Ga0439438_031985_392_1249 273
170 3300041452 Ga0451793_0070710 Ga0451793_0070710_484_1311 273
171 3300046477 Ga0495664_0141661 Ga0495664_0141661_121_951 273
172 3300046663 Ga0495635_0171317 Ga0495635_0171317_289_1119 273
173 3300009545 Ga0105237_10163055 Ga0105237_101630551 274
174 3300009553 Ga0105249_10049524 Ga0105249_100495242 274
175 3300013306 Ga0163162_10005374 Ga0163162_100053748 274
176 3300013308 Ga0157375_10457868 Ga0157375_104578682 274
177 3300014968 Ga0157379_10010845 Ga0157379_100108453 274
178 3300025961 Ga0207712_10037434 Ga0207712_100374342 274
179 3300049571 Ga0501034_0005345 Ga0501034_0005345_7058_7894 274
180 3300049823 Ga0501044_0193019 Ga0501044_0193019_47_883 274
181 3300053146 Ga0500588_0028583 Ga0500588_0028583_268_1101 274
182 3300053153 Ga0500616_0028391 Ga0500616_0028391_1567_2400 274
183 3300005331 Ga0070670_100063227 Ga0070670_1000632273 275
184 3300005331 Ga0070670_100099753 Ga0070670_1000997533 275
185 3300005335 Ga0070666_10048345 Ga0070666_100483452 275
186 3300005355 Ga0070671_100129556 Ga0070671_1001295562 275
187 3300005355 Ga0070671_100263296 Ga0070671_1002632962 275
188 3300005367 Ga0070667_100008264 Ga0070667_1000082645 275
189 3300005841 Ga0068863_100024031 Ga0068863_1000240316 275
190 3300005841 Ga0068863_100048701 Ga0068863_1000487012 275
191 3300006237 Ga0097621_100001409 Ga0097621_10000140913 275
192 3300006358 Ga0068871_100013859 Ga0068871_1000138593 275
193 3300006358 Ga0068871_100339752 Ga0068871_1003397521 275
194 3300009177 Ga0105248_10042644 Ga0105248_100426443 275
195 3300013102 Ga0157371_10058825 Ga0157371_100588253 275
196 3300013104 Ga0157370_10412029 Ga0157370_104120292 275
197 3300013296 Ga0157374_10063447 Ga0157374_100634472 275
198 3300013297 Ga0157378_10024651 Ga0157378_100246511 275
199 3300013297 Ga0157378_10035213 Ga0157378_100352133 275
200 3300013306 Ga0163162_10002367 Ga0163162_1000236713 275
201 3300013306 Ga0163162_10266675 Ga0163162_102666752 275
202 3300013307 Ga0157372_10494275 Ga0157372_104942751 275
203 3300013308 Ga0157375_10001279 Ga0157375_1000127917 275
204 3300014325 Ga0163163_10004016 Ga0163163_100040167 275
205 3300014325 Ga0163163_10035462 Ga0163163_100354623 275
206 3300014969 Ga0157376_10001014 Ga0157376_1000101417 275
207 3300017792 Ga0163161_10001416 Ga0163161_1000141613 275
208 3300025925 Ga0207650_10089271 Ga0207650_100892712 275
209 3300025931 Ga0207644_10020465 Ga0207644_100204653 275
210 3300025986 Ga0207658_10057520 Ga0207658_100575202 275
211 3300026088 Ga0207641_10113805 Ga0207641_101138052 275
212 3300026095 Ga0207676_10083029 Ga0207676_100830292 275
213 3300031616 Ga0307508_10003392 Ga0307508_100033925 275
214 3300042876 Ga0451577_0041242 Ga0451577_0041242_333_1169 275
215 3300048903 Ga0496100_0016463 Ga0496100_0016463_1262_2098 275
216 3300048904 Ga0496101_0382935 Ga0496101_0382935_101_937 275
217 3300048917 Ga0496114_0072026 Ga0496114_0072026_2045_2881 275
218 iso_pu_bacteria 2818991444 2819590077 275
219 3300005334 Ga0068869_100016147 Ga0068869_1000161472 276
220 3300005354 Ga0070675_100037894 Ga0070675_1000378942 276
221 3300005543 Ga0070672_100218344 Ga0070672_1002183442 276
222 3300005719 Ga0068861_100737724 Ga0068861_1007377241 276
223 3300005844 Ga0068862_100123684 Ga0068862_1001236841 276
224 3300013100 Ga0157373_10002524 Ga0157373_100025249 276
225 3300013102 Ga0157371_10001703 Ga0157371_100017032 276
226 3300013105 Ga0157369_10015500 Ga0157369_100155009 276
227 3300013307 Ga0157372_10001143 Ga0157372_100011433 276
228 3300013308 Ga0157375_10173340 Ga0157375_101733402 276
229 3300025315 Ga0207697_10093954 Ga0207697_100939542 276
230 3300025931 Ga0207644_10188320 Ga0207644_101883201 276
231 3300026118 Ga0207675_100432725 Ga0207675_1004327252 276
232 3300026121 Ga0207683_10133219 Ga0207683_101332192 276
233 3300028380 Ga0268265_10035735 Ga0268265_100357351 276
234 3300028381 Ga0268264_10016471 Ga0268264_100164712 276
235 3300041505 Ga0451849_0597552 Ga0451849_0597552_379_1218 276
236 3300049570 Ga0501033_0212297 Ga0501033_0212297_146_988 277
237 3300049571 Ga0501034_0387032 Ga0501034_0387032_395_1237 277
238 3300003320 rootH2_10169461 rootH2_101694612 278
239 3300003323 rootH1_10000226 rootH1_100002262 278
240 3300005466 Ga0070685_10324846 Ga0070685_103248461 278
241 3300005616 Ga0068852_100124099 Ga0068852_1001240992 278
242 3300006358 Ga0068871_100180271 Ga0068871_1001802712 278
243 3300014745 Ga0157377_10079694 Ga0157377_100796942 278
244 3300026142 Ga0207698_10531641 Ga0207698_105316412 278
245 3300031251 Ga0265327_10077826 Ga0265327_100778262 278
246 3300031507 Ga0307509_10140026 Ga0307509_101400262 278
247 3300042014 Ga0439457_011408 Ga0439457_011408_707_1624 278
248 3300044658 Ga0466972_0000020 Ga0466972_0000020_107793_108833 278
249 3300044673 Ga0453683_0089965 Ga0453683_0089965_838_1683 278
250 3300044765 Ga0466970_0000117 Ga0466970_0000117_31615_32646 278
251 3300044842 Ga0466957_0000351 Ga0466957_0000351_4210_5055 278
252 3300003354 JGI25160J50197_1003244 JGI25160J50197_10032442 279
253 3300005843 Ga0068860_100032839 Ga0068860_1000328392 279
254 3300013307 Ga0157372_10488223 Ga0157372_104882231 279
255 3300021384 Ga0213876_10009071 Ga0213876_100090714 279
256 3300025302 Ga0207426_1000002 Ga0207426_1000002986 279
257 3300039437 Ga0436365_0219322 Ga0436365_0219322_8648_9490 279
258 3300048927 Ga0496124_0135773 Ga0496124_0135773_639_1544 279
259 iso_pu_bacteria 2929154850 2929155687 279
260 3300003320 rootH2_10074975 rootH2_100749755 280
261 3300005290 Ga0065712_10006615 Ga0065712_100066153 280
262 3300005340 Ga0070689_100006441 Ga0070689_1000064417 280
263 3300005353 Ga0070669_100015799 Ga0070669_1000157994 280
264 3300005355 Ga0070671_100180631 Ga0070671_1001806312 280
265 3300005364 Ga0070673_100065354 Ga0070673_1000653543 280
266 3300005440 Ga0070705_100198925 Ga0070705_1001989252 280
267 3300005457 Ga0070662_100019599 Ga0070662_1000195991 280
268 3300005543 Ga0070672_100084098 Ga0070672_1000840984 280
269 3300005577 Ga0068857_100125079 Ga0068857_1001250792 280
270 3300005578 Ga0068854_100134910 Ga0068854_1001349102 280
271 3300005617 Ga0068859_100022888 Ga0068859_1000228882 280
272 3300005719 Ga0068861_100004190 Ga0068861_1000041909 280
273 3300005844 Ga0068862_100024052 Ga0068862_1000240524 280
274 3300006881 Ga0068865_100385459 Ga0068865_1003854592 280
275 3300006931 Ga0097620_100022888 Ga0097620_1000228882 280
276 3300009094 Ga0111539_10083796 Ga0111539_100837964 280
277 3300009553 Ga0105249_10007898 Ga0105249_100078982 280
278 3300013306 Ga0163162_10005072 Ga0163162_100050725 280
279 3300013308 Ga0157375_10009214 Ga0157375_100092143 280
280 3300014326 Ga0157380_10001753 Ga0157380_100017535 280
281 3300025926 Ga0207659_10171516 Ga0207659_101715163 280
282 3300025933 Ga0207706_10009425 Ga0207706_1000942510 280
283 3300025936 Ga0207670_10133106 Ga0207670_101331061 280
284 3300025940 Ga0207691_10115681 Ga0207691_101156813 280
285 3300025960 Ga0207651_10085082 Ga0207651_100850823 280
286 3300025961 Ga0207712_10237776 Ga0207712_102377761 280
287 3300026075 Ga0207708_10065822 Ga0207708_100658223 280
288 3300026116 Ga0207674_10190757 Ga0207674_101907572 280
289 3300026118 Ga0207675_100035632 Ga0207675_1000356324 280
290 3300028380 Ga0268265_10023262 Ga0268265_100232623 280
291 3300042876 Ga0451577_0309292 Ga0451577_0309292_446_1303 280
292 3300044712 Ga0453684_0275808 Ga0453684_0275808_82_939 280
293 3300049742 Ga0501080_0308308 Ga0501080_0308308_307_1152 280
294 3300050511 nmdc:mga08y16_5986_c1 nmdc:mga08y16_5986_c1_7602_8453 280
295 3300053088 Ga0500644_0050728 Ga0500644_0050728_171_1067 280
296 3300053108 Ga0500562_000014 Ga0500562_000014_42547_43443 280
297 3300053730 Ga0500645_014489 Ga0500645_014489_1364_2260 280
298 3300055283 Ga0500661_010932 Ga0500661_010932_648_1544 280
299 3300003316 rootH1_10107000 rootH1_101070001 281
300 3300005327 Ga0070658_10013559 Ga0070658_100135594 281
301 3300005330 Ga0070690_100025223 Ga0070690_1000252233 281
302 3300005338 Ga0068868_100115247 Ga0068868_1001152472 281
303 3300005356 Ga0070674_100083880 Ga0070674_1000838802 281
304 3300005459 Ga0068867_100077353 Ga0068867_1000773531 281
305 3300005578 Ga0068854_100013207 Ga0068854_1000132072 281
306 3300005617 Ga0068859_100087754 Ga0068859_1000877542 281
307 3300005718 Ga0068866_10053518 Ga0068866_100535183 281
308 3300005843 Ga0068860_100100892 Ga0068860_1001008923 281
309 3300006237 Ga0097621_100457072 Ga0097621_1004570722 281
310 3300006931 Ga0097620_100087759 Ga0097620_1000877592 281
311 3300009174 Ga0105241_10678953 Ga0105241_106789531 281
312 3300009545 Ga0105237_10021415 Ga0105237_100214156 281
313 3300009553 Ga0105249_10224267 Ga0105249_102242672 281
314 3300010375 Ga0105239_10019699 Ga0105239_100196997 281
315 3300013100 Ga0157373_10024191 Ga0157373_100241911 281
316 3300013297 Ga0157378_10009231 Ga0157378_100092312 281
317 3300025914 Ga0207671_10143506 Ga0207671_101435062 281
318 3300025918 Ga0207662_10107084 Ga0207662_101070842 281
319 3300025933 Ga0207706_10004753 Ga0207706_100047532 281
320 3300025937 Ga0207669_10071298 Ga0207669_100712983 281
321 3300026023 Ga0207677_10032967 Ga0207677_100329673 281
322 3300026078 Ga0207702_10262361 Ga0207702_102623612 281
323 3300026089 Ga0207648_10295467 Ga0207648_102954672 281
324 3300028381 Ga0268264_10516366 Ga0268264_105163661 281
325 3300037471 Ga0395905_0081041 Ga0395905_0081041_14_862 281
326 3300041997 Ga0439431_0011949 Ga0439431_0011949_949_1806 281
327 3300046460 Ga0495638_0129623 Ga0495638_0129623_409_1257 281
328 3300053727 Ga0500611_000007 Ga0500611_000007_134733_135581 281
329 3300003323 rootH1_10328002 rootH1_103280022 282
330 3300005328 Ga0070676_10004711 Ga0070676_100047114 282
331 3300005328 Ga0070676_10006331 Ga0070676_100063312 282
332 3300005328 Ga0070676_10040532 Ga0070676_100405322 282
333 3300005328 Ga0070676_10160381 Ga0070676_101603812 282
334 3300005329 Ga0070683_100014205 Ga0070683_1000142058 282
335 3300005329 Ga0070683_100126527 Ga0070683_1001265273 282
336 3300005330 Ga0070690_100062408 Ga0070690_1000624083 282
337 3300005331 Ga0070670_100033756 Ga0070670_1000337563 282
338 3300005331 Ga0070670_100119011 Ga0070670_1001190113 282
339 3300005334 Ga0068869_100006131 Ga0068869_1000061315 282
340 3300005334 Ga0068869_100012054 Ga0068869_1000120543 282
341 3300005334 Ga0068869_100034741 Ga0068869_1000347413 282
342 3300005334 Ga0068869_100054583 Ga0068869_1000545832 282
343 3300005334 Ga0068869_100143079 Ga0068869_1001430792 282
344 3300005335 Ga0070666_10019854 Ga0070666_100198543 282
345 3300005338 Ga0068868_100024389 Ga0068868_1000243893 282
346 3300005338 Ga0068868_100110032 Ga0068868_1001100323 282
347 3300005338 Ga0068868_100169887 Ga0068868_1001698872 282
348 3300005340 Ga0070689_100010609 Ga0070689_1000106094 282
349 3300005344 Ga0070661_100104499 Ga0070661_1001044993 282
350 3300005347 Ga0070668_100010902 Ga0070668_1000109024 282
351 3300005347 Ga0070668_100053460 Ga0070668_1000534603 282
352 3300005353 Ga0070669_100205981 Ga0070669_1002059812 282
353 3300005354 Ga0070675_100022437 Ga0070675_1000224372 282
354 3300005354 Ga0070675_100074350 Ga0070675_1000743502 282
355 3300005355 Ga0070671_100345397 Ga0070671_1003453972 282
356 3300005355 Ga0070671_100645111 Ga0070671_1006451111 282
357 3300005356 Ga0070674_100203555 Ga0070674_1002035552 282
358 3300005365 Ga0070688_100007912 Ga0070688_1000079125 282
359 3300005366 Ga0070659_100108695 Ga0070659_1001086953 282
360 3300005367 Ga0070667_100034699 Ga0070667_1000346992 282
361 3300005367 Ga0070667_100157916 Ga0070667_1001579163 282
362 3300005456 Ga0070678_100015390 Ga0070678_1000153903 282
363 3300005457 Ga0070662_100087690 Ga0070662_1000876903 282
364 3300005459 Ga0068867_100015133 Ga0068867_1000151334 282
365 3300005459 Ga0068867_100443321 Ga0068867_1004433211 282
366 3300005466 Ga0070685_10052610 Ga0070685_100526101 282
367 3300005466 Ga0070685_10107765 Ga0070685_101077652 282
368 3300005471 Ga0070698_100002002 Ga0070698_10000200212 282
369 3300005471 Ga0070698_100035409 Ga0070698_1000354095 282
370 3300005471 Ga0070698_100112108 Ga0070698_1001121082 282
371 3300005518 Ga0070699_100106128 Ga0070699_1001061283 282
372 3300005535 Ga0070684_100004295 Ga0070684_10000429515 282
373 3300005543 Ga0070672_100024199 Ga0070672_1000241992 282
374 3300005543 Ga0070672_100091837 Ga0070672_1000918371 282
375 3300005548 Ga0070665_100009957 Ga0070665_1000099576 282
376 3300005564 Ga0070664_100016835 Ga0070664_1000168352 282
377 3300005564 Ga0070664_100108317 Ga0070664_1001083172 282
378 3300005578 Ga0068854_100169592 Ga0068854_1001695923 282
379 3300005617 Ga0068859_100134474 Ga0068859_1001344742 282
380 3300005617 Ga0068859_100189514 Ga0068859_1001895142 282
381 3300005617 Ga0068859_100217364 Ga0068859_1002173643 282
382 3300005617 Ga0068859_100313876 Ga0068859_1003138763 282
383 3300005617 Ga0068859_100405572 Ga0068859_1004055722 282
384 3300005618 Ga0068864_100011567 Ga0068864_1000115676 282
385 3300005719 Ga0068861_100333556 Ga0068861_1003335562 282
386 3300005719 Ga0068861_100485522 Ga0068861_1004855222 282
387 3300005834 Ga0068851_10143706 Ga0068851_101437062 282
388 3300005841 Ga0068863_100012212 Ga0068863_1000122122 282
389 3300005841 Ga0068863_100045074 Ga0068863_1000450743 282
390 3300005841 Ga0068863_100074658 Ga0068863_1000746582 282
391 3300005841 Ga0068863_100213815 Ga0068863_1002138152 282
392 3300005841 Ga0068863_100329996 Ga0068863_1003299962 282
393 3300005841 Ga0068863_100518719 Ga0068863_1005187191 282
394 3300005842 Ga0068858_100011998 Ga0068858_1000119988 282
395 3300005843 Ga0068860_100355876 Ga0068860_1003558763 282
396 3300005844 Ga0068862_100071715 Ga0068862_1000717152 282
397 3300005844 Ga0068862_100253057 Ga0068862_1002530572 282
398 3300005844 Ga0068862_100282414 Ga0068862_1002824143 282
399 3300006237 Ga0097621_100016881 Ga0097621_1000168813 282
400 3300006358 Ga0068871_100019444 Ga0068871_1000194442 282
401 3300006358 Ga0068871_100026349 Ga0068871_1000263493 282
402 3300006358 Ga0068871_100538224 Ga0068871_1005382241 282
403 3300006844 Ga0075428_100032601 Ga0075428_1000326013 282
404 3300006846 Ga0075430_100059017 Ga0075430_1000590172 282
405 3300006880 Ga0075429_100003601 Ga0075429_10000360111 282
406 3300006880 Ga0075429_100174503 Ga0075429_1001745032 282
407 3300006881 Ga0068865_100008908 Ga0068865_1000089085 282
408 3300006881 Ga0068865_100117880 Ga0068865_1001178803 282
409 3300006931 Ga0097620_100134478 Ga0097620_1001344782 282
410 3300006931 Ga0097620_100189514 Ga0097620_1001895143 282
411 3300006931 Ga0097620_100217370 Ga0097620_1002173702 282
412 3300006931 Ga0097620_100313910 Ga0097620_1003139103 282
413 3300006931 Ga0097620_100405590 Ga0097620_1004055902 282
414 3300009101 Ga0105247_10003345 Ga0105247_100033452 282
415 3300009174 Ga0105241_10114009 Ga0105241_101140091 282
416 3300009176 Ga0105242_10023180 Ga0105242_100231801 282
417 3300009176 Ga0105242_10118442 Ga0105242_101184422 282
418 3300009176 Ga0105242_10119089 Ga0105242_101190892 282
419 3300009176 Ga0105242_10312405 Ga0105242_103124052 282
420 3300009553 Ga0105249_10000420 Ga0105249_100004207 282
421 3300009553 Ga0105249_10087231 Ga0105249_100872312 282
422 3300009553 Ga0105249_10095957 Ga0105249_100959573 282
423 3300011119 Ga0105246_10014260 Ga0105246_100142604 282
424 3300013102 Ga0157371_10264705 Ga0157371_102647051 282
425 3300013296 Ga0157374_10012894 Ga0157374_100128946 282
426 3300013296 Ga0157374_10101119 Ga0157374_101011192 282
427 3300013296 Ga0157374_10137814 Ga0157374_101378142 282
428 3300013297 Ga0157378_10067025 Ga0157378_100670252 282
429 3300013297 Ga0157378_10315552 Ga0157378_103155523 282
430 3300013306 Ga0163162_10008613 Ga0163162_100086136 282
431 3300013306 Ga0163162_10473031 Ga0163162_104730312 282
432 3300013307 Ga0157372_10212140 Ga0157372_102121403 282
433 3300013307 Ga0157372_10919942 Ga0157372_109199421 282
434 3300013308 Ga0157375_10012122 Ga0157375_100121222 282
435 3300013308 Ga0157375_10037185 Ga0157375_100371854 282
436 3300013308 Ga0157375_10485630 Ga0157375_104856302 282
437 3300014325 Ga0163163_10003016 Ga0163163_100030168 282
438 3300014325 Ga0163163_10178049 Ga0163163_101780492 282
439 3300014325 Ga0163163_10302512 Ga0163163_103025122 282
440 3300014325 Ga0163163_10333792 Ga0163163_103337922 282
441 3300014326 Ga0157380_10020060 Ga0157380_100200604 282
442 3300014745 Ga0157377_10002265 Ga0157377_100022657 282
443 3300014968 Ga0157379_10007518 Ga0157379_100075187 282
444 3300014968 Ga0157379_10048815 Ga0157379_100488153 282
445 3300014969 Ga0157376_10044898 Ga0157376_100448983 282
446 3300014969 Ga0157376_10105699 Ga0157376_101056992 282
447 3300014969 Ga0157376_10166362 Ga0157376_101663621 282
448 3300017792 Ga0163161_10219020 Ga0163161_102190202 282
449 3300025899 Ga0207642_10132374 Ga0207642_101323742 282
450 3300025903 Ga0207680_10016078 Ga0207680_100160783 282
451 3300025903 Ga0207680_10162292 Ga0207680_101622922 282
452 3300025904 Ga0207647_10035608 Ga0207647_100356082 282
453 3300025907 Ga0207645_10001091 Ga0207645_100010918 282
454 3300025907 Ga0207645_10006223 Ga0207645_100062237 282
455 3300025907 Ga0207645_10020263 Ga0207645_100202632 282
456 3300025923 Ga0207681_10010679 Ga0207681_100106793 282
457 3300025923 Ga0207681_10171000 Ga0207681_101710002 282
458 3300025925 Ga0207650_10021549 Ga0207650_100215491 282
459 3300025925 Ga0207650_10269440 Ga0207650_102694402 282
460 3300025926 Ga0207659_10005057 Ga0207659_100050577 282
461 3300025932 Ga0207690_10208388 Ga0207690_102083882 282
462 3300025933 Ga0207706_10041290 Ga0207706_100412904 282
463 3300025933 Ga0207706_10059157 Ga0207706_100591573 282
464 3300025933 Ga0207706_10225575 Ga0207706_102255752 282
465 3300025934 Ga0207686_10006720 Ga0207686_100067204 282
466 3300025934 Ga0207686_10098268 Ga0207686_100982682 282
467 3300025934 Ga0207686_10176308 Ga0207686_101763082 282
468 3300025936 Ga0207670_10022427 Ga0207670_100224274 282
469 3300025937 Ga0207669_10177971 Ga0207669_101779712 282
470 3300025938 Ga0207704_10044047 Ga0207704_100440472 282
471 3300025940 Ga0207691_10031073 Ga0207691_100310732 282
472 3300025940 Ga0207691_10035273 Ga0207691_100352733 282
473 3300025940 Ga0207691_10229611 Ga0207691_102296112 282
474 3300025942 Ga0207689_10003186 Ga0207689_100031869 282
475 3300025942 Ga0207689_10005922 Ga0207689_1000592212 282
476 3300025942 Ga0207689_10007577 Ga0207689_100075773 282
477 3300025942 Ga0207689_10013070 Ga0207689_100130707 282
478 3300025942 Ga0207689_10020523 Ga0207689_100205236 282
479 3300025942 Ga0207689_10049382 Ga0207689_100493823 282
480 3300025944 Ga0207661_10025228 Ga0207661_100252284 282
481 3300025945 Ga0207679_10019754 Ga0207679_100197543 282
482 3300025960 Ga0207651_10008670 Ga0207651_100086703 282
483 3300025960 Ga0207651_10174292 Ga0207651_101742922 282
484 3300025961 Ga0207712_10029701 Ga0207712_100297013 282
485 3300025961 Ga0207712_10261264 Ga0207712_102612641 282
486 3300025972 Ga0207668_10055478 Ga0207668_100554782 282
487 3300025972 Ga0207668_10271638 Ga0207668_102716382 282
488 3300025981 Ga0207640_10016162 Ga0207640_100161623 282
489 3300025986 Ga0207658_10007974 Ga0207658_100079742 282
490 3300026023 Ga0207677_10008388 Ga0207677_100083882 282
491 3300026023 Ga0207677_10096301 Ga0207677_100963014 282
492 3300026023 Ga0207677_10160430 Ga0207677_101604302 282
493 3300026041 Ga0207639_10316485 Ga0207639_103164852 282
494 3300026067 Ga0207678_10329828 Ga0207678_103298282 282
495 3300026088 Ga0207641_10003763 Ga0207641_100037639 282
496 3300026088 Ga0207641_10016956 Ga0207641_100169563 282
497 3300026088 Ga0207641_10050686 Ga0207641_100506862 282
498 3300026088 Ga0207641_10315992 Ga0207641_103159922 282
499 3300026089 Ga0207648_10008111 Ga0207648_100081117 282
500 3300026089 Ga0207648_10030958 Ga0207648_100309581 282
501 3300026095 Ga0207676_10001860 Ga0207676_1000186010 282
502 3300026095 Ga0207676_10197961 Ga0207676_101979612 282
503 3300026116 Ga0207674_10026708 Ga0207674_100267086 282
504 3300026116 Ga0207674_10148325 Ga0207674_101483252 282
505 3300026118 Ga0207675_100034613 Ga0207675_1000346134 282
506 3300026121 Ga0207683_10001620 Ga0207683_100016208 282
507 3300028379 Ga0268266_10044700 Ga0268266_100447002 282
508 3300028379 Ga0268266_10113814 Ga0268266_101138143 282
509 3300028380 Ga0268265_10100208 Ga0268265_101002083 282
510 3300028380 Ga0268265_10157733 Ga0268265_101577332 282
511 3300028381 Ga0268264_10618604 Ga0268264_106186042 282
512 3300031548 Ga0307408_100108412 Ga0307408_1001084122 282
513 3300031731 Ga0307405_10106405 Ga0307405_101064052 282
514 3300032005 Ga0307411_10186619 Ga0307411_101866192 282
515 3300032126 Ga0307415_100130341 Ga0307415_1001303412 282
516 3300035725 Ga0373947_0053004 Ga0373947_0053004_1339_2193 282
517 3300039450 Ga0436363_0254581 Ga0436363_0254581_33_881 282
518 3300042001 Ga0439441_001337 Ga0439441_001337_1310_2161 282
519 3300047472 Ga0495686_0046602 Ga0495686_0046602_398_1249 282
520 3300048914 Ga0496111_0057955 Ga0496111_0057955_387_1238 282
521 3300049568 Ga0501031_0005264 Ga0501031_0005264_7304_8158 282
522 3300049568 Ga0501031_0251202 Ga0501031_0251202_50_901 282
523 3300049571 Ga0501034_0060040 Ga0501034_0060040_117_971 282
524 3300049571 Ga0501034_0068903 Ga0501034_0068903_840_1691 282
525 3300049572 Ga0501036_0001937 Ga0501036_0001937_132_983 282
526 3300049572 Ga0501036_0044844 Ga0501036_0044844_382_1236 282
527 3300049573 Ga0501037_0017452 Ga0501037_0017452_3900_4754 282
528 3300049574 Ga0501038_0017596 Ga0501038_0017596_4369_5223 282
529 3300049575 Ga0501039_0061333 Ga0501039_0061333_1109_1963 282
530 3300049579 Ga0501043_0001561 Ga0501043_0001561_3903_4754 282
531 3300049579 Ga0501043_0017653 Ga0501043_0017653_130_984 282
532 3300049580 Ga0501046_0025302 Ga0501046_0025302_400_1251 282
533 3300049580 Ga0501046_0227448 Ga0501046_0227448_248_1102 282
534 3300049581 Ga0501047_0065912 Ga0501047_0065912_1254_2105 282
535 3300049588 Ga0501072_0346248 Ga0501072_0346248_74_928 282
536 3300049589 Ga0501073_0017109 Ga0501073_0017109_3354_4205 282
537 3300049590 Ga0501074_0002078 Ga0501074_0002078_12892_13743 282
538 3300049668 Ga0501233_029508 Ga0501233_029508_16_921 282
539 3300049669 Ga0501235_016889 Ga0501235_016889_461_1393 282
540 3300049705 Ga0501225_0010585 Ga0501225_0010585_820_1752 282
541 3300049742 Ga0501080_0145178 Ga0501080_0145178_48_899 282
542 3300049822 Ga0501035_0067220 Ga0501035_0067220_382_1236 282
543 3300049823 Ga0501044_0019190 Ga0501044_0019190_4595_5449 282
544 3300050493 nmdc:mga0k408_10779_c1 nmdc:mga0k408_10779_c1_3564_4415 282
545 3300050508 nmdc:mga09592_233360_c1 nmdc:mga09592_233360_c1_27_878 282
546 3300050508 nmdc:mga09592_6436_c1 nmdc:mga09592_6436_c1_3587_4441 282
547 3300050509 nmdc:mga0qj67_23497_c1 nmdc:mga0qj67_23497_c1_2675_3529 282
548 3300053139 Ga0500568_0000699 Ga0500568_0000699_22360_23214 282
549 3300005290 Ga0065712_10072296 Ga0065712_100722963 283
550 3300005329 Ga0070683_100031603 Ga0070683_1000316033 283
551 3300005329 Ga0070683_100047223 Ga0070683_1000472232 283
552 3300005330 Ga0070690_100126875 Ga0070690_1001268751 283
553 3300005330 Ga0070690_100366416 Ga0070690_1003664161 283
554 3300005331 Ga0070670_100023151 Ga0070670_1000231512 283
555 3300005331 Ga0070670_100035528 Ga0070670_1000355283 283
556 3300005334 Ga0068869_100265061 Ga0068869_1002650611 283
557 3300005335 Ga0070666_10020881 Ga0070666_100208815 283
558 3300005337 Ga0070682_100070032 Ga0070682_1000700323 283
559 3300005338 Ga0068868_100133645 Ga0068868_1001336453 283
560 3300005340 Ga0070689_100062711 Ga0070689_1000627112 283
561 3300005340 Ga0070689_100375511 Ga0070689_1003755112 283
562 3300005343 Ga0070687_100057013 Ga0070687_1000570131 283
563 3300005344 Ga0070661_100008379 Ga0070661_1000083794 283
564 3300005354 Ga0070675_100099838 Ga0070675_1000998381 283
565 3300005355 Ga0070671_100116570 Ga0070671_1001165703 283
566 3300005355 Ga0070671_100228079 Ga0070671_1002280792 283
567 3300005356 Ga0070674_100543509 Ga0070674_1005435092 283
568 3300005364 Ga0070673_100088441 Ga0070673_1000884411 283
569 3300005365 Ga0070688_100173091 Ga0070688_1001730912 283
570 3300005366 Ga0070659_100005013 Ga0070659_1000050137 283
571 3300005441 Ga0070700_100247643 Ga0070700_1002476432 283
572 3300005456 Ga0070678_100136826 Ga0070678_1001368261 283
573 3300005457 Ga0070662_100097819 Ga0070662_1000978192 283
574 3300005466 Ga0070685_10002168 Ga0070685_100021685 283
575 3300005535 Ga0070684_100012723 Ga0070684_1000127233 283
576 3300005535 Ga0070684_100324587 Ga0070684_1003245871 283
577 3300005539 Ga0068853_100029228 Ga0068853_1000292282 283
578 3300005564 Ga0070664_100030899 Ga0070664_1000308992 283
579 3300005564 Ga0070664_100080284 Ga0070664_1000802843 283
580 3300005564 Ga0070664_100161286 Ga0070664_1001612862 283
581 3300005577 Ga0068857_100014588 Ga0068857_1000145882 283
582 3300005616 Ga0068852_100198651 Ga0068852_1001986512 283
583 3300005618 Ga0068864_100221115 Ga0068864_1002211151 283
584 3300005618 Ga0068864_100385602 Ga0068864_1003856021 283
585 3300005841 Ga0068863_100549508 Ga0068863_1005495082 283
586 3300005842 Ga0068858_100318253 Ga0068858_1003182533 283
587 3300006358 Ga0068871_100390039 Ga0068871_1003900392 283
588 3300006844 Ga0075428_100022471 Ga0075428_1000224714 283
589 3300006844 Ga0075428_100214831 Ga0075428_1002148312 283
590 3300006846 Ga0075430_100002260 Ga0075430_10000226012 283
591 3300009094 Ga0111539_10117098 Ga0111539_101170983 283
592 3300009147 Ga0114129_10109610 Ga0114129_101096104 283
593 3300009176 Ga0105242_10103667 Ga0105242_101036673 283
594 3300009545 Ga0105237_10179045 Ga0105237_101790453 283
595 3300009553 Ga0105249_10025382 Ga0105249_100253824 283
596 3300009553 Ga0105249_10204349 Ga0105249_102043492 283
597 3300013100 Ga0157373_10087139 Ga0157373_100871393 283
598 3300013102 Ga0157371_10028910 Ga0157371_100289102 283
599 3300013104 Ga0157370_10314425 Ga0157370_103144252 283
600 3300013296 Ga0157374_10125421 Ga0157374_101254214 283
601 3300013297 Ga0157378_10337058 Ga0157378_103370582 283
602 3300013307 Ga0157372_10077473 Ga0157372_100774733 283
603 3300013307 Ga0157372_10080354 Ga0157372_100803543 283
604 3300013307 Ga0157372_10159166 Ga0157372_101591662 283
605 3300013308 Ga0157375_10013890 Ga0157375_100138903 283
606 3300013308 Ga0157375_10153406 Ga0157375_101534062 283
607 3300014325 Ga0163163_10013222 Ga0163163_100132222 283
608 3300014325 Ga0163163_10024119 Ga0163163_100241197 283
609 3300014745 Ga0157377_10209909 Ga0157377_102099092 283
610 3300017792 Ga0163161_10033985 Ga0163161_100339852 283
611 3300025903 Ga0207680_10095024 Ga0207680_100950243 283
612 3300025913 Ga0207695_10559335 Ga0207695_105593352 283
613 3300025918 Ga0207662_10047644 Ga0207662_100476444 283
614 3300025918 Ga0207662_10197560 Ga0207662_101975601 283
615 3300025920 Ga0207649_10008073 Ga0207649_100080735 283
616 3300025923 Ga0207681_10022786 Ga0207681_100227864 283
617 3300025925 Ga0207650_10002225 Ga0207650_1000222512 283
618 3300025926 Ga0207659_10530138 Ga0207659_105301382 283
619 3300025931 Ga0207644_10079049 Ga0207644_100790492 283
620 3300025932 Ga0207690_10014916 Ga0207690_100149164 283
621 3300025933 Ga0207706_10006384 Ga0207706_100063843 283
622 3300025934 Ga0207686_10121110 Ga0207686_101211103 283
623 3300025936 Ga0207670_10105423 Ga0207670_101054232 283
624 3300025938 Ga0207704_10078807 Ga0207704_100788073 283
625 3300025941 Ga0207711_10591928 Ga0207711_105919282 283
626 3300025942 Ga0207689_10051330 Ga0207689_100513302 283
627 3300025944 Ga0207661_10410212 Ga0207661_104102122 283
628 3300025945 Ga0207679_10001356 Ga0207679_100013564 283
629 3300025945 Ga0207679_10357794 Ga0207679_103577942 283
630 3300025960 Ga0207651_10167875 Ga0207651_101678752 283
631 3300025961 Ga0207712_10003129 Ga0207712_100031295 283
632 3300026023 Ga0207677_10090832 Ga0207677_100908322 283
633 3300026023 Ga0207677_10155902 Ga0207677_101559022 283
634 3300026041 Ga0207639_10124368 Ga0207639_101243682 283
635 3300026075 Ga0207708_10091909 Ga0207708_100919093 283
636 3300026089 Ga0207648_10419658 Ga0207648_104196582 283
637 3300026095 Ga0207676_10282425 Ga0207676_102824252 283
638 3300026116 Ga0207674_10013230 Ga0207674_100132302 283
639 3300026118 Ga0207675_100120456 Ga0207675_1001204562 283
640 3300026121 Ga0207683_10061304 Ga0207683_100613043 283
641 3300026142 Ga0207698_10097345 Ga0207698_100973451 283
642 3300027907 Ga0207428_10117749 Ga0207428_101177493 283
643 3300031824 Ga0307413_10340193 Ga0307413_103401932 283
644 3300035724 Ga0373933_0307821 Ga0373933_0307821_99_1010 283
645 3300035725 Ga0373947_0128168 Ga0373947_0128168_482_1393 283
646 3300037471 Ga0395905_0002824 Ga0395905_0002824_2897_3748 283
647 3300037471 Ga0395905_0060659 Ga0395905_0060659_2669_3520 283
648 3300044712 Ga0453684_0043874 Ga0453684_0043874_2595_3446 283
649 3300045049 Ga0466959_0056211 Ga0466959_0056211_1198_2049 283
650 3300045051 Ga0451576_0190376 Ga0451576_0190376_171_1022 283
651 3300046516 Ga0495628_0047488 Ga0495628_0047488_1304_2215 283
652 3300046539 Ga0495621_0035434 Ga0495621_0035434_266_1123 283
653 3300046648 Ga0495611_0068844 Ga0495611_0068844_473_1330 283
654 3300047320 Ga0495672_0024735 Ga0495672_0024735_1690_2544 283
655 3300050507 nmdc:mga05p37_180002_c1 nmdc:mga05p37_180002_c1_146_1003 283
656 3300050511 nmdc:mga08y16_224434_c1 nmdc:mga08y16_224434_c1_785_1642 283
657 3300053085 Ga0495619_0088244 Ga0495619_0088244_250_1107 283
658 3300053156 Ga0500622_0001206 Ga0500622_0001206_753_1661 283
659 3300005441 Ga0070700_100239671 Ga0070700_1002396711 284
660 3300013307 Ga0157372_10207862 Ga0157372_102078622 284
661 3300026142 Ga0207698_10153393 Ga0207698_101533932 284
662 3300001904 JGI24736J21556_1023873 JGI24736J21556_10238731 285
663 3300005577 Ga0068857_100388996 Ga0068857_1003889962 285
664 3300005616 Ga0068852_100004128 Ga0068852_1000041285 285
665 3300013102 Ga0157371_10028726 Ga0157371_100287262 285
666 3300013104 Ga0157370_10311856 Ga0157370_103118562 285
667 3300013105 Ga0157369_10075048 Ga0157369_100750482 285
668 3300013105 Ga0157369_10337435 Ga0157369_103374352 285
669 3300013307 Ga0157372_10328134 Ga0157372_103281342 285
670 3300025904 Ga0207647_10000208 Ga0207647_1000020829 285
671 3300026116 Ga0207674_10062174 Ga0207674_100621742 285
672 3300026142 Ga0207698_10007763 Ga0207698_100077634 285
673 3300049652 Ga0501202_000361 Ga0501202_000361_4725_5582 285
674 3300049653 Ga0501206_000286 Ga0501206_000286_2162_3019 285
675 3300049668 Ga0501233_000938 Ga0501233_000938_399_1256 285
676 3300049669 Ga0501235_000670 Ga0501235_000670_84_941 285
677 3300049675 Ga0501243_000661 Ga0501243_000661_3580_4437 285
678 3300049688 Ga0501259_000248 Ga0501259_000248_5374_6258 285
679 3300049704 Ga0501221_005253 Ga0501221_005253_1057_1914 285
680 3300049707 Ga0501234_007821 Ga0501234_007821_164_1021 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12395

DUF3658

Protein of unknown function

184

291

0.95

PF08874

DUF1835

Domain of unknown function (DUF1835)

30

155

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hs7-assembly1.cif.gz_A reduced form of the transcriptional regulator yodb from b. subtilis 0.7102 206 283
2fsw-assembly1.cif.gz_A crystal structure of the putative transcriptional regualator, marr family from porphyromonas gingivalis w83 0.7038 201 283
3pno-assembly2.cif.gz_D crystal structure of e.coli dha kinase dhak (h56n) 0.6972 89 128
3pnm-assembly1.cif.gz_B crystal structure of e.coli dha kinase dhak (h56a) 0.6966 89 128
5x11-assembly3.cif.gz_D crystal structure of bacillus subtilis padr in complex with operator dna 0.6893 205 279
ID Description Score Start End Superfamily
af_Q26454_780_865_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8126 214 264 1.10.10.10
af_A4I3U0_697_766_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7877 202 268 1.10.10.10
af_P9WN87_5_83_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7848 202 266 1.10.10.10
af_P41411_476_572_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7611 202 280 1.10.10.10
af_Q7X7L0_458_587_1.10.10.1420 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DNA replication factor Cdt1, C-terminal WH domain 0.7589 214 269 1.10.10.1420
ID Description Score Start End GO Terms
AF-A0A4Q5Z693-F1-model_v4 DUF1835 domain-containing protein 0.9889 1 122
AF-A0A4V1UUL4-F1-model_v4 DUF1835 domain-containing protein 0.9767 1 236
AF-A0A4Q3RAT1-F1-model_v4 DUF1835 domain-containing protein 0.9755 55 269
AF-A0A4R4E8N4-F1-model_v4 DUF1835 domain-containing protein 0.9693 1 269
AF-A0A2W5FAJ5-F1-model_v4 DUF1835 domain-containing protein 0.9692 1 161

Feature Viewer

pLDDT pTM Quality
93.27 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map