F474771

General Info

Members Datasets Scaffolds Average Seq Length
680 312 680 294

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10011849|Ga0105248_100118499
Length 324
Sequence MLPQALDRGNRVESRFFEAPQFMVSGSLVAIVTPMQEGGALDLSALGRLIDFQIANGTAAIVIVGTTGESPTVSVEEHCELIQAAIDHAAGRVPVIAGTGGNSTAEAIELTRFAKRAGAAACLSVVPYYNKPTQEGMYRHFRTIAEGVDLPLLLYNVPSRTVADLANETVLRLAEIPGVVGMKDATSDLVRLVDLRNRLPAGREFALYSGNDDTALAFMLLGGNGVISVTANVAPRAVSQMCAAALDNDVVAARTLNARLSNLNARLFVEANPIPVKWALAEMGLIHNELRLPLTPLSPRFHDVVRAALRDAGCLAEPAMKVYS

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
198 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
211 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
213 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
214 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
227 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
228 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
233 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
234 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
245 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
248 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
249 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
250 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
251 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
252 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
256 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
265 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
266 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
267 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
283 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
284 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
296 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
302 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
303 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
304 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
307 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
308 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
309 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
310 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
311 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 0
Rhizoplane 3.53
Rhizosphere 95.15
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10035996 3300005327 Bacteria 3988
2 Ga0070676_10000122 3300005328 Bacteria 28789
3 Ga0070676_10042311 3300005328 Bacteria 2644
4 Ga0070676_10138217 3300005328 Bacteria 1548
5 Ga0070683_100006372 3300005329 Bacteria 9896
6 Ga0070683_100031130 3300005329 Bacteria 4848
7 Ga0070683_100067797 3300005329 Bacteria 3324
8 Ga0070690_100004201 3300005330 Bacteria 7967
9 Ga0070690_100010115 3300005330 Bacteria 5480
10 Ga0070670_100052303 3300005331 Bacteria 3508
11 Ga0070670_100103301 3300005331 Bacteria 2455
12 Ga0070670_100201903 3300005331 Bacteria 1728
13 Ga0070677_10000198 3300005333 Bacteria 20764
14 Ga0070677_10014858 3300005333 Bacteria 2749
15 Ga0068869_100032922 3300005334 Bacteria 3656
16 Ga0068869_100047051 3300005334 Bacteria 3113
17 Ga0068869_100140270 3300005334 Bacteria 1866
18 Ga0070666_10002386 3300005335 Bacteria 11359
19 Ga0070666_10008975 3300005335 Bacteria 6223
20 Ga0070666_10072266 3300005335 Bacteria 2349
21 Ga0070666_10078321 3300005335 Bacteria 2256
22 Ga0070666_10111721 3300005335 Bacteria 1890
23 Ga0070680_100056629 3300005336 Bacteria 3204
24 Ga0068868_100001830 3300005338 Bacteria 14618
25 Ga0068868_100021617 3300005338 Bacteria 4846
26 Ga0068868_100034010 3300005338 Bacteria 3932
27 Ga0068868_100135471 3300005338 Bacteria 2018
28 Ga0068868_100244029 3300005338 Bacteria 1510
29 Ga0070660_100003481 3300005339 Bacteria 10841
30 Ga0070660_100036208 3300005339 Bacteria 3737
31 Ga0070660_100039103 3300005339 Bacteria 3604
32 Ga0070689_100028222 3300005340 Bacteria 4239
33 Ga0070689_100063093 3300005340 Bacteria 2884
34 Ga0070687_100043468 3300005343 Bacteria 2283
35 Ga0070661_100005534 3300005344 Bacteria 8706
36 Ga0070661_100066443 3300005344 Bacteria 2649
37 Ga0070661_100123918 3300005344 Bacteria 1937
38 Ga0070692_10016975 3300005345 Bacteria 3471
39 Ga0070692_10157777 3300005345 Bacteria 1297
40 Ga0070668_100001156 3300005347 Bacteria 18615
41 Ga0070668_100003210 3300005347 Bacteria 12042
42 Ga0070668_100003734 3300005347 Bacteria 11232
43 Ga0070668_100015694 3300005347 Bacteria 5665
44 Ga0070669_100050083 3300005353 Bacteria 3050
45 Ga0070669_100053770 3300005353 Bacteria 2948
46 Ga0070669_100070730 3300005353 Bacteria 2580
47 Ga0070669_100118560 3300005353 Bacteria 2016
48 Ga0070675_100000526 3300005354 Bacteria 26123
49 Ga0070675_100010306 3300005354 Bacteria 7297
50 Ga0070675_100048168 3300005354 Bacteria 3493
51 Ga0070675_100246507 3300005354 Bacteria 1562
52 Ga0070671_100000967 3300005355 Bacteria 21056
53 Ga0070671_100013069 3300005355 Bacteria 6689
54 Ga0070671_100032665 3300005355 Bacteria 4300
55 Ga0070671_100113830 3300005355 Bacteria 2273
56 Ga0070674_100055549 3300005356 Bacteria 2742
57 Ga0070673_100003819 3300005364 Bacteria 9451
58 Ga0070673_100008338 3300005364 Bacteria 6884
59 Ga0070673_100008627 3300005364 Bacteria 6791
60 Ga0070673_100048041 3300005364 Bacteria 3325
61 Ga0070688_100024345 3300005365 Bacteria 3571
62 Ga0070688_100096064 3300005365 Bacteria 1946
63 Ga0070659_100002917 3300005366 Bacteria 12183
64 Ga0070659_100012612 3300005366 Bacteria 6267
65 Ga0070659_100131719 3300005366 Bacteria 2031
66 Ga0070667_100000942 3300005367 Bacteria 26758
67 Ga0070667_100018956 3300005367 Bacteria 5705
68 Ga0070667_100060585 3300005367 Bacteria 3202
69 Ga0070667_100078737 3300005367 Bacteria 2816
70 Ga0070703_10031298 3300005406 Bacteria 1608
71 Ga0070709_10060769 3300005434 Bacteria 2403
72 Ga0070709_10181128 3300005434 Bacteria 1479
73 Ga0070709_10329318 3300005434 Bacteria 1123
74 Ga0070713_100000606 3300005436 Bacteria 22805
75 Ga0070713_100244651 3300005436 Bacteria 1634
76 Ga0070710_10018911 3300005437 Bacteria 3552
77 Ga0070710_10158256 3300005437 Bacteria 1402
78 Ga0070701_10091983 3300005438 Bacteria 1664
79 Ga0070705_100156937 3300005440 Bacteria 1516
80 Ga0070700_100008388 3300005441 Bacteria 5626
81 Ga0070700_100025478 3300005441 Bacteria 3482
82 Ga0070700_100193776 3300005441 Bacteria 1423
83 Ga0070694_100024144 3300005444 Bacteria 3922
84 Ga0070708_100013449 3300005445 Bacteria 6702
85 Ga0070708_100074023 3300005445 Bacteria 3071
86 Ga0070663_100003039 3300005455 Bacteria 9582
87 Ga0070663_100026977 3300005455 Bacteria 3896
88 Ga0070663_100052457 3300005455 Bacteria 2909
89 Ga0070663_100073688 3300005455 Bacteria 2491
90 Ga0070678_100000351 3300005456 Bacteria 21500
91 Ga0070678_100003883 3300005456 Bacteria 8396
92 Ga0070678_100005593 3300005456 Bacteria 7293
93 Ga0070662_100000444 3300005457 Bacteria 24451
94 Ga0070662_100026496 3300005457 Bacteria 4016
95 Ga0070662_100057168 3300005457 Bacteria 2834
96 Ga0070662_100129055 3300005457 Bacteria 1947
97 Ga0070662_100155600 3300005457 Bacteria 1784
98 Ga0070662_100381032 3300005457 Bacteria 1161
99 Ga0070681_10006101 3300005458 Bacteria 11694
100 Ga0070681_10099831 3300005458 Bacteria 2849
101 Ga0070681_10144404 3300005458 Bacteria 2309
102 Ga0068867_100004136 3300005459 Bacteria 10192
103 Ga0068867_100007487 3300005459 Bacteria 7722
104 Ga0070685_10029363 3300005466 Bacteria 3054
105 Ga0070685_10040072 3300005466 Bacteria 2665
106 Ga0070685_10041500 3300005466 Bacteria 2622
107 Ga0070706_100010757 3300005467 Bacteria 8491
108 Ga0070706_100010778 3300005467 Bacteria 8483
109 Ga0070707_100049758 3300005468 Bacteria 4017
110 Ga0070707_100061201 3300005468 Bacteria 3610
111 Ga0070698_100049554 3300005471 Bacteria 4286
112 Ga0070698_100109233 3300005471 Bacteria 2733
113 Ga0070699_100030219 3300005518 Bacteria 4676
114 Ga0070699_100040381 3300005518 Bacteria 4040
115 Ga0070699_100079095 3300005518 Bacteria 2864
116 Ga0070699_100186248 3300005518 Bacteria 1843
117 Ga0070679_100049641 3300005530 Bacteria 4179
118 Ga0070679_100063137 3300005530 Bacteria 3692
119 Ga0070679_100090121 3300005530 Bacteria 3055
120 Ga0070679_100116914 3300005530 Bacteria 2651
121 Ga0070684_100005461 3300005535 Bacteria 9739
122 Ga0070684_100022585 3300005535 Bacteria 5250
123 Ga0070684_100056429 3300005535 Bacteria 3428
124 Ga0070697_100261942 3300005536 Bacteria 1480
125 Ga0068853_100012806 3300005539 Bacteria 6832
126 Ga0068853_100019887 3300005539 Bacteria 5576
127 Ga0068853_100027863 3300005539 Bacteria 4750
128 Ga0068853_100049413 3300005539 Bacteria 3615
129 Ga0068853_100138755 3300005539 Bacteria 2181
130 Ga0070672_100000518 3300005543 Bacteria 22543
131 Ga0070672_100003540 3300005543 Bacteria 10121
132 Ga0070672_100026550 3300005543 Bacteria 4311
133 Ga0070672_100038267 3300005543 Bacteria 3664
134 Ga0070686_100000567 3300005544 Bacteria 22111
135 Ga0070686_100063416 3300005544 Bacteria 2394
136 Ga0070696_100026421 3300005546 Bacteria 3949
137 Ga0070693_100005955 3300005547 Bacteria 5893
138 Ga0070693_100088110 3300005547 Bacteria 1866
139 Ga0070665_100004668 3300005548 Bacteria 14307
140 Ga0070665_100016453 3300005548 Bacteria 7415
141 Ga0070665_100032204 3300005548 Bacteria 5277
142 Ga0070665_100126390 3300005548 Bacteria 2559
143 Ga0070665_100229541 3300005548 Bacteria 1856
144 Ga0070704_100034104 3300005549 Bacteria 3448
145 Ga0070704_100042183 3300005549 Bacteria 3155
146 Ga0068855_100017391 3300005563 Bacteria 8651
147 Ga0068855_100092597 3300005563 Bacteria 3486
148 Ga0068855_100146746 3300005563 Bacteria 2685
149 Ga0070664_100043363 3300005564 Bacteria 3796
150 Ga0070664_100055612 3300005564 Bacteria 3361
151 Ga0070664_100063023 3300005564 Bacteria 3161
152 Ga0070664_100139436 3300005564 Bacteria 2134
153 Ga0070664_100316395 3300005564 Bacteria 1413
154 Ga0068857_100127113 3300005577 Bacteria 2297
155 Ga0068854_100021151 3300005578 Bacteria 4412
156 Ga0068854_100033312 3300005578 Bacteria 3592
157 Ga0068854_100051327 3300005578 Bacteria 2954
158 Ga0068854_100174666 3300005578 Bacteria 1674
159 Ga0068856_100005096 3300005614 Bacteria 12983
160 Ga0068856_100008191 3300005614 Bacteria 10191
161 Ga0068856_100156590 3300005614 Bacteria 2288
162 Ga0068856_100567002 3300005614 Bacteria 1157
163 Ga0070702_100000998 3300005615 Bacteria 11181
164 Ga0070702_100001177 3300005615 Bacteria 10538
165 Ga0070702_100012295 3300005615 Bacteria 4283
166 Ga0068852_100008165 3300005616 Bacteria 7688
167 Ga0068852_100097170 3300005616 Bacteria 2649
168 Ga0068852_100515901 3300005616 Bacteria 1192
169 Ga0068859_100003361 3300005617 Bacteria 16279
170 Ga0068859_100022325 3300005617 Bacteria 6346
171 Ga0068859_100099642 3300005617 Bacteria 2961
172 Ga0068859_100108094 3300005617 Bacteria 2843
173 Ga0068859_100311319 3300005617 Bacteria 1668
174 Ga0068864_100001097 3300005618 Bacteria 22692
175 Ga0068864_100049791 3300005618 Bacteria 3605
176 Ga0068864_100093271 3300005618 Bacteria 2659
177 Ga0068866_10001245 3300005718 Bacteria 11055
178 Ga0068866_10018639 3300005718 Bacteria 3143
179 Ga0068861_100001593 3300005719 Bacteria 14445
180 Ga0068861_100014407 3300005719 Bacteria 5550
181 Ga0068861_100046676 3300005719 Bacteria 3266
182 Ga0068861_100135983 3300005719 Bacteria 2000
183 Ga0068851_10000630 3300005834 Bacteria 14986
184 Ga0068851_10008701 3300005834 Bacteria 4700
185 Ga0068851_10019037 3300005834 Bacteria 3316
186 Ga0068851_10119251 3300005834 Bacteria 1416
187 Ga0068870_10024046 3300005840 Bacteria 3012
188 Ga0068870_10027081 3300005840 Bacteria 2864
189 Ga0068870_10074719 3300005840 Bacteria 1857
190 Ga0068863_100003162 3300005841 Bacteria 16269
191 Ga0068863_100021594 3300005841 Bacteria 6140
192 Ga0068863_100053703 3300005841 Bacteria 3820
193 Ga0068858_100004484 3300005842 Bacteria 13688
194 Ga0068858_100008247 3300005842 Bacteria 10014
195 Ga0068860_100008422 3300005843 Bacteria 10273
196 Ga0068860_100063817 3300005843 Bacteria 3498
197 Ga0068860_100141533 3300005843 Bacteria 2312
198 Ga0068860_100214407 3300005843 Bacteria 1868
199 Ga0068862_100012885 3300005844 Bacteria 6915
200 Ga0068862_100031244 3300005844 Bacteria 4493
201 Ga0068862_100085993 3300005844 Bacteria 2733
202 Ga0081455_10187573 3300005937 Bacteria 1560
203 Ga0070717_10159017 3300006028 Bacteria 1959
204 Ga0075364_10002449 3300006051 Bacteria 10396
205 Ga0075364_10004063 3300006051 Bacteria 8397
206 Ga0070715_10044702 3300006163 Bacteria 1874
207 Ga0070716_100008591 3300006173 Bacteria 5074
208 Ga0070716_100147579 3300006173 Bacteria 1509
209 Ga0070716_100324360 3300006173 Bacteria 1080
210 Ga0070712_100013349 3300006175 Bacteria 5248
211 Ga0070712_100073754 3300006175 Bacteria 2449
212 Ga0097621_100021844 3300006237 Bacteria 4959
213 Ga0097621_100084093 3300006237 Bacteria 2652
214 Ga0097621_100147409 3300006237 Bacteria 2016
215 Ga0068871_100005276 3300006358 Bacteria 9046
216 Ga0068871_100170280 3300006358 Bacteria 1866
217 Ga0075428_100002681 3300006844 Bacteria 19354
218 Ga0075430_100044747 3300006846 Bacteria 3742
219 Ga0075433_10005211 3300006852 Bacteria 10184
220 Ga0075434_100018414 3300006871 Bacteria 6747
221 Ga0075434_100138553 3300006871 Bacteria 2453
222 Ga0075429_100055891 3300006880 Bacteria 3435
223 Ga0068865_100001499 3300006881 Bacteria 13616
224 Ga0068865_100050783 3300006881 Bacteria 2867
225 Ga0068865_100102797 3300006881 Bacteria 2094
226 Ga0068865_100110970 3300006881 Bacteria 2023
227 Ga0075436_100087423 3300006914 Bacteria 2165
228 Ga0075436_100156812 3300006914 Bacteria 1604
229 Ga0097620_100003360 3300006931 Bacteria 16279
230 Ga0097620_100022325 3300006931 Bacteria 6346
231 Ga0097620_100099631 3300006931 Bacteria 2961
232 Ga0097620_100108096 3300006931 Bacteria 2843
233 Ga0097620_100311320 3300006931 Bacteria 1668
234 Ga0075435_100154580 3300007076 Bacteria 1930
235 Ga0105240_10009886 3300009093 Bacteria 13460
236 Ga0105240_10013824 3300009093 Bacteria 11056
237 Ga0105240_10099010 3300009093 Bacteria 3550
238 Ga0105240_10109143 3300009093 Bacteria 3352
239 Ga0105240_10118721 3300009093 Bacteria 3187
240 Ga0111539_10001991 3300009094 Bacteria 27242
241 Ga0111539_10012858 3300009094 Bacteria 10472
242 Ga0105245_10000577 3300009098 Bacteria 33310
243 Ga0105245_10004771 3300009098 Bacteria 11962
244 Ga0105245_10061355 3300009098 Bacteria 3389
245 Ga0105245_10085625 3300009098 Bacteria 2889
246 Ga0105245_10091908 3300009098 Bacteria 2794
247 Ga0105247_10325563 3300009101 Bacteria 1074
248 Ga0114129_10627454 3300009147 Bacteria 1389
249 Ga0105243_10001035 3300009148 Bacteria 25558
250 Ga0105243_10208908 3300009148 Bacteria 1718
251 Ga0105241_10007912 3300009174 Bacteria 7816
252 Ga0105241_10307166 3300009174 Bacteria 1363
253 Ga0105241_10478785 3300009174 Bacteria 1106
254 Ga0105242_10008812 3300009176 Bacteria 7740
255 Ga0105242_10212304 3300009176 Bacteria 1726
256 Ga0105242_10395569 3300009176 Bacteria 1288
257 Ga0105248_10011849 3300009177 Bacteria 9619
258 Ga0105248_10089670 3300009177 Bacteria 3462
259 Ga0105237_10047979 3300009545 Bacteria 4293
260 Ga0105237_10095930 3300009545 Bacteria 2956
261 Ga0105237_10186671 3300009545 Bacteria 2073
262 Ga0105237_10425134 3300009545 Bacteria 1334
263 Ga0105238_10046317 3300009551 Bacteria 4389
264 Ga0105249_10018015 3300009553 Bacteria 6277
265 Ga0105239_10021034 3300010375 Bacteria 7200
266 Ga0105246_10031113 3300011119 Bacteria 3530
267 Ga0105246_10087977 3300011119 Bacteria 2231
268 Ga0157373_10005523 3300013100 Bacteria 9479
269 Ga0157371_10000371 3300013102 Bacteria 56697
270 Ga0157371_10058932 3300013102 Bacteria 2723
271 Ga0157371_10164120 3300013102 Bacteria 1586
272 Ga0157370_10023604 3300013104 Bacteria 6104
273 Ga0157370_10028315 3300013104 Bacteria 5513
274 Ga0157370_10077655 3300013104 Bacteria 3128
275 Ga0157370_10232186 3300013104 Bacteria 1707
276 Ga0157370_10265757 3300013104 Bacteria 1585
277 Ga0157369_10007450 3300013105 Bacteria 12604
278 Ga0157369_10144654 3300013105 Bacteria 2514
279 Ga0157369_10536945 3300013105 Bacteria 1209
280 Ga0157374_10000720 3300013296 Bacteria 28871
281 Ga0157374_10024529 3300013296 Bacteria 5408
282 Ga0157374_10062777 3300013296 Bacteria 3483
283 Ga0157374_10126570 3300013296 Bacteria 2470
284 Ga0157378_10003500 3300013297 Bacteria 13936
285 Ga0157378_10004135 3300013297 Bacteria 12819
286 Ga0157378_10008005 3300013297 Bacteria 9228
287 Ga0163162_10055310 3300013306 Bacteria 3994
288 Ga0163162_10060334 3300013306 Bacteria 3828
289 Ga0163162_10092185 3300013306 Bacteria 3113
290 Ga0157372_10001478 3300013307 Bacteria 25520
291 Ga0157372_10009553 3300013307 Bacteria 10311
292 Ga0157372_10047798 3300013307 Bacteria 4756
293 Ga0157372_10050509 3300013307 Bacteria 4626
294 Ga0157372_10190453 3300013307 Bacteria 2376
295 Ga0157372_10224984 3300013307 Bacteria 2175
296 Ga0157372_10468728 3300013307 Bacteria 1468
297 Ga0157375_10007014 3300013308 Bacteria 9838
298 Ga0157375_10010931 3300013308 Bacteria 8006
299 Ga0157375_10014430 3300013308 Bacteria 7048
300 Ga0157375_10046469 3300013308 Bacteria 4233
301 Ga0163163_10002600 3300014325 Bacteria 15303
302 Ga0163163_10013776 3300014325 Bacteria 7413
303 Ga0163163_10015054 3300014325 Bacteria 7134
304 Ga0163163_10230113 3300014325 Bacteria 1903
305 Ga0157380_10046805 3300014326 Bacteria 3399
306 Ga0157380_10056834 3300014326 Bacteria 3114
307 Ga0157377_10013266 3300014745 Bacteria 4168
308 Ga0157379_10002330 3300014968 Bacteria 15820
309 Ga0157379_10014911 3300014968 Bacteria 6817
310 Ga0157379_10021187 3300014968 Bacteria 5753
311 Ga0157376_10010402 3300014969 Bacteria 6803
312 Ga0157376_10015366 3300014969 Bacteria 5781
313 Ga0157376_10068460 3300014969 Bacteria 3006
314 Ga0157376_10068644 3300014969 Bacteria 3003
315 Ga0157376_10220029 3300014969 Bacteria 1758
316 Ga0157376_10320279 3300014969 Bacteria 1474
317 Ga0163161_10041147 3300017792 Bacteria 3320
318 Ga0163161_10120829 3300017792 Bacteria 1968
319 Ga0206356_10058451 3300020070 Bacteria 2129
320 Ga0206353_10486998 3300020082 Bacteria 1579
321 Ga0206353_11987424 3300020082 Bacteria 1933
322 Ga0207666_1001100 3300025271 Bacteria 3199
323 Ga0207673_1000515 3300025290 Bacteria 4085
324 Ga0207697_10000008 3300025315 Bacteria 71181
325 Ga0207656_10001098 3300025321 Bacteria 8881
326 Ga0207656_10007827 3300025321 Bacteria 3913
327 Ga0207682_10000078 3300025893 Bacteria 43151
328 Ga0207682_10000117 3300025893 Bacteria 36804
329 Ga0207692_10008605 3300025898 Bacteria 4231
330 Ga0207692_10045043 3300025898 Bacteria 2204
331 Ga0207692_10080625 3300025898 Bacteria 1740
332 Ga0207642_10024182 3300025899 Bacteria 2439
333 Ga0207642_10050958 3300025899 Bacteria 1870
334 Ga0207688_10002921 3300025901 Bacteria 9297
335 Ga0207680_10002794 3300025903 Bacteria 8171
336 Ga0207680_10008989 3300025903 Bacteria 4931
337 Ga0207680_10011741 3300025903 Bacteria 4437
338 Ga0207645_10000139 3300025907 Bacteria 55848
339 Ga0207645_10002794 3300025907 Bacteria 13588
340 Ga0207645_10006546 3300025907 Bacteria 8340
341 Ga0207643_10000089 3300025908 Bacteria 61020
342 Ga0207643_10003122 3300025908 Bacteria 8913
343 Ga0207705_10026936 3300025909 Bacteria 4097
344 Ga0207684_10092365 3300025910 Bacteria 2579
345 Ga0207654_10129481 3300025911 Bacteria 1596
346 Ga0207654_10303432 3300025911 Bacteria 1087
347 Ga0207707_10005597 3300025912 Bacteria 10993
348 Ga0207707_10009551 3300025912 Bacteria 8416
349 Ga0207707_10176303 3300025912 Bacteria 1867
350 Ga0207695_10029445 3300025913 Bacteria 6066
351 Ga0207695_10031252 3300025913 Bacteria 5843
352 Ga0207695_10117276 3300025913 Bacteria 2635
353 Ga0207671_10056495 3300025914 Bacteria 2908
354 Ga0207671_10180276 3300025914 Bacteria 1644
355 Ga0207671_10449201 3300025914 Bacteria 1027
356 Ga0207693_10011584 3300025915 Bacteria 7134
357 Ga0207693_10015406 3300025915 Bacteria 6134
358 Ga0207693_10127184 3300025915 Bacteria 2003
359 Ga0207693_10221888 3300025915 Bacteria 1485
360 Ga0207663_10266408 3300025916 Bacteria 1267
361 Ga0207662_10007173 3300025918 Bacteria 6062
362 Ga0207657_10000240 3300025919 Bacteria 58053
363 Ga0207657_10003754 3300025919 Bacteria 16143
364 Ga0207657_10007138 3300025919 Bacteria 11473
365 Ga0207657_10039050 3300025919 Bacteria 4221
366 Ga0207657_10146951 3300025919 Bacteria 1922
367 Ga0207649_10010697 3300025920 Bacteria 5044
368 Ga0207649_10010878 3300025920 Bacteria 5002
369 Ga0207649_10085182 3300025920 Bacteria 2056
370 Ga0207652_10007096 3300025921 Bacteria 9027
371 Ga0207652_10009720 3300025921 Bacteria 7738
372 Ga0207652_10043799 3300025921 Bacteria 3811
373 Ga0207646_10004149 3300025922 Bacteria 15900
374 Ga0207646_10069153 3300025922 Bacteria 3154
375 Ga0207681_10034195 3300025923 Bacteria 3340
376 Ga0207681_10041160 3300025923 Bacteria 3079
377 Ga0207694_10022444 3300025924 Bacteria 4787
378 Ga0207650_10013214 3300025925 Bacteria 5713
379 Ga0207650_10015761 3300025925 Bacteria 5269
380 Ga0207650_10057043 3300025925 Bacteria 2904
381 Ga0207659_10005051 3300025926 Bacteria 8002
382 Ga0207659_10023410 3300025926 Bacteria 4121
383 Ga0207659_10047517 3300025926 Bacteria 3036
384 Ga0207659_10102955 3300025926 Bacteria 2156
385 Ga0207687_10000317 3300025927 Bacteria 32913
386 Ga0207687_10065574 3300025927 Bacteria 2579
387 Ga0207700_10000045 3300025928 Bacteria 88536
388 Ga0207664_10009563 3300025929 Bacteria 6808
389 Ga0207664_10009841 3300025929 Bacteria 6729
390 Ga0207644_10009740 3300025931 Bacteria 6318
391 Ga0207644_10015521 3300025931 Bacteria 5115
392 Ga0207644_10019614 3300025931 Bacteria 4590
393 Ga0207644_10024382 3300025931 Bacteria 4152
394 Ga0207644_10057709 3300025931 Bacteria 2803
395 Ga0207690_10003316 3300025932 Bacteria 9631
396 Ga0207690_10013493 3300025932 Bacteria 4911
397 Ga0207690_10109872 3300025932 Bacteria 1984
398 Ga0207706_10000002 3300025933 Bacteria 360309
399 Ga0207706_10000456 3300025933 Bacteria 43575
400 Ga0207706_10003686 3300025933 Bacteria 14622
401 Ga0207706_10007830 3300025933 Bacteria 9860
402 Ga0207706_10075986 3300025933 Bacteria 2955
403 Ga0207686_10005671 3300025934 Bacteria 6691
404 Ga0207686_10107057 3300025934 Bacteria 1878
405 Ga0207686_10110601 3300025934 Bacteria 1852
406 Ga0207670_10046494 3300025936 Bacteria 2884
407 Ga0207670_10130384 3300025936 Bacteria 1841
408 Ga0207669_10004151 3300025937 Bacteria 6350
409 Ga0207704_10021641 3300025938 Bacteria 3429
410 Ga0207704_10024013 3300025938 Bacteria 3297
411 Ga0207665_10022079 3300025939 Bacteria 4185
412 Ga0207665_10029662 3300025939 Bacteria 3615
413 Ga0207665_10070385 3300025939 Bacteria 2387
414 Ga0207691_10000040 3300025940 Bacteria 106561
415 Ga0207691_10001760 3300025940 Bacteria 21320
416 Ga0207691_10068280 3300025940 Bacteria 3212
417 Ga0207691_10135196 3300025940 Bacteria 2175
418 Ga0207711_10000115 3300025941 Bacteria 83472
419 Ga0207711_10004590 3300025941 Bacteria 11742
420 Ga0207711_10123889 3300025941 Bacteria 2310
421 Ga0207689_10000269 3300025942 Bacteria 46995
422 Ga0207689_10001313 3300025942 Bacteria 23952
423 Ga0207689_10085962 3300025942 Bacteria 2585
424 Ga0207661_10035054 3300025944 Bacteria 3908
425 Ga0207661_10119628 3300025944 Bacteria 2240
426 Ga0207661_10291948 3300025944 Bacteria 1459
427 Ga0207679_10030342 3300025945 Bacteria 3774
428 Ga0207679_10048079 3300025945 Bacteria 3103
429 Ga0207679_10066160 3300025945 Bacteria 2707
430 Ga0207679_10066682 3300025945 Bacteria 2698
431 Ga0207679_10555816 3300025945 Bacteria 1030
432 Ga0207667_10007251 3300025949 Bacteria 13377
433 Ga0207667_10046434 3300025949 Bacteria 4599
434 Ga0207667_10073737 3300025949 Bacteria 3546
435 Ga0207667_10085333 3300025949 Bacteria 3269
436 Ga0207667_10103721 3300025949 Bacteria 2933
437 Ga0207667_10129035 3300025949 Bacteria 2604
438 Ga0207667_10203999 3300025949 Bacteria 2028
439 Ga0207651_10007535 3300025960 Bacteria 5805
440 Ga0207651_10021228 3300025960 Bacteria 3941
441 Ga0207651_10061490 3300025960 Bacteria 2612
442 Ga0207651_10084579 3300025960 Bacteria 2298
443 Ga0207651_10096875 3300025960 Bacteria 2177
444 Ga0207651_10145069 3300025960 Bacteria 1839
445 Ga0207668_10016655 3300025972 Bacteria 4591
446 Ga0207668_10023002 3300025972 Bacteria 3998
447 Ga0207640_10004249 3300025981 Bacteria 7752
448 Ga0207640_10052028 3300025981 Bacteria 2666
449 Ga0207640_10058583 3300025981 Bacteria 2538
450 Ga0207640_10097994 3300025981 Bacteria 2048
451 Ga0207658_10005849 3300025986 Bacteria 8412
452 Ga0207658_10012579 3300025986 Bacteria 5776
453 Ga0207658_10018810 3300025986 Bacteria 4777
454 Ga0207658_10075987 3300025986 Bacteria 2557
455 Ga0207658_10089993 3300025986 Bacteria 2377
456 Ga0207658_10104660 3300025986 Bacteria 2224
457 Ga0207658_10356999 3300025986 Bacteria 1274
458 Ga0207658_10376696 3300025986 Bacteria 1242
459 Ga0207677_10000395 3300026023 Bacteria 30050
460 Ga0207677_10007177 3300026023 Bacteria 6138
461 Ga0207677_10063315 3300026023 Bacteria 2570
462 Ga0207677_10087400 3300026023 Bacteria 2257
463 Ga0207677_10094308 3300026023 Bacteria 2184
464 Ga0207703_10001683 3300026035 Bacteria 19881
465 Ga0207703_10012230 3300026035 Bacteria 6693
466 Ga0207703_10034169 3300026035 Bacteria 4034
467 Ga0207703_10104793 3300026035 Bacteria 2403
468 Ga0207639_10017622 3300026041 Bacteria 5064
469 Ga0207639_10056721 3300026041 Bacteria 3003
470 Ga0207639_10312571 3300026041 Bacteria 1392
471 Ga0207678_10002147 3300026067 Bacteria 17862
472 Ga0207678_10006705 3300026067 Bacteria 10212
473 Ga0207678_10011219 3300026067 Bacteria 7872
474 Ga0207678_10031953 3300026067 Bacteria 4589
475 Ga0207678_10198229 3300026067 Bacteria 1716
476 Ga0207708_10000163 3300026075 Bacteria 52435
477 Ga0207708_10007905 3300026075 Bacteria 7882
478 Ga0207702_10002872 3300026078 Bacteria 16113
479 Ga0207702_10021255 3300026078 Bacteria 5370
480 Ga0207702_10044739 3300026078 Bacteria 3721
481 Ga0207702_10046379 3300026078 Bacteria 3658
482 Ga0207702_10148459 3300026078 Bacteria 2130
483 Ga0207641_10005149 3300026088 Bacteria 11192
484 Ga0207641_10006084 3300026088 Bacteria 10217
485 Ga0207641_10044920 3300026088 Bacteria 3717
486 Ga0207641_10067943 3300026088 Bacteria 3055
487 Ga0207641_10356311 3300026088 Bacteria 1395
488 Ga0207648_10000059 3300026089 Bacteria 103580
489 Ga0207648_10001517 3300026089 Bacteria 25560
490 Ga0207648_10005981 3300026089 Bacteria 12164
491 Ga0207648_10041222 3300026089 Bacteria 4054
492 Ga0207676_10001026 3300026095 Bacteria 21347
493 Ga0207676_10065012 3300026095 Bacteria 2903
494 Ga0207676_10074551 3300026095 Bacteria 2734
495 Ga0207674_10000974 3300026116 Bacteria 37418
496 Ga0207674_10002009 3300026116 Bacteria 25831
497 Ga0207674_10010118 3300026116 Bacteria 10723
498 Ga0207675_100011849 3300026118 Bacteria 8147
499 Ga0207675_100020246 3300026118 Bacteria 6202
500 Ga0207675_100025786 3300026118 Bacteria 5470
501 Ga0207675_100309682 3300026118 Bacteria 1540
502 Ga0207683_10000059 3300026121 Bacteria 83666
503 Ga0207683_10001225 3300026121 Bacteria 23300
504 Ga0207683_10001439 3300026121 Bacteria 21523
505 Ga0207683_10005472 3300026121 Bacteria 10881
506 Ga0207683_10290289 3300026121 Bacteria 1495
507 Ga0207698_10015380 3300026142 Bacteria 5121
508 Ga0207698_10024627 3300026142 Bacteria 4228
509 Ga0207698_10097203 3300026142 Bacteria 2429
510 Ga0207698_10477969 3300026142 Bacteria 1208
511 Ga0209969_1005305 3300027360 Bacteria 1806
512 Ga0209967_1001171 3300027364 Bacteria 3351
513 Ga0210000_1000390 3300027462 Bacteria 6124
514 Ga0210000_1004354 3300027462 Bacteria 2046
515 Ga0209999_1003339 3300027543 Bacteria 2865
516 Ga0209982_1006994 3300027552 Bacteria 1648
517 Ga0210002_1017817 3300027617 Bacteria 1133
518 Ga0209971_1004564 3300027682 Bacteria 3287
519 Ga0209998_10002472 3300027717 Bacteria 4226
520 Ga0209974_10001154 3300027876 Bacteria 9405
521 Ga0209974_10002238 3300027876 Bacteria 7032
522 Ga0207428_10002668 3300027907 Bacteria 17770
523 Ga0268266_10005648 3300028379 Bacteria 11602
524 Ga0268266_10020068 3300028379 Bacteria 5696
525 Ga0268266_10136609 3300028379 Bacteria 2197
526 Ga0268266_10244913 3300028379 Bacteria 1656
527 Ga0268266_10544288 3300028379 Bacteria 1112
528 Ga0268265_10077772 3300028380 Bacteria 2607
529 Ga0268264_10004260 3300028381 Bacteria 12212
530 Ga0268264_10020915 3300028381 Bacteria 5345
531 Ga0268264_10174869 3300028381 Bacteria 1945
532 Ga0265328_10000021 3300031239 Bacteria 125696
533 Ga0265327_10004647 3300031251 Bacteria 12043
534 Ga0307408_100049860 3300031548 Bacteria 3008
535 Ga0307408_100140500 3300031548 Bacteria 1895
536 Ga0316576_10001149 3300031727 Bacteria 13874
537 Ga0316578_10074717 3300031728 Bacteria 2010
538 Ga0307516_10050290 3300031730 Unclassified 4090
539 Ga0307405_10005409 3300031731 Bacteria 6158
540 Ga0316577_10057485 3300031733 Bacteria 2172
541 Ga0307413_10005439 3300031824 Bacteria 5688
542 Ga0307413_10360171 3300031824 Bacteria 1126
543 Ga0307410_10001877 3300031852 Bacteria 9804
544 Ga0307406_10025526 3300031901 Bacteria 3538
545 Ga0307412_10041809 3300031911 Bacteria 2973
546 Ga0307409_100015956 3300031995 Bacteria 4951
547 Ga0307416_100154629 3300032002 Bacteria 2109
548 Ga0307411_10000620 3300032005 Bacteria 12819
549 Ga0307415_100004742 3300032126 Bacteria 7117
550 Ga0373926_0032886 3300035083 Bacteria 1831
551 Ga0373923_0007418 3300035111 Bacteria 3855
552 Ga0373954_0012955 3300035118 Bacteria 3713
553 Ga0373954_0188308 3300035118 Bacteria 1013
554 Ga0373956_0142348 3300035119 Bacteria 1126
555 Ga0373957_0007641 3300035120 Bacteria 3467
556 Ga0373955_0028201 3300035172 Bacteria 2909
557 Ga0373955_0061871 3300035172 Bacteria 2069
558 Ga0373924_0000748 3300035410 Bacteria 10132
559 Ga0373924_0017273 3300035410 Bacteria 2765
560 Ga0373931_0005073 3300035691 Bacteria 6057
561 Ga0373931_0080408 3300035691 Bacteria 1797
562 Ga0373935_0084733 3300035692 Bacteria 2065
563 Ga0373927_0070101 3300035695 Bacteria 2269
564 Ga0373927_0141833 3300035695 Bacteria 1572
565 Ga0373933_0046053 3300035724 Bacteria 2588
566 Ga0373933_0228326 3300035724 Bacteria 1195
567 Ga0373933_0268493 3300035724 Bacteria 1101
568 Ga0373947_0047985 3300035725 Bacteria 2561
569 Ga0373937_0155380 3300036401 Bacteria 2144
570 Ga0373937_0310981 3300036401 Bacteria 1490
571 Ga0316584_0165877 3300036712 Bacteria 1640
572 Ga0373925_0017257 3300037068 Bacteria 5228
573 Ga0373925_0027475 3300037068 Bacteria 4165
574 Ga0451853_1015325 3300041512 Bacteria 1672
575 Ga0439441_001142 3300042001 Bacteria 3337
576 Ga0439448_0040343 3300042005 Bacteria 1508
577 Ga0450893_0040330 3300042532 Bacteria 854
578 Ga0451577_0065992 3300042876 Bacteria 3227
579 Ga0453684_0036941 3300044712 Bacteria 6717
580 Ga0451576_0185197 3300045051 Bacteria 2174
581 Ga0466967_0196621 3300045976 Bacteria 1908
582 Ga0495592_0164315 3300046454 Bacteria 1525
583 Ga0495603_0239913 3300046455 Bacteria 1044
584 Ga0495629_0140560 3300046459 Bacteria 1680
585 Ga0495638_0045596 3300046460 Bacteria 2757
586 Ga0495638_0057570 3300046460 Bacteria 2410
587 Ga0495651_0239889 3300046462 Bacteria 1244
588 Ga0495580_0007298 3300046472 Bacteria 8885
589 Ga0495582_0021865 3300046473 Bacteria 3499
590 Ga0495639_0057288 3300046475 Bacteria 1780
591 Ga0495664_0019930 3300046477 Bacteria 3863
592 Ga0495585_0000183 3300046492 Bacteria 66586
593 Ga0495585_0010876 3300046492 Bacteria 5406
594 Ga0495606_0006253 3300046507 Bacteria 11054
595 Ga0495608_0264253 3300046511 Bacteria 1071
596 Ga0495616_0137327 3300046513 Bacteria 1116
597 Ga0495628_0192156 3300046516 Bacteria 1541
598 Ga0495663_0010608 3300046525 Bacteria 2563
599 Ga0495642_0004167 3300046528 Bacteria 5642
600 Ga0495642_0021154 3300046528 Bacteria 2557
601 Ga0495665_0012100 3300046531 Bacteria 4671
602 Ga0495640_0168999 3300046533 Bacteria 1398
603 Ga0495598_0008674 3300046537 Bacteria 2376
604 Ga0495621_0002301 3300046539 Bacteria 5126
605 Ga0495645_0071531 3300046543 Bacteria 2501
606 Ga0495635_0002903 3300046663 Bacteria 11774
607 Ga0495661_0064947 3300046665 Bacteria 2151
608 Ga0495657_0129632 3300046675 Bacteria 1581
609 Ga0495623_0137887 3300046679 Bacteria 1454
610 Ga0495647_0005522 3300046681 Bacteria 4147
611 Ga0495658_0066125 3300046683 Bacteria 2087
612 Ga0495613_0078176 3300046689 Bacteria 2407
613 Ga0495600_0139991 3300046809 Bacteria 1570
614 Ga0495581_0000877 3300047315 Bacteria 16067
615 Ga0495604_0029175 3300047317 Bacteria 4389
616 Ga0495680_0178056 3300047322 Bacteria 1536
617 Ga0495675_0095241 3300047444 Bacteria 1867
618 Ga0495614_0029641 3300048089 Bacteria 2355
619 Ga0495615_0006487 3300048090 Bacteria 2170
620 Ga0496100_0101355 3300048903 Bacteria 1985
621 Ga0496101_0046735 3300048904 Bacteria 3106
622 Ga0496101_0243927 3300048904 Bacteria 1398
623 Ga0496102_0060090 3300048905 Bacteria 3477
624 Ga0496102_0289759 3300048905 Bacteria 1543
625 Ga0496103_0105954 3300048906 Bacteria 1783
626 Ga0496104_0020039 3300048907 Bacteria 6126
627 Ga0496104_0241354 3300048907 Bacteria 1719
628 Ga0496105_0003430 3300048908 Bacteria 11732
629 Ga0496106_0002245 3300048909 Bacteria 14401
630 Ga0496106_0026769 3300048909 Bacteria 4295
631 Ga0496106_0031246 3300048909 Bacteria 3967
632 Ga0496107_0012148 3300048910 Bacteria 6007
633 Ga0496107_0062535 3300048910 Bacteria 2697
634 Ga0496108_0194232 3300048911 Bacteria 1760
635 Ga0496109_0013547 3300048912 Bacteria 7079
636 Ga0496109_0055446 3300048912 Bacteria 3616
637 Ga0496109_0087837 3300048912 Bacteria 2872
638 Ga0496110_0015445 3300048913 Bacteria 6355
639 Ga0496112_0019696 3300048915 Bacteria 6376
640 Ga0496113_0201424 3300048916 Bacteria 1582
641 Ga0496115_0006889 3300048918 Bacteria 8347
642 Ga0496115_0140125 3300048918 Bacteria 1995
643 Ga0496115_0174452 3300048918 Bacteria 1778
644 Ga0496125_0004893 3300048928 Bacteria 15183
645 Ga0501295_003521 3300049518 Bacteria 1929
646 Ga0501032_0010705 3300049569 Bacteria 6600
647 Ga0501033_0066257 3300049570 Bacteria 2656
648 Ga0501034_0076671 3300049571 Bacteria 3349
649 Ga0501034_0153436 3300049571 Bacteria 2278
650 Ga0501038_0016387 3300049574 Bacteria 6717
651 Ga0501039_0000901 3300049575 Bacteria 21633
652 Ga0501039_0013917 3300049575 Bacteria 6154
653 Ga0501040_0089042 3300049576 Bacteria 2144
654 Ga0501041_0007189 3300049577 Bacteria 6532
655 Ga0501042_0008620 3300049578 Bacteria 6748
656 Ga0501046_0151018 3300049580 Bacteria 1752
657 Ga0501048_0094128 3300049582 Bacteria 2113
658 Ga0501071_0022730 3300049587 Bacteria 4373
659 Ga0501075_0019282 3300049591 Bacteria 4946
660 Ga0501076_0000468 3300049592 Bacteria 25466
661 Ga0501079_0014141 3300049741 Bacteria 6083
662 Ga0501080_0010515 3300049742 Bacteria 8471
663 Ga0501081_0000619 3300049743 Bacteria 20290
664 Ga0501035_0092453 3300049822 Bacteria 2662
665 Ga0501035_0105994 3300049822 Bacteria 2465
666 Ga0501045_0042010 3300049824 Bacteria 3328
667 nmdc:mga00v17_14722_c1 3300050491 Bacteria 4374
668 nmdc:mga0yw44_46271_c1 3300050492 Bacteria 2612
669 nmdc:mga0qj67_63803_c1 3300050509 Bacteria 2929
670 nmdc:mga08y16_309869_c1 3300050511 Bacteria 1626
671 nmdc:mga08y16_682_c1 3300050511 Bacteria 32091
672 nmdc:mga08x19_35613_c1 3300050514 Bacteria 3150
673 nmdc:mga08x19_76133_c1 3300050514 Bacteria 2195
674 nmdc:mga08x19_84874_c1 3300050514 Bacteria 2083
675 nmdc:mga0a205_7849_c2 3300050515 Bacteria 8925
676 Ga0495619_0009678 3300053085 Bacteria 6078
677 Ga0500650_0063687 3300053098 Bacteria 1723
678 Ga0500622_0000023 3300053156 Bacteria 251170
679 Ga0501084_0028010 3300054114 Bacteria 4708
680 Ga0501082_0002263 3300060353 Bacteria 16866

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042532 Ga0450893_0040330 Ga0450893_0040330_74_811 242
2 3300049822 Ga0501035_0092453 Ga0501035_0092453_421_1299 251
3 3300005334 Ga0068869_100047051 Ga0068869_1000470512 256
4 3300005617 Ga0068859_100022325 Ga0068859_1000223257 256
5 3300006931 Ga0097620_100022325 Ga0097620_1000223257 256
6 3300025986 Ga0207658_10376696 Ga0207658_103766962 261
7 3300005339 Ga0070660_100036208 Ga0070660_1000362084 263
8 3300005616 Ga0068852_100097170 Ga0068852_1000971702 263
9 3300013104 Ga0157370_10077655 Ga0157370_100776553 263
10 3300013105 Ga0157369_10007450 Ga0157369_100074502 263
11 3300025919 Ga0207657_10146951 Ga0207657_101469512 263
12 3300025932 Ga0207690_10013493 Ga0207690_100134933 263
13 3300025949 Ga0207667_10103721 Ga0207667_101037213 263
14 3300026142 Ga0207698_10097203 Ga0207698_100972032 263
15 3300020082 Ga0206353_11987424 Ga0206353_119874242 265
16 3300005339 Ga0070660_100003481 Ga0070660_10000348110 266
17 3300005353 Ga0070669_100053770 Ga0070669_1000537703 266
18 3300005355 Ga0070671_100000967 Ga0070671_1000009679 266
19 3300005364 Ga0070673_100048041 Ga0070673_1000480413 266
20 3300005366 Ga0070659_100002917 Ga0070659_1000029176 266
21 3300005455 Ga0070663_100003039 Ga0070663_1000030397 266
22 3300005457 Ga0070662_100000444 Ga0070662_10000044421 266
23 3300005539 Ga0068853_100027863 Ga0068853_1000278632 266
24 3300005563 Ga0068855_100017391 Ga0068855_1000173917 266
25 3300005564 Ga0070664_100139436 Ga0070664_1001394362 266
26 3300005578 Ga0068854_100174666 Ga0068854_1001746662 266
27 3300005614 Ga0068856_100008191 Ga0068856_1000081917 266
28 3300005834 Ga0068851_10119251 Ga0068851_101192512 266
29 3300013100 Ga0157373_10005523 Ga0157373_100055237 266
30 3300013102 Ga0157371_10000371 Ga0157371_1000037145 266
31 3300013105 Ga0157369_10536945 Ga0157369_105369451 266
32 3300013307 Ga0157372_10001478 Ga0157372_1000147815 266
33 3300025907 Ga0207645_10006546 Ga0207645_100065466 266
34 3300025912 Ga0207707_10176303 Ga0207707_101763031 266
35 3300025919 Ga0207657_10007138 Ga0207657_100071389 266
36 3300025923 Ga0207681_10034195 Ga0207681_100341952 266
37 3300025931 Ga0207644_10019614 Ga0207644_100196144 266
38 3300025932 Ga0207690_10003316 Ga0207690_100033169 266
39 3300025933 Ga0207706_10000002 Ga0207706_10000002180 266
40 3300025945 Ga0207679_10048079 Ga0207679_100480793 266
41 3300025949 Ga0207667_10203999 Ga0207667_102039992 266
42 3300025960 Ga0207651_10145069 Ga0207651_101450693 266
43 3300025981 Ga0207640_10097994 Ga0207640_100979942 266
44 3300026067 Ga0207678_10006705 Ga0207678_100067059 266
45 3300026078 Ga0207702_10002872 Ga0207702_100028723 266
46 3300026121 Ga0207683_10290289 Ga0207683_102902891 266
47 3300048904 Ga0496101_0243927 Ga0496101_0243927_420_1328 266
48 3300048905 Ga0496102_0060090 Ga0496102_0060090_1458_2366 266
49 3300048909 Ga0496106_0002245 Ga0496106_0002245_5637_6545 266
50 3300048910 Ga0496107_0012148 Ga0496107_0012148_4781_5689 266
51 3300005563 Ga0068855_100146746 Ga0068855_1001467462 267
52 3300005330 Ga0070690_100004201 Ga0070690_1000042013 272
53 3300005345 Ga0070692_10157777 Ga0070692_101577772 272
54 3300005365 Ga0070688_100096064 Ga0070688_1000960642 272
55 3300005441 Ga0070700_100008388 Ga0070700_1000083885 272
56 3300005444 Ga0070694_100024144 Ga0070694_1000241444 272
57 3300005466 Ga0070685_10029363 Ga0070685_100293634 272
58 3300005547 Ga0070693_100088110 Ga0070693_1000881101 272
59 3300005549 Ga0070704_100042183 Ga0070704_1000421832 272
60 3300005615 Ga0070702_100000998 Ga0070702_1000009987 272
61 3300005718 Ga0068866_10001245 Ga0068866_100012459 272
62 3300005719 Ga0068861_100001593 Ga0068861_10000159314 272
63 3300005844 Ga0068862_100012885 Ga0068862_1000128852 272
64 3300005937 Ga0081455_10187573 Ga0081455_101875732 272
65 3300009176 Ga0105242_10008812 Ga0105242_100088129 272
66 3300014969 Ga0157376_10068644 Ga0157376_100686442 272
67 3300025934 Ga0207686_10005671 Ga0207686_100056713 272
68 3300025942 Ga0207689_10000269 Ga0207689_1000026928 272
69 3300026075 Ga0207708_10000163 Ga0207708_1000016333 272
70 3300026089 Ga0207648_10000059 Ga0207648_1000005930 272
71 3300026118 Ga0207675_100011849 Ga0207675_1000118497 272
72 3300005436 Ga0070713_100244651 Ga0070713_1002446511 274
73 3300005546 Ga0070696_100026421 Ga0070696_1000264215 277
74 3300031548 Ga0307408_100049860 Ga0307408_1000498602 278
75 3300031731 Ga0307405_10005409 Ga0307405_100054094 278
76 3300031824 Ga0307413_10005439 Ga0307413_100054395 278
77 3300031852 Ga0307410_10001877 Ga0307410_100018774 278
78 3300031901 Ga0307406_10025526 Ga0307406_100255264 278
79 3300031911 Ga0307412_10041809 Ga0307412_100418093 278
80 3300031995 Ga0307409_100015956 Ga0307409_1000159561 278
81 3300032002 Ga0307416_100154629 Ga0307416_1001546291 278
82 3300032005 Ga0307411_10000620 Ga0307411_100006209 278
83 3300032126 Ga0307415_100004742 Ga0307415_1000047424 278
84 3300009093 Ga0105240_10099010 Ga0105240_100990105 280
85 3300026041 Ga0207639_10312571 Ga0207639_103125711 280
86 3300035119 Ga0373956_0142348 Ga0373956_0142348_250_1095 281
87 3300046454 Ga0495592_0164315 Ga0495592_0164315_30_875 281
88 3300046462 Ga0495651_0239889 Ga0495651_0239889_381_1226 281
89 3300005347 Ga0070668_100001156 Ga0070668_10000115618 282
90 3300005353 Ga0070669_100118560 Ga0070669_1001185602 282
91 3300005441 Ga0070700_100193776 Ga0070700_1001937762 282
92 3300005543 Ga0070672_100038267 Ga0070672_1000382673 282
93 3300005844 Ga0068862_100085993 Ga0068862_1000859932 282
94 3300025940 Ga0207691_10135196 Ga0207691_101351963 282
95 3300028380 Ga0268265_10077772 Ga0268265_100777723 282
96 3300036401 Ga0373937_0155380 Ga0373937_0155380_824_1702 282
97 3300046525 Ga0495663_0010608 Ga0495663_0010608_668_1516 282
98 3300009177 Ga0105248_10089670 Ga0105248_100896701 287
99 3300009094 Ga0111539_10001991 Ga0111539_1000199119 288
100 3300035691 Ga0373931_0080408 Ga0373931_0080408_907_1779 288
101 3300050511 nmdc:mga08y16_682_c1 nmdc:mga08y16_682_c1_12873_13745 288
102 3300031251 Ga0265327_10004647 Ga0265327_100046473 290
103 3300031733 Ga0316577_10057485 Ga0316577_100574852 290
104 3300036712 Ga0316584_0165877 Ga0316584_0165877_31_903 290
105 3300048916 Ga0496113_0201424 Ga0496113_0201424_689_1561 290
106 3300053156 Ga0500622_0000023 Ga0500622_0000023_167832_168704 290
107 3300006051 Ga0075364_10002449 Ga0075364_100024495 291
108 3300006051 Ga0075364_10004063 Ga0075364_1000406312 291
109 3300031239 Ga0265328_10000021 Ga0265328_10000021109 291
110 3300031548 Ga0307408_100140500 Ga0307408_1001405002 291
111 3300031727 Ga0316576_10001149 Ga0316576_100011494 291
112 3300031728 Ga0316578_10074717 Ga0316578_100747172 291
113 3300031730 Ga0307516_10050290 Ga0307516_100502905 291
114 3300031824 Ga0307413_10360171 Ga0307413_103601712 291
115 3300035410 Ga0373924_0000748 Ga0373924_0000748_6091_6966 291
116 3300042876 Ga0451577_0065992 Ga0451577_0065992_1032_1907 291
117 3300044712 Ga0453684_0036941 Ga0453684_0036941_4371_5246 291
118 3300045051 Ga0451576_0185197 Ga0451576_0185197_493_1368 291
119 3300046513 Ga0495616_0137327 Ga0495616_0137327_222_1106 291
120 3300049518 Ga0501295_003521 Ga0501295_003521_313_1188 291
121 3300050491 nmdc:mga00v17_14722_c1 nmdc:mga00v17_14722_c1_1347_2249 291
122 3300005367 Ga0070667_100018956 Ga0070667_1000189566 292
123 3300005458 Ga0070681_10099831 Ga0070681_100998312 292
124 3300005617 Ga0068859_100108094 Ga0068859_1001080943 292
125 3300006931 Ga0097620_100108096 Ga0097620_1001080963 292
126 3300025986 Ga0207658_10356999 Ga0207658_103569991 292
127 3300027360 Ga0209969_1005305 Ga0209969_10053051 292
128 3300027364 Ga0209967_1001171 Ga0209967_10011711 292
129 3300027462 Ga0210000_1000390 Ga0210000_10003903 292
130 3300027543 Ga0209999_1003339 Ga0209999_10033392 292
131 3300027682 Ga0209971_1004564 Ga0209971_10045643 292
132 3300027876 Ga0209974_10002238 Ga0209974_100022382 292
133 3300042001 Ga0439441_001142 Ga0439441_001142_811_1695 292
134 3300048928 Ga0496125_0004893 Ga0496125_0004893_6310_7188 292
135 3300049569 Ga0501032_0010705 Ga0501032_0010705_4785_5663 292
136 3300049571 Ga0501034_0076671 Ga0501034_0076671_695_1573 292
137 3300049574 Ga0501038_0016387 Ga0501038_0016387_5416_6294 292
138 3300049575 Ga0501039_0013917 Ga0501039_0013917_2372_3250 292
139 3300049822 Ga0501035_0105994 Ga0501035_0105994_222_1100 292
140 3300005335 Ga0070666_10008975 Ga0070666_100089753 293
141 3300005336 Ga0070680_100056629 Ga0070680_1000566294 293
142 3300005338 Ga0068868_100021617 Ga0068868_1000216175 293
143 3300005338 Ga0068868_100034010 Ga0068868_1000340103 293
144 3300005338 Ga0068868_100244029 Ga0068868_1002440292 293
145 3300005340 Ga0070689_100063093 Ga0070689_1000630932 293
146 3300005347 Ga0070668_100003734 Ga0070668_1000037342 293
147 3300005353 Ga0070669_100070730 Ga0070669_1000707302 293
148 3300005354 Ga0070675_100010306 Ga0070675_1000103064 293
149 3300005356 Ga0070674_100055549 Ga0070674_1000555492 293
150 3300005364 Ga0070673_100008338 Ga0070673_1000083386 293
151 3300005364 Ga0070673_100008627 Ga0070673_1000086272 293
152 3300005366 Ga0070659_100131719 Ga0070659_1001317192 293
153 3300005367 Ga0070667_100060585 Ga0070667_1000605853 293
154 3300005367 Ga0070667_100078737 Ga0070667_1000787372 293
155 3300005406 Ga0070703_10031298 Ga0070703_100312982 293
156 3300005434 Ga0070709_10181128 Ga0070709_101811281 293
157 3300005436 Ga0070713_100000606 Ga0070713_10000060621 293
158 3300005437 Ga0070710_10018911 Ga0070710_100189113 293
159 3300005440 Ga0070705_100156937 Ga0070705_1001569372 293
160 3300005445 Ga0070708_100013449 Ga0070708_1000134498 293
161 3300005445 Ga0070708_100074023 Ga0070708_1000740233 293
162 3300005455 Ga0070663_100052457 Ga0070663_1000524572 293
163 3300005456 Ga0070678_100003883 Ga0070678_1000038835 293
164 3300005457 Ga0070662_100026496 Ga0070662_1000264962 293
165 3300005457 Ga0070662_100057168 Ga0070662_1000571682 293
166 3300005457 Ga0070662_100129055 Ga0070662_1001290552 293
167 3300005466 Ga0070685_10040072 Ga0070685_100400723 293
168 3300005467 Ga0070706_100010757 Ga0070706_1000107578 293
169 3300005467 Ga0070706_100010778 Ga0070706_1000107785 293
170 3300005468 Ga0070707_100049758 Ga0070707_1000497584 293
171 3300005468 Ga0070707_100061201 Ga0070707_1000612013 293
172 3300005471 Ga0070698_100049554 Ga0070698_1000495543 293
173 3300005471 Ga0070698_100109233 Ga0070698_1001092332 293
174 3300005518 Ga0070699_100030219 Ga0070699_1000302192 293
175 3300005518 Ga0070699_100040381 Ga0070699_1000403812 293
176 3300005535 Ga0070684_100056429 Ga0070684_1000564292 293
177 3300005536 Ga0070697_100261942 Ga0070697_1002619422 293
178 3300005543 Ga0070672_100003540 Ga0070672_1000035406 293
179 3300005544 Ga0070686_100063416 Ga0070686_1000634162 293
180 3300005547 Ga0070693_100005955 Ga0070693_1000059553 293
181 3300005548 Ga0070665_100032204 Ga0070665_1000322044 293
182 3300005549 Ga0070704_100034104 Ga0070704_1000341043 293
183 3300005564 Ga0070664_100316395 Ga0070664_1003163952 293
184 3300005578 Ga0068854_100051327 Ga0068854_1000513273 293
185 3300005614 Ga0068856_100567002 Ga0068856_1005670021 293
186 3300005615 Ga0070702_100012295 Ga0070702_1000122952 293
187 3300005617 Ga0068859_100003361 Ga0068859_10000336111 293
188 3300005618 Ga0068864_100001097 Ga0068864_1000010973 293
189 3300005719 Ga0068861_100046676 Ga0068861_1000466761 293
190 3300005841 Ga0068863_100003162 Ga0068863_10000316217 293
191 3300005841 Ga0068863_100053703 Ga0068863_1000537033 293
192 3300005843 Ga0068860_100141533 Ga0068860_1001415332 293
193 3300006028 Ga0070717_10159017 Ga0070717_101590172 293
194 3300006163 Ga0070715_10044702 Ga0070715_100447022 293
195 3300006173 Ga0070716_100008591 Ga0070716_1000085915 293
196 3300006173 Ga0070716_100147579 Ga0070716_1001475792 293
197 3300006175 Ga0070712_100013349 Ga0070712_1000133493 293
198 3300006175 Ga0070712_100073754 Ga0070712_1000737543 293
199 3300006237 Ga0097621_100084093 Ga0097621_1000840932 293
200 3300006358 Ga0068871_100170280 Ga0068871_1001702802 293
201 3300006852 Ga0075433_10005211 Ga0075433_100052119 293
202 3300006871 Ga0075434_100018414 Ga0075434_1000184145 293
203 3300006871 Ga0075434_100138553 Ga0075434_1001385533 293
204 3300006881 Ga0068865_100102797 Ga0068865_1001027971 293
205 3300006931 Ga0097620_100003360 Ga0097620_10000336011 293
206 3300009093 Ga0105240_10118721 Ga0105240_101187212 293
207 3300009098 Ga0105245_10004771 Ga0105245_100047715 293
208 3300009098 Ga0105245_10061355 Ga0105245_100613552 293
209 3300009098 Ga0105245_10091908 Ga0105245_100919083 293
210 3300009101 Ga0105247_10325563 Ga0105247_103255632 293
211 3300009147 Ga0114129_10627454 Ga0114129_106274542 293
212 3300009174 Ga0105241_10307166 Ga0105241_103071662 293
213 3300009176 Ga0105242_10395569 Ga0105242_103955692 293
214 3300009545 Ga0105237_10186671 Ga0105237_101866711 293
215 3300011119 Ga0105246_10031113 Ga0105246_100311134 293
216 3300011119 Ga0105246_10087977 Ga0105246_100879773 293
217 3300013104 Ga0157370_10028315 Ga0157370_100283155 293
218 3300013296 Ga0157374_10000720 Ga0157374_1000072025 293
219 3300013297 Ga0157378_10004135 Ga0157378_100041353 293
220 3300013306 Ga0163162_10055310 Ga0163162_100553102 293
221 3300013306 Ga0163162_10092185 Ga0163162_100921854 293
222 3300013308 Ga0157375_10010931 Ga0157375_100109312 293
223 3300013308 Ga0157375_10046469 Ga0157375_100464695 293
224 3300014325 Ga0163163_10013776 Ga0163163_100137768 293
225 3300014326 Ga0157380_10046805 Ga0157380_100468054 293
226 3300014745 Ga0157377_10013266 Ga0157377_100132664 293
227 3300014968 Ga0157379_10021187 Ga0157379_100211876 293
228 3300014969 Ga0157376_10068460 Ga0157376_100684604 293
229 3300014969 Ga0157376_10320279 Ga0157376_103202792 293
230 3300017792 Ga0163161_10041147 Ga0163161_100411473 293
231 3300020082 Ga0206353_10486998 Ga0206353_104869982 293
232 3300025898 Ga0207692_10008605 Ga0207692_100086053 293
233 3300025898 Ga0207692_10045043 Ga0207692_100450432 293
234 3300025899 Ga0207642_10050958 Ga0207642_100509582 293
235 3300025903 Ga0207680_10002794 Ga0207680_100027948 293
236 3300025910 Ga0207684_10092365 Ga0207684_100923653 293
237 3300025911 Ga0207654_10129481 Ga0207654_101294812 293
238 3300025911 Ga0207654_10303432 Ga0207654_103034321 293
239 3300025914 Ga0207671_10180276 Ga0207671_101802761 293
240 3300025915 Ga0207693_10011584 Ga0207693_100115844 293
241 3300025915 Ga0207693_10015406 Ga0207693_100154066 293
242 3300025915 Ga0207693_10221888 Ga0207693_102218881 293
243 3300025919 Ga0207657_10003754 Ga0207657_1000375417 293
244 3300025920 Ga0207649_10085182 Ga0207649_100851822 293
245 3300025922 Ga0207646_10004149 Ga0207646_100041495 293
246 3300025922 Ga0207646_10069153 Ga0207646_100691533 293
247 3300025925 Ga0207650_10013214 Ga0207650_100132144 293
248 3300025926 Ga0207659_10102955 Ga0207659_101029551 293
249 3300025927 Ga0207687_10000317 Ga0207687_100003176 293
250 3300025927 Ga0207687_10065574 Ga0207687_100655742 293
251 3300025928 Ga0207700_10000045 Ga0207700_1000004522 293
252 3300025929 Ga0207664_10009841 Ga0207664_100098412 293
253 3300025931 Ga0207644_10057709 Ga0207644_100577092 293
254 3300025933 Ga0207706_10003686 Ga0207706_100036865 293
255 3300025933 Ga0207706_10007830 Ga0207706_100078302 293
256 3300025934 Ga0207686_10107057 Ga0207686_101070572 293
257 3300025936 Ga0207670_10046494 Ga0207670_100464943 293
258 3300025938 Ga0207704_10021641 Ga0207704_100216412 293
259 3300025939 Ga0207665_10022079 Ga0207665_100220793 293
260 3300025939 Ga0207665_10070385 Ga0207665_100703853 293
261 3300025940 Ga0207691_10001760 Ga0207691_100017606 293
262 3300025940 Ga0207691_10068280 Ga0207691_100682802 293
263 3300025941 Ga0207711_10000115 Ga0207711_1000011519 293
264 3300025942 Ga0207689_10085962 Ga0207689_100859623 293
265 3300025945 Ga0207679_10555816 Ga0207679_105558161 293
266 3300025949 Ga0207667_10073737 Ga0207667_100737374 293
267 3300025960 Ga0207651_10021228 Ga0207651_100212281 293
268 3300025960 Ga0207651_10084579 Ga0207651_100845793 293
269 3300025981 Ga0207640_10004249 Ga0207640_100042493 293
270 3300025986 Ga0207658_10005849 Ga0207658_100058499 293
271 3300025986 Ga0207658_10089993 Ga0207658_100899932 293
272 3300025986 Ga0207658_10104660 Ga0207658_101046603 293
273 3300026023 Ga0207677_10000395 Ga0207677_1000039517 293
274 3300026023 Ga0207677_10087400 Ga0207677_100874003 293
275 3300026023 Ga0207677_10094308 Ga0207677_100943082 293
276 3300026035 Ga0207703_10012230 Ga0207703_100122301 293
277 3300026078 Ga0207702_10021255 Ga0207702_100212553 293
278 3300026088 Ga0207641_10006084 Ga0207641_100060849 293
279 3300026088 Ga0207641_10044920 Ga0207641_100449204 293
280 3300026089 Ga0207648_10041222 Ga0207648_100412224 293
281 3300026095 Ga0207676_10001026 Ga0207676_1000102613 293
282 3300026116 Ga0207674_10010118 Ga0207674_100101189 293
283 3300026118 Ga0207675_100025786 Ga0207675_1000257866 293
284 3300026118 Ga0207675_100309682 Ga0207675_1003096822 293
285 3300026121 Ga0207683_10001225 Ga0207683_1000122522 293
286 3300026142 Ga0207698_10477969 Ga0207698_104779691 293
287 3300028379 Ga0268266_10005648 Ga0268266_1000564810 293
288 3300028379 Ga0268266_10544288 Ga0268266_105442882 293
289 3300028381 Ga0268264_10004260 Ga0268264_100042604 293
290 3300028381 Ga0268264_10174869 Ga0268264_101748692 293
291 3300035083 Ga0373926_0032886 Ga0373926_0032886_731_1612 293
292 3300035111 Ga0373923_0007418 Ga0373923_0007418_2278_3159 293
293 3300035118 Ga0373954_0012955 Ga0373954_0012955_1245_2126 293
294 3300035172 Ga0373955_0028201 Ga0373955_0028201_937_1818 293
295 3300035172 Ga0373955_0061871 Ga0373955_0061871_818_1699 293
296 3300035410 Ga0373924_0017273 Ga0373924_0017273_58_939 293
297 3300035695 Ga0373927_0070101 Ga0373927_0070101_492_1373 293
298 3300035724 Ga0373933_0046053 Ga0373933_0046053_278_1159 293
299 3300035724 Ga0373933_0228326 Ga0373933_0228326_173_1054 293
300 3300036401 Ga0373937_0310981 Ga0373937_0310981_132_1019 293
301 3300037068 Ga0373925_0017257 Ga0373925_0017257_2733_3614 293
302 3300037068 Ga0373925_0027475 Ga0373925_0027475_617_1504 293
303 3300042005 Ga0439448_0040343 Ga0439448_0040343_612_1493 293
304 3300046472 Ga0495580_0007298 Ga0495580_0007298_5853_6755 293
305 3300046473 Ga0495582_0021865 Ga0495582_0021865_1043_1924 293
306 3300046475 Ga0495639_0057288 Ga0495639_0057288_349_1230 293
307 3300046477 Ga0495664_0019930 Ga0495664_0019930_1674_2564 293
308 3300046511 Ga0495608_0264253 Ga0495608_0264253_107_988 293
309 3300046516 Ga0495628_0192156 Ga0495628_0192156_423_1313 293
310 3300046531 Ga0495665_0012100 Ga0495665_0012100_2759_3640 293
311 3300046533 Ga0495640_0168999 Ga0495640_0168999_268_1149 293
312 3300046539 Ga0495621_0002301 Ga0495621_0002301_1879_2760 293
313 3300046663 Ga0495635_0002903 Ga0495635_0002903_5926_6807 293
314 3300046675 Ga0495657_0129632 Ga0495657_0129632_91_972 293
315 3300046681 Ga0495647_0005522 Ga0495647_0005522_717_1598 293
316 3300046683 Ga0495658_0066125 Ga0495658_0066125_220_1101 293
317 3300046689 Ga0495613_0078176 Ga0495613_0078176_1232_2113 293
318 3300046809 Ga0495600_0139991 Ga0495600_0139991_362_1243 293
319 3300047315 Ga0495581_0000877 Ga0495581_0000877_10795_11676 293
320 3300047322 Ga0495680_0178056 Ga0495680_0178056_255_1136 293
321 3300047444 Ga0495675_0095241 Ga0495675_0095241_664_1545 293
322 3300048089 Ga0495614_0029641 Ga0495614_0029641_864_1745 293
323 3300048903 Ga0496100_0101355 Ga0496100_0101355_1047_1928 293
324 3300048904 Ga0496101_0046735 Ga0496101_0046735_460_1341 293
325 3300048907 Ga0496104_0020039 Ga0496104_0020039_1764_2645 293
326 3300048909 Ga0496106_0026769 Ga0496106_0026769_147_1028 293
327 3300048911 Ga0496108_0194232 Ga0496108_0194232_622_1503 293
328 3300048912 Ga0496109_0087837 Ga0496109_0087837_1596_2477 293
329 3300048915 Ga0496112_0019696 Ga0496112_0019696_1815_2696 293
330 3300048918 Ga0496115_0140125 Ga0496115_0140125_510_1391 293
331 3300050514 nmdc:mga08x19_35613_c1 nmdc:mga08x19_35613_c1_449_1336 293
332 3300050514 nmdc:mga08x19_84874_c1 nmdc:mga08x19_84874_c1_470_1351 293
333 3300050515 nmdc:mga0a205_7849_c2 nmdc:mga0a205_7849_c2_3509_4396 293
334 3300053085 Ga0495619_0009678 Ga0495619_0009678_4376_5257 293
335 3300005328 Ga0070676_10000122 Ga0070676_100001226 294
336 3300005331 Ga0070670_100052303 Ga0070670_1000523032 294
337 3300005333 Ga0070677_10000198 Ga0070677_1000019811 294
338 3300005335 Ga0070666_10002386 Ga0070666_100023869 294
339 3300005335 Ga0070666_10111721 Ga0070666_101117212 294
340 3300005338 Ga0068868_100001830 Ga0068868_1000018309 294
341 3300005347 Ga0070668_100003210 Ga0070668_1000032109 294
342 3300005347 Ga0070668_100015694 Ga0070668_1000156942 294
343 3300005354 Ga0070675_100000526 Ga0070675_10000052616 294
344 3300005355 Ga0070671_100013069 Ga0070671_1000130695 294
345 3300005364 Ga0070673_100003819 Ga0070673_1000038194 294
346 3300005367 Ga0070667_100000942 Ga0070667_10000094219 294
347 3300005434 Ga0070709_10329318 Ga0070709_103293181 294
348 3300005455 Ga0070663_100026977 Ga0070663_1000269772 294
349 3300005456 Ga0070678_100000351 Ga0070678_1000003514 294
350 3300005457 Ga0070662_100155600 Ga0070662_1001556002 294
351 3300005457 Ga0070662_100381032 Ga0070662_1003810321 294
352 3300005458 Ga0070681_10006101 Ga0070681_100061016 294
353 3300005459 Ga0068867_100004136 Ga0068867_1000041367 294
354 3300005530 Ga0070679_100049641 Ga0070679_1000496412 294
355 3300005539 Ga0068853_100012806 Ga0068853_1000128066 294
356 3300005539 Ga0068853_100049413 Ga0068853_1000494132 294
357 3300005543 Ga0070672_100000518 Ga0070672_10000051815 294
358 3300005548 Ga0070665_100004668 Ga0070665_10000466811 294
359 3300005618 Ga0068864_100049791 Ga0068864_1000497912 294
360 3300005719 Ga0068861_100135983 Ga0068861_1001359832 294
361 3300005834 Ga0068851_10000630 Ga0068851_1000063010 294
362 3300005840 Ga0068870_10024046 Ga0068870_100240462 294
363 3300005841 Ga0068863_100021594 Ga0068863_1000215946 294
364 3300005842 Ga0068858_100004484 Ga0068858_10000448413 294
365 3300005843 Ga0068860_100008422 Ga0068860_1000084229 294
366 3300006237 Ga0097621_100021844 Ga0097621_1000218444 294
367 3300006358 Ga0068871_100005276 Ga0068871_1000052769 294
368 3300006881 Ga0068865_100050783 Ga0068865_1000507833 294
369 3300013104 Ga0157370_10265757 Ga0157370_102657571 294
370 3300013296 Ga0157374_10024529 Ga0157374_100245295 294
371 3300013297 Ga0157378_10008005 Ga0157378_100080057 294
372 3300013306 Ga0163162_10060334 Ga0163162_100603342 294
373 3300013307 Ga0157372_10009553 Ga0157372_100095535 294
374 3300013308 Ga0157375_10014430 Ga0157375_100144304 294
375 3300014325 Ga0163163_10015054 Ga0163163_100150544 294
376 3300014968 Ga0157379_10002330 Ga0157379_1000233010 294
377 3300014969 Ga0157376_10220029 Ga0157376_102200292 294
378 3300017792 Ga0163161_10120829 Ga0163161_101208292 294
379 3300025321 Ga0207656_10001098 Ga0207656_100010984 294
380 3300025893 Ga0207682_10000078 Ga0207682_1000007819 294
381 3300025903 Ga0207680_10011741 Ga0207680_100117414 294
382 3300025907 Ga0207645_10000139 Ga0207645_1000013937 294
383 3300025916 Ga0207663_10266408 Ga0207663_102664081 294
384 3300025921 Ga0207652_10043799 Ga0207652_100437993 294
385 3300025925 Ga0207650_10057043 Ga0207650_100570433 294
386 3300025926 Ga0207659_10023410 Ga0207659_100234103 294
387 3300025931 Ga0207644_10015521 Ga0207644_100155211 294
388 3300025933 Ga0207706_10075986 Ga0207706_100759862 294
389 3300025937 Ga0207669_10004151 Ga0207669_100041515 294
390 3300025938 Ga0207704_10024013 Ga0207704_100240134 294
391 3300025940 Ga0207691_10000040 Ga0207691_1000004033 294
392 3300025941 Ga0207711_10123889 Ga0207711_101238891 294
393 3300025960 Ga0207651_10007535 Ga0207651_100075356 294
394 3300025972 Ga0207668_10016655 Ga0207668_100166553 294
395 3300025972 Ga0207668_10023002 Ga0207668_100230022 294
396 3300025986 Ga0207658_10012579 Ga0207658_100125793 294
397 3300025986 Ga0207658_10018810 Ga0207658_100188106 294
398 3300026023 Ga0207677_10007177 Ga0207677_100071774 294
399 3300026035 Ga0207703_10034169 Ga0207703_100341692 294
400 3300026041 Ga0207639_10017622 Ga0207639_100176224 294
401 3300026067 Ga0207678_10031953 Ga0207678_100319536 294
402 3300026088 Ga0207641_10005149 Ga0207641_100051499 294
403 3300026089 Ga0207648_10005981 Ga0207648_100059817 294
404 3300026095 Ga0207676_10074551 Ga0207676_100745512 294
405 3300026118 Ga0207675_100020246 Ga0207675_1000202466 294
406 3300026121 Ga0207683_10000059 Ga0207683_1000005938 294
407 3300028379 Ga0268266_10020068 Ga0268266_100200685 294
408 3300028379 Ga0268266_10244913 Ga0268266_102449132 294
409 3300028381 Ga0268264_10020915 Ga0268264_100209154 294
410 3300035691 Ga0373931_0005073 Ga0373931_0005073_706_1590 294
411 3300046460 Ga0495638_0045596 Ga0495638_0045596_1268_2152 294
412 3300046460 Ga0495638_0057570 Ga0495638_0057570_652_1536 294
413 3300046492 Ga0495585_0000183 Ga0495585_0000183_45783_46679 294
414 3300046492 Ga0495585_0010876 Ga0495585_0010876_1838_2722 294
415 3300046507 Ga0495606_0006253 Ga0495606_0006253_776_1660 294
416 3300046528 Ga0495642_0004167 Ga0495642_0004167_717_1601 294
417 3300046528 Ga0495642_0021154 Ga0495642_0021154_711_1595 294
418 3300046543 Ga0495645_0071531 Ga0495645_0071531_118_1017 294
419 3300046665 Ga0495661_0064947 Ga0495661_0064947_846_1730 294
420 3300046679 Ga0495623_0137887 Ga0495623_0137887_541_1425 294
421 3300047317 Ga0495604_0029175 Ga0495604_0029175_1465_2349 294
422 3300048090 Ga0495615_0006487 Ga0495615_0006487_908_1792 294
423 3300048918 Ga0496115_0006889 Ga0496115_0006889_1665_2549 294
424 3300050492 nmdc:mga0yw44_46271_c1 nmdc:mga0yw44_46271_c1_1468_2364 297
425 3300005543 Ga0070672_100026550 Ga0070672_1000265506 299
426 3300005459 Ga0068867_100007487 Ga0068867_1000074877 300
427 3300005518 Ga0070699_100186248 Ga0070699_1001862482 300
428 3300005544 Ga0070686_100000567 Ga0070686_10000056722 300
429 3300005617 Ga0068859_100311319 Ga0068859_1003113192 300
430 3300005840 Ga0068870_10027081 Ga0068870_100270812 300
431 3300005842 Ga0068858_100008247 Ga0068858_1000082472 300
432 3300006844 Ga0075428_100002681 Ga0075428_10000268110 300
433 3300006846 Ga0075430_100044747 Ga0075430_1000447473 300
434 3300006880 Ga0075429_100055891 Ga0075429_1000558914 300
435 3300006881 Ga0068865_100001499 Ga0068865_1000014993 300
436 3300006931 Ga0097620_100311320 Ga0097620_1003113202 300
437 3300007076 Ga0075435_100154580 Ga0075435_1001545802 300
438 3300009093 Ga0105240_10109143 Ga0105240_101091433 300
439 3300009098 Ga0105245_10000577 Ga0105245_1000057726 300
440 3300009148 Ga0105243_10001035 Ga0105243_100010356 300
441 3300013297 Ga0157378_10003500 Ga0157378_100035009 300
442 3300014325 Ga0163163_10002600 Ga0163163_1000260013 300
443 3300025908 Ga0207643_10003122 Ga0207643_100031227 300
444 3300025913 Ga0207695_10117276 Ga0207695_101172763 300
445 3300025949 Ga0207667_10046434 Ga0207667_100464343 300
446 3300026035 Ga0207703_10001683 Ga0207703_100016832 300
447 3300026078 Ga0207702_10044739 Ga0207702_100447391 300
448 3300026088 Ga0207641_10067943 Ga0207641_100679433 300
449 3300027907 Ga0207428_10002668 Ga0207428_1000266814 300
450 3300035692 Ga0373935_0084733 Ga0373935_0084733_381_1289 300
451 3300035724 Ga0373933_0268493 Ga0373933_0268493_31_939 300
452 3300049570 Ga0501033_0066257 Ga0501033_0066257_909_1823 300
453 3300049571 Ga0501034_0153436 Ga0501034_0153436_1268_2173 300
454 3300049575 Ga0501039_0000901 Ga0501039_0000901_12577_13491 300
455 3300049576 Ga0501040_0089042 Ga0501040_0089042_1019_1933 300
456 3300049577 Ga0501041_0007189 Ga0501041_0007189_1795_2709 300
457 3300049578 Ga0501042_0008620 Ga0501042_0008620_5656_6570 300
458 3300049580 Ga0501046_0151018 Ga0501046_0151018_753_1667 300
459 3300049582 Ga0501048_0094128 Ga0501048_0094128_1042_1956 300
460 3300049587 Ga0501071_0022730 Ga0501071_0022730_368_1282 300
461 3300049591 Ga0501075_0019282 Ga0501075_0019282_440_1354 300
462 3300049592 Ga0501076_0000468 Ga0501076_0000468_9661_10575 300
463 3300049741 Ga0501079_0014141 Ga0501079_0014141_4450_5364 300
464 3300049742 Ga0501080_0010515 Ga0501080_0010515_6340_7254 300
465 3300049743 Ga0501081_0000619 Ga0501081_0000619_12897_13811 300
466 3300049824 Ga0501045_0042010 Ga0501045_0042010_2089_3003 300
467 3300050509 nmdc:mga0qj67_63803_c1 nmdc:mga0qj67_63803_c1_95_1009 300
468 3300050511 nmdc:mga08y16_309869_c1 nmdc:mga08y16_309869_c1_254_1168 300
469 3300053098 Ga0500650_0063687 Ga0500650_0063687_609_1514 300
470 3300054114 Ga0501084_0028010 Ga0501084_0028010_3241_4155 300
471 3300060353 Ga0501082_0002263 Ga0501082_0002263_10936_11850 300
472 3300005335 Ga0070666_10078321 Ga0070666_100783213 301
473 3300005456 Ga0070678_100005593 Ga0070678_1000055937 301
474 3300005548 Ga0070665_100016453 Ga0070665_1000164535 301
475 3300005843 Ga0068860_100063817 Ga0068860_1000638172 301
476 3300014969 Ga0157376_10010402 Ga0157376_100104025 301
477 3300025903 Ga0207680_10008989 Ga0207680_100089892 301
478 3300026121 Ga0207683_10001439 Ga0207683_1000143918 301
479 3300005327 Ga0070658_10035996 Ga0070658_100359962 302
480 3300005328 Ga0070676_10042311 Ga0070676_100423113 302
481 3300005328 Ga0070676_10138217 Ga0070676_101382172 302
482 3300005329 Ga0070683_100006372 Ga0070683_1000063728 302
483 3300005329 Ga0070683_100031130 Ga0070683_1000311306 302
484 3300005329 Ga0070683_100067797 Ga0070683_1000677972 302
485 3300005330 Ga0070690_100010115 Ga0070690_1000101157 302
486 3300005331 Ga0070670_100103301 Ga0070670_1001033012 302
487 3300005331 Ga0070670_100201903 Ga0070670_1002019031 302
488 3300005333 Ga0070677_10014858 Ga0070677_100148582 302
489 3300005334 Ga0068869_100032922 Ga0068869_1000329224 302
490 3300005334 Ga0068869_100140270 Ga0068869_1001402702 302
491 3300005335 Ga0070666_10072266 Ga0070666_100722663 302
492 3300005338 Ga0068868_100135471 Ga0068868_1001354712 302
493 3300005339 Ga0070660_100039103 Ga0070660_1000391032 302
494 3300005340 Ga0070689_100028222 Ga0070689_1000282226 302
495 3300005343 Ga0070687_100043468 Ga0070687_1000434682 302
496 3300005344 Ga0070661_100005534 Ga0070661_1000055344 302
497 3300005344 Ga0070661_100066443 Ga0070661_1000664432 302
498 3300005344 Ga0070661_100123918 Ga0070661_1001239182 302
499 3300005345 Ga0070692_10016975 Ga0070692_100169752 302
500 3300005353 Ga0070669_100050083 Ga0070669_1000500832 302
501 3300005354 Ga0070675_100048168 Ga0070675_1000481683 302
502 3300005354 Ga0070675_100246507 Ga0070675_1002465072 302
503 3300005355 Ga0070671_100032665 Ga0070671_1000326654 302
504 3300005355 Ga0070671_100113830 Ga0070671_1001138302 302
505 3300005365 Ga0070688_100024345 Ga0070688_1000243452 302
506 3300005366 Ga0070659_100012612 Ga0070659_1000126123 302
507 3300005434 Ga0070709_10060769 Ga0070709_100607692 302
508 3300005437 Ga0070710_10158256 Ga0070710_101582562 302
509 3300005438 Ga0070701_10091983 Ga0070701_100919832 302
510 3300005441 Ga0070700_100025478 Ga0070700_1000254782 302
511 3300005455 Ga0070663_100073688 Ga0070663_1000736883 302
512 3300005458 Ga0070681_10144404 Ga0070681_101444041 302
513 3300005466 Ga0070685_10041500 Ga0070685_100415003 302
514 3300005518 Ga0070699_100079095 Ga0070699_1000790953 302
515 3300005530 Ga0070679_100063137 Ga0070679_1000631374 302
516 3300005530 Ga0070679_100090121 Ga0070679_1000901211 302
517 3300005530 Ga0070679_100116914 Ga0070679_1001169143 302
518 3300005535 Ga0070684_100005461 Ga0070684_1000054612 302
519 3300005535 Ga0070684_100022585 Ga0070684_1000225852 302
520 3300005539 Ga0068853_100019887 Ga0068853_1000198873 302
521 3300005539 Ga0068853_100138755 Ga0068853_1001387552 302
522 3300005548 Ga0070665_100126390 Ga0070665_1001263902 302
523 3300005548 Ga0070665_100229541 Ga0070665_1002295412 302
524 3300005563 Ga0068855_100092597 Ga0068855_1000925971 302
525 3300005564 Ga0070664_100043363 Ga0070664_1000433633 302
526 3300005564 Ga0070664_100055612 Ga0070664_1000556123 302
527 3300005564 Ga0070664_100063023 Ga0070664_1000630233 302
528 3300005577 Ga0068857_100127113 Ga0068857_1001271132 302
529 3300005578 Ga0068854_100021151 Ga0068854_1000211514 302
530 3300005578 Ga0068854_100033312 Ga0068854_1000333122 302
531 3300005614 Ga0068856_100005096 Ga0068856_10000509612 302
532 3300005614 Ga0068856_100156590 Ga0068856_1001565902 302
533 3300005615 Ga0070702_100001177 Ga0070702_10000117711 302
534 3300005616 Ga0068852_100008165 Ga0068852_1000081657 302
535 3300005616 Ga0068852_100515901 Ga0068852_1005159011 302
536 3300005617 Ga0068859_100099642 Ga0068859_1000996423 302
537 3300005618 Ga0068864_100093271 Ga0068864_1000932712 302
538 3300005718 Ga0068866_10018639 Ga0068866_100186393 302
539 3300005719 Ga0068861_100014407 Ga0068861_1000144072 302
540 3300005834 Ga0068851_10008701 Ga0068851_100087015 302
541 3300005834 Ga0068851_10019037 Ga0068851_100190372 302
542 3300005840 Ga0068870_10074719 Ga0068870_100747192 302
543 3300005843 Ga0068860_100214407 Ga0068860_1002144072 302
544 3300005844 Ga0068862_100031244 Ga0068862_1000312442 302
545 3300006173 Ga0070716_100324360 Ga0070716_1003243601 302
546 3300006237 Ga0097621_100147409 Ga0097621_1001474092 302
547 3300006881 Ga0068865_100110970 Ga0068865_1001109702 302
548 3300006914 Ga0075436_100087423 Ga0075436_1000874233 302
549 3300006914 Ga0075436_100156812 Ga0075436_1001568122 302
550 3300006931 Ga0097620_100099631 Ga0097620_1000996313 302
551 3300009093 Ga0105240_10009886 Ga0105240_1000988610 302
552 3300009093 Ga0105240_10013824 Ga0105240_1001382411 302
553 3300009094 Ga0111539_10012858 Ga0111539_100128586 302
554 3300009098 Ga0105245_10085625 Ga0105245_100856251 302
555 3300009148 Ga0105243_10208908 Ga0105243_102089082 302
556 3300009174 Ga0105241_10007912 Ga0105241_100079123 302
557 3300009174 Ga0105241_10478785 Ga0105241_104787851 302
558 3300009176 Ga0105242_10212304 Ga0105242_102123042 302
559 3300009177 Ga0105248_10011849 Ga0105248_100118499 302
560 3300009545 Ga0105237_10047979 Ga0105237_100479793 302
561 3300009545 Ga0105237_10095930 Ga0105237_100959302 302
562 3300009545 Ga0105237_10425134 Ga0105237_104251341 302
563 3300009551 Ga0105238_10046317 Ga0105238_100463174 302
564 3300009553 Ga0105249_10018015 Ga0105249_100180156 302
565 3300010375 Ga0105239_10021034 Ga0105239_100210347 302
566 3300013102 Ga0157371_10058932 Ga0157371_100589322 302
567 3300013102 Ga0157371_10164120 Ga0157371_101641202 302
568 3300013104 Ga0157370_10023604 Ga0157370_100236042 302
569 3300013104 Ga0157370_10232186 Ga0157370_102321862 302
570 3300013105 Ga0157369_10144654 Ga0157369_101446542 302
571 3300013296 Ga0157374_10062777 Ga0157374_100627772 302
572 3300013296 Ga0157374_10126570 Ga0157374_101265702 302
573 3300013307 Ga0157372_10047798 Ga0157372_100477982 302
574 3300013307 Ga0157372_10050509 Ga0157372_100505093 302
575 3300013307 Ga0157372_10190453 Ga0157372_101904532 302
576 3300013307 Ga0157372_10224984 Ga0157372_102249841 302
577 3300013307 Ga0157372_10468728 Ga0157372_104687282 302
578 3300013308 Ga0157375_10007014 Ga0157375_100070146 302
579 3300014325 Ga0163163_10230113 Ga0163163_102301132 302
580 3300014326 Ga0157380_10056834 Ga0157380_100568343 302
581 3300014968 Ga0157379_10014911 Ga0157379_100149116 302
582 3300014969 Ga0157376_10015366 Ga0157376_100153662 302
583 3300020070 Ga0206356_10058451 Ga0206356_100584512 302
584 3300025271 Ga0207666_1001100 Ga0207666_10011004 302
585 3300025290 Ga0207673_1000515 Ga0207673_10005152 302
586 3300025315 Ga0207697_10000008 Ga0207697_1000000828 302
587 3300025321 Ga0207656_10007827 Ga0207656_100078273 302
588 3300025893 Ga0207682_10000117 Ga0207682_1000011732 302
589 3300025898 Ga0207692_10080625 Ga0207692_100806252 302
590 3300025899 Ga0207642_10024182 Ga0207642_100241822 302
591 3300025901 Ga0207688_10002921 Ga0207688_100029216 302
592 3300025907 Ga0207645_10002794 Ga0207645_100027947 302
593 3300025908 Ga0207643_10000089 Ga0207643_1000008910 302
594 3300025909 Ga0207705_10026936 Ga0207705_100269363 302
595 3300025912 Ga0207707_10005597 Ga0207707_100055979 302
596 3300025912 Ga0207707_10009551 Ga0207707_100095516 302
597 3300025913 Ga0207695_10029445 Ga0207695_100294456 302
598 3300025913 Ga0207695_10031252 Ga0207695_100312523 302
599 3300025914 Ga0207671_10056495 Ga0207671_100564952 302
600 3300025914 Ga0207671_10449201 Ga0207671_104492011 302
601 3300025915 Ga0207693_10127184 Ga0207693_101271842 302
602 3300025918 Ga0207662_10007173 Ga0207662_100071732 302
603 3300025919 Ga0207657_10000240 Ga0207657_1000024010 302
604 3300025919 Ga0207657_10039050 Ga0207657_100390504 302
605 3300025920 Ga0207649_10010697 Ga0207649_100106975 302
606 3300025920 Ga0207649_10010878 Ga0207649_100108783 302
607 3300025921 Ga0207652_10007096 Ga0207652_100070967 302
608 3300025921 Ga0207652_10009720 Ga0207652_100097202 302
609 3300025923 Ga0207681_10041160 Ga0207681_100411603 302
610 3300025924 Ga0207694_10022444 Ga0207694_100224446 302
611 3300025925 Ga0207650_10015761 Ga0207650_100157614 302
612 3300025926 Ga0207659_10005051 Ga0207659_100050516 302
613 3300025926 Ga0207659_10047517 Ga0207659_100475172 302
614 3300025929 Ga0207664_10009563 Ga0207664_100095632 302
615 3300025931 Ga0207644_10009740 Ga0207644_100097404 302
616 3300025931 Ga0207644_10024382 Ga0207644_100243824 302
617 3300025932 Ga0207690_10109872 Ga0207690_101098722 302
618 3300025933 Ga0207706_10000456 Ga0207706_1000045641 302
619 3300025934 Ga0207686_10110601 Ga0207686_101106012 302
620 3300025936 Ga0207670_10130384 Ga0207670_101303842 302
621 3300025939 Ga0207665_10029662 Ga0207665_100296624 302
622 3300025941 Ga0207711_10004590 Ga0207711_100045906 302
623 3300025942 Ga0207689_10001313 Ga0207689_100013138 302
624 3300025944 Ga0207661_10035054 Ga0207661_100350543 302
625 3300025944 Ga0207661_10119628 Ga0207661_101196282 302
626 3300025944 Ga0207661_10291948 Ga0207661_102919482 302
627 3300025945 Ga0207679_10030342 Ga0207679_100303423 302
628 3300025945 Ga0207679_10066160 Ga0207679_100661603 302
629 3300025945 Ga0207679_10066682 Ga0207679_100666822 302
630 3300025949 Ga0207667_10007251 Ga0207667_100072515 302
631 3300025949 Ga0207667_10085333 Ga0207667_100853334 302
632 3300025949 Ga0207667_10129035 Ga0207667_101290353 302
633 3300025960 Ga0207651_10061490 Ga0207651_100614902 302
634 3300025960 Ga0207651_10096875 Ga0207651_100968752 302
635 3300025981 Ga0207640_10052028 Ga0207640_100520283 302
636 3300025981 Ga0207640_10058583 Ga0207640_100585833 302
637 3300025986 Ga0207658_10075987 Ga0207658_100759872 302
638 3300026023 Ga0207677_10063315 Ga0207677_100633153 302
639 3300026035 Ga0207703_10104793 Ga0207703_101047932 302
640 3300026041 Ga0207639_10056721 Ga0207639_100567213 302
641 3300026067 Ga0207678_10002147 Ga0207678_100021473 302
642 3300026067 Ga0207678_10011219 Ga0207678_100112196 302
643 3300026067 Ga0207678_10198229 Ga0207678_101982292 302
644 3300026075 Ga0207708_10007905 Ga0207708_100079057 302
645 3300026078 Ga0207702_10046379 Ga0207702_100463794 302
646 3300026078 Ga0207702_10148459 Ga0207702_101484592 302
647 3300026088 Ga0207641_10356311 Ga0207641_103563111 302
648 3300026089 Ga0207648_10001517 Ga0207648_1000151717 302
649 3300026095 Ga0207676_10065012 Ga0207676_100650123 302
650 3300026116 Ga0207674_10000974 Ga0207674_1000097427 302
651 3300026116 Ga0207674_10002009 Ga0207674_1000200913 302
652 3300026121 Ga0207683_10005472 Ga0207683_100054725 302
653 3300026142 Ga0207698_10015380 Ga0207698_100153804 302
654 3300026142 Ga0207698_10024627 Ga0207698_100246274 302
655 3300027462 Ga0210000_1004354 Ga0210000_10043542 302
656 3300027552 Ga0209982_1006994 Ga0209982_10069942 302
657 3300027617 Ga0210002_1017817 Ga0210002_10178171 302
658 3300027717 Ga0209998_10002472 Ga0209998_100024722 302
659 3300027876 Ga0209974_10001154 Ga0209974_100011548 302
660 3300028379 Ga0268266_10136609 Ga0268266_101366092 302
661 3300035118 Ga0373954_0188308 Ga0373954_0188308_44_952 302
662 3300035120 Ga0373957_0007641 Ga0373957_0007641_204_1112 302
663 3300035695 Ga0373927_0141833 Ga0373927_0141833_31_939 302
664 3300035725 Ga0373947_0047985 Ga0373947_0047985_359_1267 302
665 3300041512 Ga0451853_1015325 Ga0451853_1015325_539_1450 302
666 3300045976 Ga0466967_0196621 Ga0466967_0196621_365_1273 302
667 3300046455 Ga0495603_0239913 Ga0495603_0239913_46_954 302
668 3300046459 Ga0495629_0140560 Ga0495629_0140560_415_1323 302
669 3300046537 Ga0495598_0008674 Ga0495598_0008674_53_961 302
670 3300048905 Ga0496102_0289759 Ga0496102_0289759_490_1464 302
671 3300048906 Ga0496103_0105954 Ga0496103_0105954_94_1002 302
672 3300048907 Ga0496104_0241354 Ga0496104_0241354_568_1476 302
673 3300048908 Ga0496105_0003430 Ga0496105_0003430_10075_10983 302
674 3300048909 Ga0496106_0031246 Ga0496106_0031246_1994_2902 302
675 3300048910 Ga0496107_0062535 Ga0496107_0062535_282_1190 302
676 3300048912 Ga0496109_0013547 Ga0496109_0013547_5546_6454 302
677 3300048912 Ga0496109_0055446 Ga0496109_0055446_1227_2201 302
678 3300048913 Ga0496110_0015445 Ga0496110_0015445_245_1153 302
679 3300048918 Ga0496115_0174452 Ga0496115_0174452_669_1577 302
680 3300050514 nmdc:mga08x19_76133_c1 nmdc:mga08x19_76133_c1_1207_2115 302

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00701

DHDPS

Dihydrodipicolinate synthetase family

23

312

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mqh-assembly1.cif.gz_A crystal structure of 4-hydroxy-tetrahydrodipicolinate synthase (htpa synthase) from burkholderia mallei 0.981 1 293
6p90-assembly1.cif.gz_B crystal structure of padhdps2-h56q mutant 0.98 1 293
3qze-assembly2.cif.gz_D crystal structure of dapa (pa1010) at 1.6 a resolution 0.9788 3 293
3noe-assembly1.cif.gz_A crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa 0.9786 1 294
3pud-assembly1.cif.gz_A crystal structure of dhydrodipicolinate synthase from acinetobacter baumannii at 2.8a resolution 0.9785 1 293
ID Description Score Start End Superfamily
6nvaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9732 3 293 3.20.20.70
2rfgB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9716 1 289 3.20.20.70
3di0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9664 3 290 3.20.20.70
3a5fA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9657 3 293 3.20.20.70
2yxgD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9645 3 293 3.20.20.70
ID Description Score Start End GO Terms
AF-K2AWC9-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase 0.9853 183 290 GO:0005829
GO:0008840
AF-A0A7R6PD14-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9844 7 293 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A0A2T5K103-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.983 2 291 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A0A7V1PHF2-F1-model_v4 N-acetylneuraminate lyase (EC 4.1.3.3) 0.9829 1 107 GO:0005829
GO:0008747
GO:0008840
GO:0019262
AF-A0A521ZAB2-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9823 1 294 GO:0005829
GO:0008840
GO:0009089
GO:0019877

Feature Viewer

pLDDT pTM Quality
93.78 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map