F474771
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 680 | 312 | 680 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10011849|Ga0105248_100118499 |
| Length | 324 |
| Sequence | MLPQALDRGNRVESRFFEAPQFMVSGSLVAIVTPMQEGGALDLSALGRLIDFQIANGTAAIVIVGTTGESPTVSVEEHCELIQAAIDHAAGRVPVIAGTGGNSTAEAIELTRFAKRAGAAACLSVVPYYNKPTQEGMYRHFRTIAEGVDLPLLLYNVPSRTVADLANETVLRLAEIPGVVGMKDATSDLVRLVDLRNRLPAGREFALYSGNDDTALAFMLLGGNGVISVTANVAPRAVSQMCAAALDNDVVAARTLNARLSNLNARLFVEANPIPVKWALAEMGLIHNELRLPLTPLSPRFHDVVRAALRDAGCLAEPAMKVYS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 195 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 196 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 197 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 198 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 199 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 200 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 202 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 203 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 211 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 215 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 220 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 224 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 226 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 227 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 228 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 229 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 230 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 231 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 232 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 233 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 272 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 273 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 274 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 275 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 280 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 281 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 282 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 283 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 284 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 303 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 304 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 310 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 311 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.56 |
| Metatranscriptomes | 0.44 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.88 |
| Nodule | 0 |
| Rhizoplane | 3.53 |
| Rhizosphere | 95.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10035996 | 3300005327 | Bacteria | 3988 |
| 2 | Ga0070676_10000122 | 3300005328 | Bacteria | 28789 |
| 3 | Ga0070676_10042311 | 3300005328 | Bacteria | 2644 |
| 4 | Ga0070676_10138217 | 3300005328 | Bacteria | 1548 |
| 5 | Ga0070683_100006372 | 3300005329 | Bacteria | 9896 |
| 6 | Ga0070683_100031130 | 3300005329 | Bacteria | 4848 |
| 7 | Ga0070683_100067797 | 3300005329 | Bacteria | 3324 |
| 8 | Ga0070690_100004201 | 3300005330 | Bacteria | 7967 |
| 9 | Ga0070690_100010115 | 3300005330 | Bacteria | 5480 |
| 10 | Ga0070670_100052303 | 3300005331 | Bacteria | 3508 |
| 11 | Ga0070670_100103301 | 3300005331 | Bacteria | 2455 |
| 12 | Ga0070670_100201903 | 3300005331 | Bacteria | 1728 |
| 13 | Ga0070677_10000198 | 3300005333 | Bacteria | 20764 |
| 14 | Ga0070677_10014858 | 3300005333 | Bacteria | 2749 |
| 15 | Ga0068869_100032922 | 3300005334 | Bacteria | 3656 |
| 16 | Ga0068869_100047051 | 3300005334 | Bacteria | 3113 |
| 17 | Ga0068869_100140270 | 3300005334 | Bacteria | 1866 |
| 18 | Ga0070666_10002386 | 3300005335 | Bacteria | 11359 |
| 19 | Ga0070666_10008975 | 3300005335 | Bacteria | 6223 |
| 20 | Ga0070666_10072266 | 3300005335 | Bacteria | 2349 |
| 21 | Ga0070666_10078321 | 3300005335 | Bacteria | 2256 |
| 22 | Ga0070666_10111721 | 3300005335 | Bacteria | 1890 |
| 23 | Ga0070680_100056629 | 3300005336 | Bacteria | 3204 |
| 24 | Ga0068868_100001830 | 3300005338 | Bacteria | 14618 |
| 25 | Ga0068868_100021617 | 3300005338 | Bacteria | 4846 |
| 26 | Ga0068868_100034010 | 3300005338 | Bacteria | 3932 |
| 27 | Ga0068868_100135471 | 3300005338 | Bacteria | 2018 |
| 28 | Ga0068868_100244029 | 3300005338 | Bacteria | 1510 |
| 29 | Ga0070660_100003481 | 3300005339 | Bacteria | 10841 |
| 30 | Ga0070660_100036208 | 3300005339 | Bacteria | 3737 |
| 31 | Ga0070660_100039103 | 3300005339 | Bacteria | 3604 |
| 32 | Ga0070689_100028222 | 3300005340 | Bacteria | 4239 |
| 33 | Ga0070689_100063093 | 3300005340 | Bacteria | 2884 |
| 34 | Ga0070687_100043468 | 3300005343 | Bacteria | 2283 |
| 35 | Ga0070661_100005534 | 3300005344 | Bacteria | 8706 |
| 36 | Ga0070661_100066443 | 3300005344 | Bacteria | 2649 |
| 37 | Ga0070661_100123918 | 3300005344 | Bacteria | 1937 |
| 38 | Ga0070692_10016975 | 3300005345 | Bacteria | 3471 |
| 39 | Ga0070692_10157777 | 3300005345 | Bacteria | 1297 |
| 40 | Ga0070668_100001156 | 3300005347 | Bacteria | 18615 |
| 41 | Ga0070668_100003210 | 3300005347 | Bacteria | 12042 |
| 42 | Ga0070668_100003734 | 3300005347 | Bacteria | 11232 |
| 43 | Ga0070668_100015694 | 3300005347 | Bacteria | 5665 |
| 44 | Ga0070669_100050083 | 3300005353 | Bacteria | 3050 |
| 45 | Ga0070669_100053770 | 3300005353 | Bacteria | 2948 |
| 46 | Ga0070669_100070730 | 3300005353 | Bacteria | 2580 |
| 47 | Ga0070669_100118560 | 3300005353 | Bacteria | 2016 |
| 48 | Ga0070675_100000526 | 3300005354 | Bacteria | 26123 |
| 49 | Ga0070675_100010306 | 3300005354 | Bacteria | 7297 |
| 50 | Ga0070675_100048168 | 3300005354 | Bacteria | 3493 |
| 51 | Ga0070675_100246507 | 3300005354 | Bacteria | 1562 |
| 52 | Ga0070671_100000967 | 3300005355 | Bacteria | 21056 |
| 53 | Ga0070671_100013069 | 3300005355 | Bacteria | 6689 |
| 54 | Ga0070671_100032665 | 3300005355 | Bacteria | 4300 |
| 55 | Ga0070671_100113830 | 3300005355 | Bacteria | 2273 |
| 56 | Ga0070674_100055549 | 3300005356 | Bacteria | 2742 |
| 57 | Ga0070673_100003819 | 3300005364 | Bacteria | 9451 |
| 58 | Ga0070673_100008338 | 3300005364 | Bacteria | 6884 |
| 59 | Ga0070673_100008627 | 3300005364 | Bacteria | 6791 |
| 60 | Ga0070673_100048041 | 3300005364 | Bacteria | 3325 |
| 61 | Ga0070688_100024345 | 3300005365 | Bacteria | 3571 |
| 62 | Ga0070688_100096064 | 3300005365 | Bacteria | 1946 |
| 63 | Ga0070659_100002917 | 3300005366 | Bacteria | 12183 |
| 64 | Ga0070659_100012612 | 3300005366 | Bacteria | 6267 |
| 65 | Ga0070659_100131719 | 3300005366 | Bacteria | 2031 |
| 66 | Ga0070667_100000942 | 3300005367 | Bacteria | 26758 |
| 67 | Ga0070667_100018956 | 3300005367 | Bacteria | 5705 |
| 68 | Ga0070667_100060585 | 3300005367 | Bacteria | 3202 |
| 69 | Ga0070667_100078737 | 3300005367 | Bacteria | 2816 |
| 70 | Ga0070703_10031298 | 3300005406 | Bacteria | 1608 |
| 71 | Ga0070709_10060769 | 3300005434 | Bacteria | 2403 |
| 72 | Ga0070709_10181128 | 3300005434 | Bacteria | 1479 |
| 73 | Ga0070709_10329318 | 3300005434 | Bacteria | 1123 |
| 74 | Ga0070713_100000606 | 3300005436 | Bacteria | 22805 |
| 75 | Ga0070713_100244651 | 3300005436 | Bacteria | 1634 |
| 76 | Ga0070710_10018911 | 3300005437 | Bacteria | 3552 |
| 77 | Ga0070710_10158256 | 3300005437 | Bacteria | 1402 |
| 78 | Ga0070701_10091983 | 3300005438 | Bacteria | 1664 |
| 79 | Ga0070705_100156937 | 3300005440 | Bacteria | 1516 |
| 80 | Ga0070700_100008388 | 3300005441 | Bacteria | 5626 |
| 81 | Ga0070700_100025478 | 3300005441 | Bacteria | 3482 |
| 82 | Ga0070700_100193776 | 3300005441 | Bacteria | 1423 |
| 83 | Ga0070694_100024144 | 3300005444 | Bacteria | 3922 |
| 84 | Ga0070708_100013449 | 3300005445 | Bacteria | 6702 |
| 85 | Ga0070708_100074023 | 3300005445 | Bacteria | 3071 |
| 86 | Ga0070663_100003039 | 3300005455 | Bacteria | 9582 |
| 87 | Ga0070663_100026977 | 3300005455 | Bacteria | 3896 |
| 88 | Ga0070663_100052457 | 3300005455 | Bacteria | 2909 |
| 89 | Ga0070663_100073688 | 3300005455 | Bacteria | 2491 |
| 90 | Ga0070678_100000351 | 3300005456 | Bacteria | 21500 |
| 91 | Ga0070678_100003883 | 3300005456 | Bacteria | 8396 |
| 92 | Ga0070678_100005593 | 3300005456 | Bacteria | 7293 |
| 93 | Ga0070662_100000444 | 3300005457 | Bacteria | 24451 |
| 94 | Ga0070662_100026496 | 3300005457 | Bacteria | 4016 |
| 95 | Ga0070662_100057168 | 3300005457 | Bacteria | 2834 |
| 96 | Ga0070662_100129055 | 3300005457 | Bacteria | 1947 |
| 97 | Ga0070662_100155600 | 3300005457 | Bacteria | 1784 |
| 98 | Ga0070662_100381032 | 3300005457 | Bacteria | 1161 |
| 99 | Ga0070681_10006101 | 3300005458 | Bacteria | 11694 |
| 100 | Ga0070681_10099831 | 3300005458 | Bacteria | 2849 |
| 101 | Ga0070681_10144404 | 3300005458 | Bacteria | 2309 |
| 102 | Ga0068867_100004136 | 3300005459 | Bacteria | 10192 |
| 103 | Ga0068867_100007487 | 3300005459 | Bacteria | 7722 |
| 104 | Ga0070685_10029363 | 3300005466 | Bacteria | 3054 |
| 105 | Ga0070685_10040072 | 3300005466 | Bacteria | 2665 |
| 106 | Ga0070685_10041500 | 3300005466 | Bacteria | 2622 |
| 107 | Ga0070706_100010757 | 3300005467 | Bacteria | 8491 |
| 108 | Ga0070706_100010778 | 3300005467 | Bacteria | 8483 |
| 109 | Ga0070707_100049758 | 3300005468 | Bacteria | 4017 |
| 110 | Ga0070707_100061201 | 3300005468 | Bacteria | 3610 |
| 111 | Ga0070698_100049554 | 3300005471 | Bacteria | 4286 |
| 112 | Ga0070698_100109233 | 3300005471 | Bacteria | 2733 |
| 113 | Ga0070699_100030219 | 3300005518 | Bacteria | 4676 |
| 114 | Ga0070699_100040381 | 3300005518 | Bacteria | 4040 |
| 115 | Ga0070699_100079095 | 3300005518 | Bacteria | 2864 |
| 116 | Ga0070699_100186248 | 3300005518 | Bacteria | 1843 |
| 117 | Ga0070679_100049641 | 3300005530 | Bacteria | 4179 |
| 118 | Ga0070679_100063137 | 3300005530 | Bacteria | 3692 |
| 119 | Ga0070679_100090121 | 3300005530 | Bacteria | 3055 |
| 120 | Ga0070679_100116914 | 3300005530 | Bacteria | 2651 |
| 121 | Ga0070684_100005461 | 3300005535 | Bacteria | 9739 |
| 122 | Ga0070684_100022585 | 3300005535 | Bacteria | 5250 |
| 123 | Ga0070684_100056429 | 3300005535 | Bacteria | 3428 |
| 124 | Ga0070697_100261942 | 3300005536 | Bacteria | 1480 |
| 125 | Ga0068853_100012806 | 3300005539 | Bacteria | 6832 |
| 126 | Ga0068853_100019887 | 3300005539 | Bacteria | 5576 |
| 127 | Ga0068853_100027863 | 3300005539 | Bacteria | 4750 |
| 128 | Ga0068853_100049413 | 3300005539 | Bacteria | 3615 |
| 129 | Ga0068853_100138755 | 3300005539 | Bacteria | 2181 |
| 130 | Ga0070672_100000518 | 3300005543 | Bacteria | 22543 |
| 131 | Ga0070672_100003540 | 3300005543 | Bacteria | 10121 |
| 132 | Ga0070672_100026550 | 3300005543 | Bacteria | 4311 |
| 133 | Ga0070672_100038267 | 3300005543 | Bacteria | 3664 |
| 134 | Ga0070686_100000567 | 3300005544 | Bacteria | 22111 |
| 135 | Ga0070686_100063416 | 3300005544 | Bacteria | 2394 |
| 136 | Ga0070696_100026421 | 3300005546 | Bacteria | 3949 |
| 137 | Ga0070693_100005955 | 3300005547 | Bacteria | 5893 |
| 138 | Ga0070693_100088110 | 3300005547 | Bacteria | 1866 |
| 139 | Ga0070665_100004668 | 3300005548 | Bacteria | 14307 |
| 140 | Ga0070665_100016453 | 3300005548 | Bacteria | 7415 |
| 141 | Ga0070665_100032204 | 3300005548 | Bacteria | 5277 |
| 142 | Ga0070665_100126390 | 3300005548 | Bacteria | 2559 |
| 143 | Ga0070665_100229541 | 3300005548 | Bacteria | 1856 |
| 144 | Ga0070704_100034104 | 3300005549 | Bacteria | 3448 |
| 145 | Ga0070704_100042183 | 3300005549 | Bacteria | 3155 |
| 146 | Ga0068855_100017391 | 3300005563 | Bacteria | 8651 |
| 147 | Ga0068855_100092597 | 3300005563 | Bacteria | 3486 |
| 148 | Ga0068855_100146746 | 3300005563 | Bacteria | 2685 |
| 149 | Ga0070664_100043363 | 3300005564 | Bacteria | 3796 |
| 150 | Ga0070664_100055612 | 3300005564 | Bacteria | 3361 |
| 151 | Ga0070664_100063023 | 3300005564 | Bacteria | 3161 |
| 152 | Ga0070664_100139436 | 3300005564 | Bacteria | 2134 |
| 153 | Ga0070664_100316395 | 3300005564 | Bacteria | 1413 |
| 154 | Ga0068857_100127113 | 3300005577 | Bacteria | 2297 |
| 155 | Ga0068854_100021151 | 3300005578 | Bacteria | 4412 |
| 156 | Ga0068854_100033312 | 3300005578 | Bacteria | 3592 |
| 157 | Ga0068854_100051327 | 3300005578 | Bacteria | 2954 |
| 158 | Ga0068854_100174666 | 3300005578 | Bacteria | 1674 |
| 159 | Ga0068856_100005096 | 3300005614 | Bacteria | 12983 |
| 160 | Ga0068856_100008191 | 3300005614 | Bacteria | 10191 |
| 161 | Ga0068856_100156590 | 3300005614 | Bacteria | 2288 |
| 162 | Ga0068856_100567002 | 3300005614 | Bacteria | 1157 |
| 163 | Ga0070702_100000998 | 3300005615 | Bacteria | 11181 |
| 164 | Ga0070702_100001177 | 3300005615 | Bacteria | 10538 |
| 165 | Ga0070702_100012295 | 3300005615 | Bacteria | 4283 |
| 166 | Ga0068852_100008165 | 3300005616 | Bacteria | 7688 |
| 167 | Ga0068852_100097170 | 3300005616 | Bacteria | 2649 |
| 168 | Ga0068852_100515901 | 3300005616 | Bacteria | 1192 |
| 169 | Ga0068859_100003361 | 3300005617 | Bacteria | 16279 |
| 170 | Ga0068859_100022325 | 3300005617 | Bacteria | 6346 |
| 171 | Ga0068859_100099642 | 3300005617 | Bacteria | 2961 |
| 172 | Ga0068859_100108094 | 3300005617 | Bacteria | 2843 |
| 173 | Ga0068859_100311319 | 3300005617 | Bacteria | 1668 |
| 174 | Ga0068864_100001097 | 3300005618 | Bacteria | 22692 |
| 175 | Ga0068864_100049791 | 3300005618 | Bacteria | 3605 |
| 176 | Ga0068864_100093271 | 3300005618 | Bacteria | 2659 |
| 177 | Ga0068866_10001245 | 3300005718 | Bacteria | 11055 |
| 178 | Ga0068866_10018639 | 3300005718 | Bacteria | 3143 |
| 179 | Ga0068861_100001593 | 3300005719 | Bacteria | 14445 |
| 180 | Ga0068861_100014407 | 3300005719 | Bacteria | 5550 |
| 181 | Ga0068861_100046676 | 3300005719 | Bacteria | 3266 |
| 182 | Ga0068861_100135983 | 3300005719 | Bacteria | 2000 |
| 183 | Ga0068851_10000630 | 3300005834 | Bacteria | 14986 |
| 184 | Ga0068851_10008701 | 3300005834 | Bacteria | 4700 |
| 185 | Ga0068851_10019037 | 3300005834 | Bacteria | 3316 |
| 186 | Ga0068851_10119251 | 3300005834 | Bacteria | 1416 |
| 187 | Ga0068870_10024046 | 3300005840 | Bacteria | 3012 |
| 188 | Ga0068870_10027081 | 3300005840 | Bacteria | 2864 |
| 189 | Ga0068870_10074719 | 3300005840 | Bacteria | 1857 |
| 190 | Ga0068863_100003162 | 3300005841 | Bacteria | 16269 |
| 191 | Ga0068863_100021594 | 3300005841 | Bacteria | 6140 |
| 192 | Ga0068863_100053703 | 3300005841 | Bacteria | 3820 |
| 193 | Ga0068858_100004484 | 3300005842 | Bacteria | 13688 |
| 194 | Ga0068858_100008247 | 3300005842 | Bacteria | 10014 |
| 195 | Ga0068860_100008422 | 3300005843 | Bacteria | 10273 |
| 196 | Ga0068860_100063817 | 3300005843 | Bacteria | 3498 |
| 197 | Ga0068860_100141533 | 3300005843 | Bacteria | 2312 |
| 198 | Ga0068860_100214407 | 3300005843 | Bacteria | 1868 |
| 199 | Ga0068862_100012885 | 3300005844 | Bacteria | 6915 |
| 200 | Ga0068862_100031244 | 3300005844 | Bacteria | 4493 |
| 201 | Ga0068862_100085993 | 3300005844 | Bacteria | 2733 |
| 202 | Ga0081455_10187573 | 3300005937 | Bacteria | 1560 |
| 203 | Ga0070717_10159017 | 3300006028 | Bacteria | 1959 |
| 204 | Ga0075364_10002449 | 3300006051 | Bacteria | 10396 |
| 205 | Ga0075364_10004063 | 3300006051 | Bacteria | 8397 |
| 206 | Ga0070715_10044702 | 3300006163 | Bacteria | 1874 |
| 207 | Ga0070716_100008591 | 3300006173 | Bacteria | 5074 |
| 208 | Ga0070716_100147579 | 3300006173 | Bacteria | 1509 |
| 209 | Ga0070716_100324360 | 3300006173 | Bacteria | 1080 |
| 210 | Ga0070712_100013349 | 3300006175 | Bacteria | 5248 |
| 211 | Ga0070712_100073754 | 3300006175 | Bacteria | 2449 |
| 212 | Ga0097621_100021844 | 3300006237 | Bacteria | 4959 |
| 213 | Ga0097621_100084093 | 3300006237 | Bacteria | 2652 |
| 214 | Ga0097621_100147409 | 3300006237 | Bacteria | 2016 |
| 215 | Ga0068871_100005276 | 3300006358 | Bacteria | 9046 |
| 216 | Ga0068871_100170280 | 3300006358 | Bacteria | 1866 |
| 217 | Ga0075428_100002681 | 3300006844 | Bacteria | 19354 |
| 218 | Ga0075430_100044747 | 3300006846 | Bacteria | 3742 |
| 219 | Ga0075433_10005211 | 3300006852 | Bacteria | 10184 |
| 220 | Ga0075434_100018414 | 3300006871 | Bacteria | 6747 |
| 221 | Ga0075434_100138553 | 3300006871 | Bacteria | 2453 |
| 222 | Ga0075429_100055891 | 3300006880 | Bacteria | 3435 |
| 223 | Ga0068865_100001499 | 3300006881 | Bacteria | 13616 |
| 224 | Ga0068865_100050783 | 3300006881 | Bacteria | 2867 |
| 225 | Ga0068865_100102797 | 3300006881 | Bacteria | 2094 |
| 226 | Ga0068865_100110970 | 3300006881 | Bacteria | 2023 |
| 227 | Ga0075436_100087423 | 3300006914 | Bacteria | 2165 |
| 228 | Ga0075436_100156812 | 3300006914 | Bacteria | 1604 |
| 229 | Ga0097620_100003360 | 3300006931 | Bacteria | 16279 |
| 230 | Ga0097620_100022325 | 3300006931 | Bacteria | 6346 |
| 231 | Ga0097620_100099631 | 3300006931 | Bacteria | 2961 |
| 232 | Ga0097620_100108096 | 3300006931 | Bacteria | 2843 |
| 233 | Ga0097620_100311320 | 3300006931 | Bacteria | 1668 |
| 234 | Ga0075435_100154580 | 3300007076 | Bacteria | 1930 |
| 235 | Ga0105240_10009886 | 3300009093 | Bacteria | 13460 |
| 236 | Ga0105240_10013824 | 3300009093 | Bacteria | 11056 |
| 237 | Ga0105240_10099010 | 3300009093 | Bacteria | 3550 |
| 238 | Ga0105240_10109143 | 3300009093 | Bacteria | 3352 |
| 239 | Ga0105240_10118721 | 3300009093 | Bacteria | 3187 |
| 240 | Ga0111539_10001991 | 3300009094 | Bacteria | 27242 |
| 241 | Ga0111539_10012858 | 3300009094 | Bacteria | 10472 |
| 242 | Ga0105245_10000577 | 3300009098 | Bacteria | 33310 |
| 243 | Ga0105245_10004771 | 3300009098 | Bacteria | 11962 |
| 244 | Ga0105245_10061355 | 3300009098 | Bacteria | 3389 |
| 245 | Ga0105245_10085625 | 3300009098 | Bacteria | 2889 |
| 246 | Ga0105245_10091908 | 3300009098 | Bacteria | 2794 |
| 247 | Ga0105247_10325563 | 3300009101 | Bacteria | 1074 |
| 248 | Ga0114129_10627454 | 3300009147 | Bacteria | 1389 |
| 249 | Ga0105243_10001035 | 3300009148 | Bacteria | 25558 |
| 250 | Ga0105243_10208908 | 3300009148 | Bacteria | 1718 |
| 251 | Ga0105241_10007912 | 3300009174 | Bacteria | 7816 |
| 252 | Ga0105241_10307166 | 3300009174 | Bacteria | 1363 |
| 253 | Ga0105241_10478785 | 3300009174 | Bacteria | 1106 |
| 254 | Ga0105242_10008812 | 3300009176 | Bacteria | 7740 |
| 255 | Ga0105242_10212304 | 3300009176 | Bacteria | 1726 |
| 256 | Ga0105242_10395569 | 3300009176 | Bacteria | 1288 |
| 257 | Ga0105248_10011849 | 3300009177 | Bacteria | 9619 |
| 258 | Ga0105248_10089670 | 3300009177 | Bacteria | 3462 |
| 259 | Ga0105237_10047979 | 3300009545 | Bacteria | 4293 |
| 260 | Ga0105237_10095930 | 3300009545 | Bacteria | 2956 |
| 261 | Ga0105237_10186671 | 3300009545 | Bacteria | 2073 |
| 262 | Ga0105237_10425134 | 3300009545 | Bacteria | 1334 |
| 263 | Ga0105238_10046317 | 3300009551 | Bacteria | 4389 |
| 264 | Ga0105249_10018015 | 3300009553 | Bacteria | 6277 |
| 265 | Ga0105239_10021034 | 3300010375 | Bacteria | 7200 |
| 266 | Ga0105246_10031113 | 3300011119 | Bacteria | 3530 |
| 267 | Ga0105246_10087977 | 3300011119 | Bacteria | 2231 |
| 268 | Ga0157373_10005523 | 3300013100 | Bacteria | 9479 |
| 269 | Ga0157371_10000371 | 3300013102 | Bacteria | 56697 |
| 270 | Ga0157371_10058932 | 3300013102 | Bacteria | 2723 |
| 271 | Ga0157371_10164120 | 3300013102 | Bacteria | 1586 |
| 272 | Ga0157370_10023604 | 3300013104 | Bacteria | 6104 |
| 273 | Ga0157370_10028315 | 3300013104 | Bacteria | 5513 |
| 274 | Ga0157370_10077655 | 3300013104 | Bacteria | 3128 |
| 275 | Ga0157370_10232186 | 3300013104 | Bacteria | 1707 |
| 276 | Ga0157370_10265757 | 3300013104 | Bacteria | 1585 |
| 277 | Ga0157369_10007450 | 3300013105 | Bacteria | 12604 |
| 278 | Ga0157369_10144654 | 3300013105 | Bacteria | 2514 |
| 279 | Ga0157369_10536945 | 3300013105 | Bacteria | 1209 |
| 280 | Ga0157374_10000720 | 3300013296 | Bacteria | 28871 |
| 281 | Ga0157374_10024529 | 3300013296 | Bacteria | 5408 |
| 282 | Ga0157374_10062777 | 3300013296 | Bacteria | 3483 |
| 283 | Ga0157374_10126570 | 3300013296 | Bacteria | 2470 |
| 284 | Ga0157378_10003500 | 3300013297 | Bacteria | 13936 |
| 285 | Ga0157378_10004135 | 3300013297 | Bacteria | 12819 |
| 286 | Ga0157378_10008005 | 3300013297 | Bacteria | 9228 |
| 287 | Ga0163162_10055310 | 3300013306 | Bacteria | 3994 |
| 288 | Ga0163162_10060334 | 3300013306 | Bacteria | 3828 |
| 289 | Ga0163162_10092185 | 3300013306 | Bacteria | 3113 |
| 290 | Ga0157372_10001478 | 3300013307 | Bacteria | 25520 |
| 291 | Ga0157372_10009553 | 3300013307 | Bacteria | 10311 |
| 292 | Ga0157372_10047798 | 3300013307 | Bacteria | 4756 |
| 293 | Ga0157372_10050509 | 3300013307 | Bacteria | 4626 |
| 294 | Ga0157372_10190453 | 3300013307 | Bacteria | 2376 |
| 295 | Ga0157372_10224984 | 3300013307 | Bacteria | 2175 |
| 296 | Ga0157372_10468728 | 3300013307 | Bacteria | 1468 |
| 297 | Ga0157375_10007014 | 3300013308 | Bacteria | 9838 |
| 298 | Ga0157375_10010931 | 3300013308 | Bacteria | 8006 |
| 299 | Ga0157375_10014430 | 3300013308 | Bacteria | 7048 |
| 300 | Ga0157375_10046469 | 3300013308 | Bacteria | 4233 |
| 301 | Ga0163163_10002600 | 3300014325 | Bacteria | 15303 |
| 302 | Ga0163163_10013776 | 3300014325 | Bacteria | 7413 |
| 303 | Ga0163163_10015054 | 3300014325 | Bacteria | 7134 |
| 304 | Ga0163163_10230113 | 3300014325 | Bacteria | 1903 |
| 305 | Ga0157380_10046805 | 3300014326 | Bacteria | 3399 |
| 306 | Ga0157380_10056834 | 3300014326 | Bacteria | 3114 |
| 307 | Ga0157377_10013266 | 3300014745 | Bacteria | 4168 |
| 308 | Ga0157379_10002330 | 3300014968 | Bacteria | 15820 |
| 309 | Ga0157379_10014911 | 3300014968 | Bacteria | 6817 |
| 310 | Ga0157379_10021187 | 3300014968 | Bacteria | 5753 |
| 311 | Ga0157376_10010402 | 3300014969 | Bacteria | 6803 |
| 312 | Ga0157376_10015366 | 3300014969 | Bacteria | 5781 |
| 313 | Ga0157376_10068460 | 3300014969 | Bacteria | 3006 |
| 314 | Ga0157376_10068644 | 3300014969 | Bacteria | 3003 |
| 315 | Ga0157376_10220029 | 3300014969 | Bacteria | 1758 |
| 316 | Ga0157376_10320279 | 3300014969 | Bacteria | 1474 |
| 317 | Ga0163161_10041147 | 3300017792 | Bacteria | 3320 |
| 318 | Ga0163161_10120829 | 3300017792 | Bacteria | 1968 |
| 319 | Ga0206356_10058451 | 3300020070 | Bacteria | 2129 |
| 320 | Ga0206353_10486998 | 3300020082 | Bacteria | 1579 |
| 321 | Ga0206353_11987424 | 3300020082 | Bacteria | 1933 |
| 322 | Ga0207666_1001100 | 3300025271 | Bacteria | 3199 |
| 323 | Ga0207673_1000515 | 3300025290 | Bacteria | 4085 |
| 324 | Ga0207697_10000008 | 3300025315 | Bacteria | 71181 |
| 325 | Ga0207656_10001098 | 3300025321 | Bacteria | 8881 |
| 326 | Ga0207656_10007827 | 3300025321 | Bacteria | 3913 |
| 327 | Ga0207682_10000078 | 3300025893 | Bacteria | 43151 |
| 328 | Ga0207682_10000117 | 3300025893 | Bacteria | 36804 |
| 329 | Ga0207692_10008605 | 3300025898 | Bacteria | 4231 |
| 330 | Ga0207692_10045043 | 3300025898 | Bacteria | 2204 |
| 331 | Ga0207692_10080625 | 3300025898 | Bacteria | 1740 |
| 332 | Ga0207642_10024182 | 3300025899 | Bacteria | 2439 |
| 333 | Ga0207642_10050958 | 3300025899 | Bacteria | 1870 |
| 334 | Ga0207688_10002921 | 3300025901 | Bacteria | 9297 |
| 335 | Ga0207680_10002794 | 3300025903 | Bacteria | 8171 |
| 336 | Ga0207680_10008989 | 3300025903 | Bacteria | 4931 |
| 337 | Ga0207680_10011741 | 3300025903 | Bacteria | 4437 |
| 338 | Ga0207645_10000139 | 3300025907 | Bacteria | 55848 |
| 339 | Ga0207645_10002794 | 3300025907 | Bacteria | 13588 |
| 340 | Ga0207645_10006546 | 3300025907 | Bacteria | 8340 |
| 341 | Ga0207643_10000089 | 3300025908 | Bacteria | 61020 |
| 342 | Ga0207643_10003122 | 3300025908 | Bacteria | 8913 |
| 343 | Ga0207705_10026936 | 3300025909 | Bacteria | 4097 |
| 344 | Ga0207684_10092365 | 3300025910 | Bacteria | 2579 |
| 345 | Ga0207654_10129481 | 3300025911 | Bacteria | 1596 |
| 346 | Ga0207654_10303432 | 3300025911 | Bacteria | 1087 |
| 347 | Ga0207707_10005597 | 3300025912 | Bacteria | 10993 |
| 348 | Ga0207707_10009551 | 3300025912 | Bacteria | 8416 |
| 349 | Ga0207707_10176303 | 3300025912 | Bacteria | 1867 |
| 350 | Ga0207695_10029445 | 3300025913 | Bacteria | 6066 |
| 351 | Ga0207695_10031252 | 3300025913 | Bacteria | 5843 |
| 352 | Ga0207695_10117276 | 3300025913 | Bacteria | 2635 |
| 353 | Ga0207671_10056495 | 3300025914 | Bacteria | 2908 |
| 354 | Ga0207671_10180276 | 3300025914 | Bacteria | 1644 |
| 355 | Ga0207671_10449201 | 3300025914 | Bacteria | 1027 |
| 356 | Ga0207693_10011584 | 3300025915 | Bacteria | 7134 |
| 357 | Ga0207693_10015406 | 3300025915 | Bacteria | 6134 |
| 358 | Ga0207693_10127184 | 3300025915 | Bacteria | 2003 |
| 359 | Ga0207693_10221888 | 3300025915 | Bacteria | 1485 |
| 360 | Ga0207663_10266408 | 3300025916 | Bacteria | 1267 |
| 361 | Ga0207662_10007173 | 3300025918 | Bacteria | 6062 |
| 362 | Ga0207657_10000240 | 3300025919 | Bacteria | 58053 |
| 363 | Ga0207657_10003754 | 3300025919 | Bacteria | 16143 |
| 364 | Ga0207657_10007138 | 3300025919 | Bacteria | 11473 |
| 365 | Ga0207657_10039050 | 3300025919 | Bacteria | 4221 |
| 366 | Ga0207657_10146951 | 3300025919 | Bacteria | 1922 |
| 367 | Ga0207649_10010697 | 3300025920 | Bacteria | 5044 |
| 368 | Ga0207649_10010878 | 3300025920 | Bacteria | 5002 |
| 369 | Ga0207649_10085182 | 3300025920 | Bacteria | 2056 |
| 370 | Ga0207652_10007096 | 3300025921 | Bacteria | 9027 |
| 371 | Ga0207652_10009720 | 3300025921 | Bacteria | 7738 |
| 372 | Ga0207652_10043799 | 3300025921 | Bacteria | 3811 |
| 373 | Ga0207646_10004149 | 3300025922 | Bacteria | 15900 |
| 374 | Ga0207646_10069153 | 3300025922 | Bacteria | 3154 |
| 375 | Ga0207681_10034195 | 3300025923 | Bacteria | 3340 |
| 376 | Ga0207681_10041160 | 3300025923 | Bacteria | 3079 |
| 377 | Ga0207694_10022444 | 3300025924 | Bacteria | 4787 |
| 378 | Ga0207650_10013214 | 3300025925 | Bacteria | 5713 |
| 379 | Ga0207650_10015761 | 3300025925 | Bacteria | 5269 |
| 380 | Ga0207650_10057043 | 3300025925 | Bacteria | 2904 |
| 381 | Ga0207659_10005051 | 3300025926 | Bacteria | 8002 |
| 382 | Ga0207659_10023410 | 3300025926 | Bacteria | 4121 |
| 383 | Ga0207659_10047517 | 3300025926 | Bacteria | 3036 |
| 384 | Ga0207659_10102955 | 3300025926 | Bacteria | 2156 |
| 385 | Ga0207687_10000317 | 3300025927 | Bacteria | 32913 |
| 386 | Ga0207687_10065574 | 3300025927 | Bacteria | 2579 |
| 387 | Ga0207700_10000045 | 3300025928 | Bacteria | 88536 |
| 388 | Ga0207664_10009563 | 3300025929 | Bacteria | 6808 |
| 389 | Ga0207664_10009841 | 3300025929 | Bacteria | 6729 |
| 390 | Ga0207644_10009740 | 3300025931 | Bacteria | 6318 |
| 391 | Ga0207644_10015521 | 3300025931 | Bacteria | 5115 |
| 392 | Ga0207644_10019614 | 3300025931 | Bacteria | 4590 |
| 393 | Ga0207644_10024382 | 3300025931 | Bacteria | 4152 |
| 394 | Ga0207644_10057709 | 3300025931 | Bacteria | 2803 |
| 395 | Ga0207690_10003316 | 3300025932 | Bacteria | 9631 |
| 396 | Ga0207690_10013493 | 3300025932 | Bacteria | 4911 |
| 397 | Ga0207690_10109872 | 3300025932 | Bacteria | 1984 |
| 398 | Ga0207706_10000002 | 3300025933 | Bacteria | 360309 |
| 399 | Ga0207706_10000456 | 3300025933 | Bacteria | 43575 |
| 400 | Ga0207706_10003686 | 3300025933 | Bacteria | 14622 |
| 401 | Ga0207706_10007830 | 3300025933 | Bacteria | 9860 |
| 402 | Ga0207706_10075986 | 3300025933 | Bacteria | 2955 |
| 403 | Ga0207686_10005671 | 3300025934 | Bacteria | 6691 |
| 404 | Ga0207686_10107057 | 3300025934 | Bacteria | 1878 |
| 405 | Ga0207686_10110601 | 3300025934 | Bacteria | 1852 |
| 406 | Ga0207670_10046494 | 3300025936 | Bacteria | 2884 |
| 407 | Ga0207670_10130384 | 3300025936 | Bacteria | 1841 |
| 408 | Ga0207669_10004151 | 3300025937 | Bacteria | 6350 |
| 409 | Ga0207704_10021641 | 3300025938 | Bacteria | 3429 |
| 410 | Ga0207704_10024013 | 3300025938 | Bacteria | 3297 |
| 411 | Ga0207665_10022079 | 3300025939 | Bacteria | 4185 |
| 412 | Ga0207665_10029662 | 3300025939 | Bacteria | 3615 |
| 413 | Ga0207665_10070385 | 3300025939 | Bacteria | 2387 |
| 414 | Ga0207691_10000040 | 3300025940 | Bacteria | 106561 |
| 415 | Ga0207691_10001760 | 3300025940 | Bacteria | 21320 |
| 416 | Ga0207691_10068280 | 3300025940 | Bacteria | 3212 |
| 417 | Ga0207691_10135196 | 3300025940 | Bacteria | 2175 |
| 418 | Ga0207711_10000115 | 3300025941 | Bacteria | 83472 |
| 419 | Ga0207711_10004590 | 3300025941 | Bacteria | 11742 |
| 420 | Ga0207711_10123889 | 3300025941 | Bacteria | 2310 |
| 421 | Ga0207689_10000269 | 3300025942 | Bacteria | 46995 |
| 422 | Ga0207689_10001313 | 3300025942 | Bacteria | 23952 |
| 423 | Ga0207689_10085962 | 3300025942 | Bacteria | 2585 |
| 424 | Ga0207661_10035054 | 3300025944 | Bacteria | 3908 |
| 425 | Ga0207661_10119628 | 3300025944 | Bacteria | 2240 |
| 426 | Ga0207661_10291948 | 3300025944 | Bacteria | 1459 |
| 427 | Ga0207679_10030342 | 3300025945 | Bacteria | 3774 |
| 428 | Ga0207679_10048079 | 3300025945 | Bacteria | 3103 |
| 429 | Ga0207679_10066160 | 3300025945 | Bacteria | 2707 |
| 430 | Ga0207679_10066682 | 3300025945 | Bacteria | 2698 |
| 431 | Ga0207679_10555816 | 3300025945 | Bacteria | 1030 |
| 432 | Ga0207667_10007251 | 3300025949 | Bacteria | 13377 |
| 433 | Ga0207667_10046434 | 3300025949 | Bacteria | 4599 |
| 434 | Ga0207667_10073737 | 3300025949 | Bacteria | 3546 |
| 435 | Ga0207667_10085333 | 3300025949 | Bacteria | 3269 |
| 436 | Ga0207667_10103721 | 3300025949 | Bacteria | 2933 |
| 437 | Ga0207667_10129035 | 3300025949 | Bacteria | 2604 |
| 438 | Ga0207667_10203999 | 3300025949 | Bacteria | 2028 |
| 439 | Ga0207651_10007535 | 3300025960 | Bacteria | 5805 |
| 440 | Ga0207651_10021228 | 3300025960 | Bacteria | 3941 |
| 441 | Ga0207651_10061490 | 3300025960 | Bacteria | 2612 |
| 442 | Ga0207651_10084579 | 3300025960 | Bacteria | 2298 |
| 443 | Ga0207651_10096875 | 3300025960 | Bacteria | 2177 |
| 444 | Ga0207651_10145069 | 3300025960 | Bacteria | 1839 |
| 445 | Ga0207668_10016655 | 3300025972 | Bacteria | 4591 |
| 446 | Ga0207668_10023002 | 3300025972 | Bacteria | 3998 |
| 447 | Ga0207640_10004249 | 3300025981 | Bacteria | 7752 |
| 448 | Ga0207640_10052028 | 3300025981 | Bacteria | 2666 |
| 449 | Ga0207640_10058583 | 3300025981 | Bacteria | 2538 |
| 450 | Ga0207640_10097994 | 3300025981 | Bacteria | 2048 |
| 451 | Ga0207658_10005849 | 3300025986 | Bacteria | 8412 |
| 452 | Ga0207658_10012579 | 3300025986 | Bacteria | 5776 |
| 453 | Ga0207658_10018810 | 3300025986 | Bacteria | 4777 |
| 454 | Ga0207658_10075987 | 3300025986 | Bacteria | 2557 |
| 455 | Ga0207658_10089993 | 3300025986 | Bacteria | 2377 |
| 456 | Ga0207658_10104660 | 3300025986 | Bacteria | 2224 |
| 457 | Ga0207658_10356999 | 3300025986 | Bacteria | 1274 |
| 458 | Ga0207658_10376696 | 3300025986 | Bacteria | 1242 |
| 459 | Ga0207677_10000395 | 3300026023 | Bacteria | 30050 |
| 460 | Ga0207677_10007177 | 3300026023 | Bacteria | 6138 |
| 461 | Ga0207677_10063315 | 3300026023 | Bacteria | 2570 |
| 462 | Ga0207677_10087400 | 3300026023 | Bacteria | 2257 |
| 463 | Ga0207677_10094308 | 3300026023 | Bacteria | 2184 |
| 464 | Ga0207703_10001683 | 3300026035 | Bacteria | 19881 |
| 465 | Ga0207703_10012230 | 3300026035 | Bacteria | 6693 |
| 466 | Ga0207703_10034169 | 3300026035 | Bacteria | 4034 |
| 467 | Ga0207703_10104793 | 3300026035 | Bacteria | 2403 |
| 468 | Ga0207639_10017622 | 3300026041 | Bacteria | 5064 |
| 469 | Ga0207639_10056721 | 3300026041 | Bacteria | 3003 |
| 470 | Ga0207639_10312571 | 3300026041 | Bacteria | 1392 |
| 471 | Ga0207678_10002147 | 3300026067 | Bacteria | 17862 |
| 472 | Ga0207678_10006705 | 3300026067 | Bacteria | 10212 |
| 473 | Ga0207678_10011219 | 3300026067 | Bacteria | 7872 |
| 474 | Ga0207678_10031953 | 3300026067 | Bacteria | 4589 |
| 475 | Ga0207678_10198229 | 3300026067 | Bacteria | 1716 |
| 476 | Ga0207708_10000163 | 3300026075 | Bacteria | 52435 |
| 477 | Ga0207708_10007905 | 3300026075 | Bacteria | 7882 |
| 478 | Ga0207702_10002872 | 3300026078 | Bacteria | 16113 |
| 479 | Ga0207702_10021255 | 3300026078 | Bacteria | 5370 |
| 480 | Ga0207702_10044739 | 3300026078 | Bacteria | 3721 |
| 481 | Ga0207702_10046379 | 3300026078 | Bacteria | 3658 |
| 482 | Ga0207702_10148459 | 3300026078 | Bacteria | 2130 |
| 483 | Ga0207641_10005149 | 3300026088 | Bacteria | 11192 |
| 484 | Ga0207641_10006084 | 3300026088 | Bacteria | 10217 |
| 485 | Ga0207641_10044920 | 3300026088 | Bacteria | 3717 |
| 486 | Ga0207641_10067943 | 3300026088 | Bacteria | 3055 |
| 487 | Ga0207641_10356311 | 3300026088 | Bacteria | 1395 |
| 488 | Ga0207648_10000059 | 3300026089 | Bacteria | 103580 |
| 489 | Ga0207648_10001517 | 3300026089 | Bacteria | 25560 |
| 490 | Ga0207648_10005981 | 3300026089 | Bacteria | 12164 |
| 491 | Ga0207648_10041222 | 3300026089 | Bacteria | 4054 |
| 492 | Ga0207676_10001026 | 3300026095 | Bacteria | 21347 |
| 493 | Ga0207676_10065012 | 3300026095 | Bacteria | 2903 |
| 494 | Ga0207676_10074551 | 3300026095 | Bacteria | 2734 |
| 495 | Ga0207674_10000974 | 3300026116 | Bacteria | 37418 |
| 496 | Ga0207674_10002009 | 3300026116 | Bacteria | 25831 |
| 497 | Ga0207674_10010118 | 3300026116 | Bacteria | 10723 |
| 498 | Ga0207675_100011849 | 3300026118 | Bacteria | 8147 |
| 499 | Ga0207675_100020246 | 3300026118 | Bacteria | 6202 |
| 500 | Ga0207675_100025786 | 3300026118 | Bacteria | 5470 |
| 501 | Ga0207675_100309682 | 3300026118 | Bacteria | 1540 |
| 502 | Ga0207683_10000059 | 3300026121 | Bacteria | 83666 |
| 503 | Ga0207683_10001225 | 3300026121 | Bacteria | 23300 |
| 504 | Ga0207683_10001439 | 3300026121 | Bacteria | 21523 |
| 505 | Ga0207683_10005472 | 3300026121 | Bacteria | 10881 |
| 506 | Ga0207683_10290289 | 3300026121 | Bacteria | 1495 |
| 507 | Ga0207698_10015380 | 3300026142 | Bacteria | 5121 |
| 508 | Ga0207698_10024627 | 3300026142 | Bacteria | 4228 |
| 509 | Ga0207698_10097203 | 3300026142 | Bacteria | 2429 |
| 510 | Ga0207698_10477969 | 3300026142 | Bacteria | 1208 |
| 511 | Ga0209969_1005305 | 3300027360 | Bacteria | 1806 |
| 512 | Ga0209967_1001171 | 3300027364 | Bacteria | 3351 |
| 513 | Ga0210000_1000390 | 3300027462 | Bacteria | 6124 |
| 514 | Ga0210000_1004354 | 3300027462 | Bacteria | 2046 |
| 515 | Ga0209999_1003339 | 3300027543 | Bacteria | 2865 |
| 516 | Ga0209982_1006994 | 3300027552 | Bacteria | 1648 |
| 517 | Ga0210002_1017817 | 3300027617 | Bacteria | 1133 |
| 518 | Ga0209971_1004564 | 3300027682 | Bacteria | 3287 |
| 519 | Ga0209998_10002472 | 3300027717 | Bacteria | 4226 |
| 520 | Ga0209974_10001154 | 3300027876 | Bacteria | 9405 |
| 521 | Ga0209974_10002238 | 3300027876 | Bacteria | 7032 |
| 522 | Ga0207428_10002668 | 3300027907 | Bacteria | 17770 |
| 523 | Ga0268266_10005648 | 3300028379 | Bacteria | 11602 |
| 524 | Ga0268266_10020068 | 3300028379 | Bacteria | 5696 |
| 525 | Ga0268266_10136609 | 3300028379 | Bacteria | 2197 |
| 526 | Ga0268266_10244913 | 3300028379 | Bacteria | 1656 |
| 527 | Ga0268266_10544288 | 3300028379 | Bacteria | 1112 |
| 528 | Ga0268265_10077772 | 3300028380 | Bacteria | 2607 |
| 529 | Ga0268264_10004260 | 3300028381 | Bacteria | 12212 |
| 530 | Ga0268264_10020915 | 3300028381 | Bacteria | 5345 |
| 531 | Ga0268264_10174869 | 3300028381 | Bacteria | 1945 |
| 532 | Ga0265328_10000021 | 3300031239 | Bacteria | 125696 |
| 533 | Ga0265327_10004647 | 3300031251 | Bacteria | 12043 |
| 534 | Ga0307408_100049860 | 3300031548 | Bacteria | 3008 |
| 535 | Ga0307408_100140500 | 3300031548 | Bacteria | 1895 |
| 536 | Ga0316576_10001149 | 3300031727 | Bacteria | 13874 |
| 537 | Ga0316578_10074717 | 3300031728 | Bacteria | 2010 |
| 538 | Ga0307516_10050290 | 3300031730 | Unclassified | 4090 |
| 539 | Ga0307405_10005409 | 3300031731 | Bacteria | 6158 |
| 540 | Ga0316577_10057485 | 3300031733 | Bacteria | 2172 |
| 541 | Ga0307413_10005439 | 3300031824 | Bacteria | 5688 |
| 542 | Ga0307413_10360171 | 3300031824 | Bacteria | 1126 |
| 543 | Ga0307410_10001877 | 3300031852 | Bacteria | 9804 |
| 544 | Ga0307406_10025526 | 3300031901 | Bacteria | 3538 |
| 545 | Ga0307412_10041809 | 3300031911 | Bacteria | 2973 |
| 546 | Ga0307409_100015956 | 3300031995 | Bacteria | 4951 |
| 547 | Ga0307416_100154629 | 3300032002 | Bacteria | 2109 |
| 548 | Ga0307411_10000620 | 3300032005 | Bacteria | 12819 |
| 549 | Ga0307415_100004742 | 3300032126 | Bacteria | 7117 |
| 550 | Ga0373926_0032886 | 3300035083 | Bacteria | 1831 |
| 551 | Ga0373923_0007418 | 3300035111 | Bacteria | 3855 |
| 552 | Ga0373954_0012955 | 3300035118 | Bacteria | 3713 |
| 553 | Ga0373954_0188308 | 3300035118 | Bacteria | 1013 |
| 554 | Ga0373956_0142348 | 3300035119 | Bacteria | 1126 |
| 555 | Ga0373957_0007641 | 3300035120 | Bacteria | 3467 |
| 556 | Ga0373955_0028201 | 3300035172 | Bacteria | 2909 |
| 557 | Ga0373955_0061871 | 3300035172 | Bacteria | 2069 |
| 558 | Ga0373924_0000748 | 3300035410 | Bacteria | 10132 |
| 559 | Ga0373924_0017273 | 3300035410 | Bacteria | 2765 |
| 560 | Ga0373931_0005073 | 3300035691 | Bacteria | 6057 |
| 561 | Ga0373931_0080408 | 3300035691 | Bacteria | 1797 |
| 562 | Ga0373935_0084733 | 3300035692 | Bacteria | 2065 |
| 563 | Ga0373927_0070101 | 3300035695 | Bacteria | 2269 |
| 564 | Ga0373927_0141833 | 3300035695 | Bacteria | 1572 |
| 565 | Ga0373933_0046053 | 3300035724 | Bacteria | 2588 |
| 566 | Ga0373933_0228326 | 3300035724 | Bacteria | 1195 |
| 567 | Ga0373933_0268493 | 3300035724 | Bacteria | 1101 |
| 568 | Ga0373947_0047985 | 3300035725 | Bacteria | 2561 |
| 569 | Ga0373937_0155380 | 3300036401 | Bacteria | 2144 |
| 570 | Ga0373937_0310981 | 3300036401 | Bacteria | 1490 |
| 571 | Ga0316584_0165877 | 3300036712 | Bacteria | 1640 |
| 572 | Ga0373925_0017257 | 3300037068 | Bacteria | 5228 |
| 573 | Ga0373925_0027475 | 3300037068 | Bacteria | 4165 |
| 574 | Ga0451853_1015325 | 3300041512 | Bacteria | 1672 |
| 575 | Ga0439441_001142 | 3300042001 | Bacteria | 3337 |
| 576 | Ga0439448_0040343 | 3300042005 | Bacteria | 1508 |
| 577 | Ga0450893_0040330 | 3300042532 | Bacteria | 854 |
| 578 | Ga0451577_0065992 | 3300042876 | Bacteria | 3227 |
| 579 | Ga0453684_0036941 | 3300044712 | Bacteria | 6717 |
| 580 | Ga0451576_0185197 | 3300045051 | Bacteria | 2174 |
| 581 | Ga0466967_0196621 | 3300045976 | Bacteria | 1908 |
| 582 | Ga0495592_0164315 | 3300046454 | Bacteria | 1525 |
| 583 | Ga0495603_0239913 | 3300046455 | Bacteria | 1044 |
| 584 | Ga0495629_0140560 | 3300046459 | Bacteria | 1680 |
| 585 | Ga0495638_0045596 | 3300046460 | Bacteria | 2757 |
| 586 | Ga0495638_0057570 | 3300046460 | Bacteria | 2410 |
| 587 | Ga0495651_0239889 | 3300046462 | Bacteria | 1244 |
| 588 | Ga0495580_0007298 | 3300046472 | Bacteria | 8885 |
| 589 | Ga0495582_0021865 | 3300046473 | Bacteria | 3499 |
| 590 | Ga0495639_0057288 | 3300046475 | Bacteria | 1780 |
| 591 | Ga0495664_0019930 | 3300046477 | Bacteria | 3863 |
| 592 | Ga0495585_0000183 | 3300046492 | Bacteria | 66586 |
| 593 | Ga0495585_0010876 | 3300046492 | Bacteria | 5406 |
| 594 | Ga0495606_0006253 | 3300046507 | Bacteria | 11054 |
| 595 | Ga0495608_0264253 | 3300046511 | Bacteria | 1071 |
| 596 | Ga0495616_0137327 | 3300046513 | Bacteria | 1116 |
| 597 | Ga0495628_0192156 | 3300046516 | Bacteria | 1541 |
| 598 | Ga0495663_0010608 | 3300046525 | Bacteria | 2563 |
| 599 | Ga0495642_0004167 | 3300046528 | Bacteria | 5642 |
| 600 | Ga0495642_0021154 | 3300046528 | Bacteria | 2557 |
| 601 | Ga0495665_0012100 | 3300046531 | Bacteria | 4671 |
| 602 | Ga0495640_0168999 | 3300046533 | Bacteria | 1398 |
| 603 | Ga0495598_0008674 | 3300046537 | Bacteria | 2376 |
| 604 | Ga0495621_0002301 | 3300046539 | Bacteria | 5126 |
| 605 | Ga0495645_0071531 | 3300046543 | Bacteria | 2501 |
| 606 | Ga0495635_0002903 | 3300046663 | Bacteria | 11774 |
| 607 | Ga0495661_0064947 | 3300046665 | Bacteria | 2151 |
| 608 | Ga0495657_0129632 | 3300046675 | Bacteria | 1581 |
| 609 | Ga0495623_0137887 | 3300046679 | Bacteria | 1454 |
| 610 | Ga0495647_0005522 | 3300046681 | Bacteria | 4147 |
| 611 | Ga0495658_0066125 | 3300046683 | Bacteria | 2087 |
| 612 | Ga0495613_0078176 | 3300046689 | Bacteria | 2407 |
| 613 | Ga0495600_0139991 | 3300046809 | Bacteria | 1570 |
| 614 | Ga0495581_0000877 | 3300047315 | Bacteria | 16067 |
| 615 | Ga0495604_0029175 | 3300047317 | Bacteria | 4389 |
| 616 | Ga0495680_0178056 | 3300047322 | Bacteria | 1536 |
| 617 | Ga0495675_0095241 | 3300047444 | Bacteria | 1867 |
| 618 | Ga0495614_0029641 | 3300048089 | Bacteria | 2355 |
| 619 | Ga0495615_0006487 | 3300048090 | Bacteria | 2170 |
| 620 | Ga0496100_0101355 | 3300048903 | Bacteria | 1985 |
| 621 | Ga0496101_0046735 | 3300048904 | Bacteria | 3106 |
| 622 | Ga0496101_0243927 | 3300048904 | Bacteria | 1398 |
| 623 | Ga0496102_0060090 | 3300048905 | Bacteria | 3477 |
| 624 | Ga0496102_0289759 | 3300048905 | Bacteria | 1543 |
| 625 | Ga0496103_0105954 | 3300048906 | Bacteria | 1783 |
| 626 | Ga0496104_0020039 | 3300048907 | Bacteria | 6126 |
| 627 | Ga0496104_0241354 | 3300048907 | Bacteria | 1719 |
| 628 | Ga0496105_0003430 | 3300048908 | Bacteria | 11732 |
| 629 | Ga0496106_0002245 | 3300048909 | Bacteria | 14401 |
| 630 | Ga0496106_0026769 | 3300048909 | Bacteria | 4295 |
| 631 | Ga0496106_0031246 | 3300048909 | Bacteria | 3967 |
| 632 | Ga0496107_0012148 | 3300048910 | Bacteria | 6007 |
| 633 | Ga0496107_0062535 | 3300048910 | Bacteria | 2697 |
| 634 | Ga0496108_0194232 | 3300048911 | Bacteria | 1760 |
| 635 | Ga0496109_0013547 | 3300048912 | Bacteria | 7079 |
| 636 | Ga0496109_0055446 | 3300048912 | Bacteria | 3616 |
| 637 | Ga0496109_0087837 | 3300048912 | Bacteria | 2872 |
| 638 | Ga0496110_0015445 | 3300048913 | Bacteria | 6355 |
| 639 | Ga0496112_0019696 | 3300048915 | Bacteria | 6376 |
| 640 | Ga0496113_0201424 | 3300048916 | Bacteria | 1582 |
| 641 | Ga0496115_0006889 | 3300048918 | Bacteria | 8347 |
| 642 | Ga0496115_0140125 | 3300048918 | Bacteria | 1995 |
| 643 | Ga0496115_0174452 | 3300048918 | Bacteria | 1778 |
| 644 | Ga0496125_0004893 | 3300048928 | Bacteria | 15183 |
| 645 | Ga0501295_003521 | 3300049518 | Bacteria | 1929 |
| 646 | Ga0501032_0010705 | 3300049569 | Bacteria | 6600 |
| 647 | Ga0501033_0066257 | 3300049570 | Bacteria | 2656 |
| 648 | Ga0501034_0076671 | 3300049571 | Bacteria | 3349 |
| 649 | Ga0501034_0153436 | 3300049571 | Bacteria | 2278 |
| 650 | Ga0501038_0016387 | 3300049574 | Bacteria | 6717 |
| 651 | Ga0501039_0000901 | 3300049575 | Bacteria | 21633 |
| 652 | Ga0501039_0013917 | 3300049575 | Bacteria | 6154 |
| 653 | Ga0501040_0089042 | 3300049576 | Bacteria | 2144 |
| 654 | Ga0501041_0007189 | 3300049577 | Bacteria | 6532 |
| 655 | Ga0501042_0008620 | 3300049578 | Bacteria | 6748 |
| 656 | Ga0501046_0151018 | 3300049580 | Bacteria | 1752 |
| 657 | Ga0501048_0094128 | 3300049582 | Bacteria | 2113 |
| 658 | Ga0501071_0022730 | 3300049587 | Bacteria | 4373 |
| 659 | Ga0501075_0019282 | 3300049591 | Bacteria | 4946 |
| 660 | Ga0501076_0000468 | 3300049592 | Bacteria | 25466 |
| 661 | Ga0501079_0014141 | 3300049741 | Bacteria | 6083 |
| 662 | Ga0501080_0010515 | 3300049742 | Bacteria | 8471 |
| 663 | Ga0501081_0000619 | 3300049743 | Bacteria | 20290 |
| 664 | Ga0501035_0092453 | 3300049822 | Bacteria | 2662 |
| 665 | Ga0501035_0105994 | 3300049822 | Bacteria | 2465 |
| 666 | Ga0501045_0042010 | 3300049824 | Bacteria | 3328 |
| 667 | nmdc:mga00v17_14722_c1 | 3300050491 | Bacteria | 4374 |
| 668 | nmdc:mga0yw44_46271_c1 | 3300050492 | Bacteria | 2612 |
| 669 | nmdc:mga0qj67_63803_c1 | 3300050509 | Bacteria | 2929 |
| 670 | nmdc:mga08y16_309869_c1 | 3300050511 | Bacteria | 1626 |
| 671 | nmdc:mga08y16_682_c1 | 3300050511 | Bacteria | 32091 |
| 672 | nmdc:mga08x19_35613_c1 | 3300050514 | Bacteria | 3150 |
| 673 | nmdc:mga08x19_76133_c1 | 3300050514 | Bacteria | 2195 |
| 674 | nmdc:mga08x19_84874_c1 | 3300050514 | Bacteria | 2083 |
| 675 | nmdc:mga0a205_7849_c2 | 3300050515 | Bacteria | 8925 |
| 676 | Ga0495619_0009678 | 3300053085 | Bacteria | 6078 |
| 677 | Ga0500650_0063687 | 3300053098 | Bacteria | 1723 |
| 678 | Ga0500622_0000023 | 3300053156 | Bacteria | 251170 |
| 679 | Ga0501084_0028010 | 3300054114 | Bacteria | 4708 |
| 680 | Ga0501082_0002263 | 3300060353 | Bacteria | 16866 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042532 | Ga0450893_0040330 | Ga0450893_0040330_74_811 | 242 |
| 2 | 3300049822 | Ga0501035_0092453 | Ga0501035_0092453_421_1299 | 251 |
| 3 | 3300005334 | Ga0068869_100047051 | Ga0068869_1000470512 | 256 |
| 4 | 3300005617 | Ga0068859_100022325 | Ga0068859_1000223257 | 256 |
| 5 | 3300006931 | Ga0097620_100022325 | Ga0097620_1000223257 | 256 |
| 6 | 3300025986 | Ga0207658_10376696 | Ga0207658_103766962 | 261 |
| 7 | 3300005339 | Ga0070660_100036208 | Ga0070660_1000362084 | 263 |
| 8 | 3300005616 | Ga0068852_100097170 | Ga0068852_1000971702 | 263 |
| 9 | 3300013104 | Ga0157370_10077655 | Ga0157370_100776553 | 263 |
| 10 | 3300013105 | Ga0157369_10007450 | Ga0157369_100074502 | 263 |
| 11 | 3300025919 | Ga0207657_10146951 | Ga0207657_101469512 | 263 |
| 12 | 3300025932 | Ga0207690_10013493 | Ga0207690_100134933 | 263 |
| 13 | 3300025949 | Ga0207667_10103721 | Ga0207667_101037213 | 263 |
| 14 | 3300026142 | Ga0207698_10097203 | Ga0207698_100972032 | 263 |
| 15 | 3300020082 | Ga0206353_11987424 | Ga0206353_119874242 | 265 |
| 16 | 3300005339 | Ga0070660_100003481 | Ga0070660_10000348110 | 266 |
| 17 | 3300005353 | Ga0070669_100053770 | Ga0070669_1000537703 | 266 |
| 18 | 3300005355 | Ga0070671_100000967 | Ga0070671_1000009679 | 266 |
| 19 | 3300005364 | Ga0070673_100048041 | Ga0070673_1000480413 | 266 |
| 20 | 3300005366 | Ga0070659_100002917 | Ga0070659_1000029176 | 266 |
| 21 | 3300005455 | Ga0070663_100003039 | Ga0070663_1000030397 | 266 |
| 22 | 3300005457 | Ga0070662_100000444 | Ga0070662_10000044421 | 266 |
| 23 | 3300005539 | Ga0068853_100027863 | Ga0068853_1000278632 | 266 |
| 24 | 3300005563 | Ga0068855_100017391 | Ga0068855_1000173917 | 266 |
| 25 | 3300005564 | Ga0070664_100139436 | Ga0070664_1001394362 | 266 |
| 26 | 3300005578 | Ga0068854_100174666 | Ga0068854_1001746662 | 266 |
| 27 | 3300005614 | Ga0068856_100008191 | Ga0068856_1000081917 | 266 |
| 28 | 3300005834 | Ga0068851_10119251 | Ga0068851_101192512 | 266 |
| 29 | 3300013100 | Ga0157373_10005523 | Ga0157373_100055237 | 266 |
| 30 | 3300013102 | Ga0157371_10000371 | Ga0157371_1000037145 | 266 |
| 31 | 3300013105 | Ga0157369_10536945 | Ga0157369_105369451 | 266 |
| 32 | 3300013307 | Ga0157372_10001478 | Ga0157372_1000147815 | 266 |
| 33 | 3300025907 | Ga0207645_10006546 | Ga0207645_100065466 | 266 |
| 34 | 3300025912 | Ga0207707_10176303 | Ga0207707_101763031 | 266 |
| 35 | 3300025919 | Ga0207657_10007138 | Ga0207657_100071389 | 266 |
| 36 | 3300025923 | Ga0207681_10034195 | Ga0207681_100341952 | 266 |
| 37 | 3300025931 | Ga0207644_10019614 | Ga0207644_100196144 | 266 |
| 38 | 3300025932 | Ga0207690_10003316 | Ga0207690_100033169 | 266 |
| 39 | 3300025933 | Ga0207706_10000002 | Ga0207706_10000002180 | 266 |
| 40 | 3300025945 | Ga0207679_10048079 | Ga0207679_100480793 | 266 |
| 41 | 3300025949 | Ga0207667_10203999 | Ga0207667_102039992 | 266 |
| 42 | 3300025960 | Ga0207651_10145069 | Ga0207651_101450693 | 266 |
| 43 | 3300025981 | Ga0207640_10097994 | Ga0207640_100979942 | 266 |
| 44 | 3300026067 | Ga0207678_10006705 | Ga0207678_100067059 | 266 |
| 45 | 3300026078 | Ga0207702_10002872 | Ga0207702_100028723 | 266 |
| 46 | 3300026121 | Ga0207683_10290289 | Ga0207683_102902891 | 266 |
| 47 | 3300048904 | Ga0496101_0243927 | Ga0496101_0243927_420_1328 | 266 |
| 48 | 3300048905 | Ga0496102_0060090 | Ga0496102_0060090_1458_2366 | 266 |
| 49 | 3300048909 | Ga0496106_0002245 | Ga0496106_0002245_5637_6545 | 266 |
| 50 | 3300048910 | Ga0496107_0012148 | Ga0496107_0012148_4781_5689 | 266 |
| 51 | 3300005563 | Ga0068855_100146746 | Ga0068855_1001467462 | 267 |
| 52 | 3300005330 | Ga0070690_100004201 | Ga0070690_1000042013 | 272 |
| 53 | 3300005345 | Ga0070692_10157777 | Ga0070692_101577772 | 272 |
| 54 | 3300005365 | Ga0070688_100096064 | Ga0070688_1000960642 | 272 |
| 55 | 3300005441 | Ga0070700_100008388 | Ga0070700_1000083885 | 272 |
| 56 | 3300005444 | Ga0070694_100024144 | Ga0070694_1000241444 | 272 |
| 57 | 3300005466 | Ga0070685_10029363 | Ga0070685_100293634 | 272 |
| 58 | 3300005547 | Ga0070693_100088110 | Ga0070693_1000881101 | 272 |
| 59 | 3300005549 | Ga0070704_100042183 | Ga0070704_1000421832 | 272 |
| 60 | 3300005615 | Ga0070702_100000998 | Ga0070702_1000009987 | 272 |
| 61 | 3300005718 | Ga0068866_10001245 | Ga0068866_100012459 | 272 |
| 62 | 3300005719 | Ga0068861_100001593 | Ga0068861_10000159314 | 272 |
| 63 | 3300005844 | Ga0068862_100012885 | Ga0068862_1000128852 | 272 |
| 64 | 3300005937 | Ga0081455_10187573 | Ga0081455_101875732 | 272 |
| 65 | 3300009176 | Ga0105242_10008812 | Ga0105242_100088129 | 272 |
| 66 | 3300014969 | Ga0157376_10068644 | Ga0157376_100686442 | 272 |
| 67 | 3300025934 | Ga0207686_10005671 | Ga0207686_100056713 | 272 |
| 68 | 3300025942 | Ga0207689_10000269 | Ga0207689_1000026928 | 272 |
| 69 | 3300026075 | Ga0207708_10000163 | Ga0207708_1000016333 | 272 |
| 70 | 3300026089 | Ga0207648_10000059 | Ga0207648_1000005930 | 272 |
| 71 | 3300026118 | Ga0207675_100011849 | Ga0207675_1000118497 | 272 |
| 72 | 3300005436 | Ga0070713_100244651 | Ga0070713_1002446511 | 274 |
| 73 | 3300005546 | Ga0070696_100026421 | Ga0070696_1000264215 | 277 |
| 74 | 3300031548 | Ga0307408_100049860 | Ga0307408_1000498602 | 278 |
| 75 | 3300031731 | Ga0307405_10005409 | Ga0307405_100054094 | 278 |
| 76 | 3300031824 | Ga0307413_10005439 | Ga0307413_100054395 | 278 |
| 77 | 3300031852 | Ga0307410_10001877 | Ga0307410_100018774 | 278 |
| 78 | 3300031901 | Ga0307406_10025526 | Ga0307406_100255264 | 278 |
| 79 | 3300031911 | Ga0307412_10041809 | Ga0307412_100418093 | 278 |
| 80 | 3300031995 | Ga0307409_100015956 | Ga0307409_1000159561 | 278 |
| 81 | 3300032002 | Ga0307416_100154629 | Ga0307416_1001546291 | 278 |
| 82 | 3300032005 | Ga0307411_10000620 | Ga0307411_100006209 | 278 |
| 83 | 3300032126 | Ga0307415_100004742 | Ga0307415_1000047424 | 278 |
| 84 | 3300009093 | Ga0105240_10099010 | Ga0105240_100990105 | 280 |
| 85 | 3300026041 | Ga0207639_10312571 | Ga0207639_103125711 | 280 |
| 86 | 3300035119 | Ga0373956_0142348 | Ga0373956_0142348_250_1095 | 281 |
| 87 | 3300046454 | Ga0495592_0164315 | Ga0495592_0164315_30_875 | 281 |
| 88 | 3300046462 | Ga0495651_0239889 | Ga0495651_0239889_381_1226 | 281 |
| 89 | 3300005347 | Ga0070668_100001156 | Ga0070668_10000115618 | 282 |
| 90 | 3300005353 | Ga0070669_100118560 | Ga0070669_1001185602 | 282 |
| 91 | 3300005441 | Ga0070700_100193776 | Ga0070700_1001937762 | 282 |
| 92 | 3300005543 | Ga0070672_100038267 | Ga0070672_1000382673 | 282 |
| 93 | 3300005844 | Ga0068862_100085993 | Ga0068862_1000859932 | 282 |
| 94 | 3300025940 | Ga0207691_10135196 | Ga0207691_101351963 | 282 |
| 95 | 3300028380 | Ga0268265_10077772 | Ga0268265_100777723 | 282 |
| 96 | 3300036401 | Ga0373937_0155380 | Ga0373937_0155380_824_1702 | 282 |
| 97 | 3300046525 | Ga0495663_0010608 | Ga0495663_0010608_668_1516 | 282 |
| 98 | 3300009177 | Ga0105248_10089670 | Ga0105248_100896701 | 287 |
| 99 | 3300009094 | Ga0111539_10001991 | Ga0111539_1000199119 | 288 |
| 100 | 3300035691 | Ga0373931_0080408 | Ga0373931_0080408_907_1779 | 288 |
| 101 | 3300050511 | nmdc:mga08y16_682_c1 | nmdc:mga08y16_682_c1_12873_13745 | 288 |
| 102 | 3300031251 | Ga0265327_10004647 | Ga0265327_100046473 | 290 |
| 103 | 3300031733 | Ga0316577_10057485 | Ga0316577_100574852 | 290 |
| 104 | 3300036712 | Ga0316584_0165877 | Ga0316584_0165877_31_903 | 290 |
| 105 | 3300048916 | Ga0496113_0201424 | Ga0496113_0201424_689_1561 | 290 |
| 106 | 3300053156 | Ga0500622_0000023 | Ga0500622_0000023_167832_168704 | 290 |
| 107 | 3300006051 | Ga0075364_10002449 | Ga0075364_100024495 | 291 |
| 108 | 3300006051 | Ga0075364_10004063 | Ga0075364_1000406312 | 291 |
| 109 | 3300031239 | Ga0265328_10000021 | Ga0265328_10000021109 | 291 |
| 110 | 3300031548 | Ga0307408_100140500 | Ga0307408_1001405002 | 291 |
| 111 | 3300031727 | Ga0316576_10001149 | Ga0316576_100011494 | 291 |
| 112 | 3300031728 | Ga0316578_10074717 | Ga0316578_100747172 | 291 |
| 113 | 3300031730 | Ga0307516_10050290 | Ga0307516_100502905 | 291 |
| 114 | 3300031824 | Ga0307413_10360171 | Ga0307413_103601712 | 291 |
| 115 | 3300035410 | Ga0373924_0000748 | Ga0373924_0000748_6091_6966 | 291 |
| 116 | 3300042876 | Ga0451577_0065992 | Ga0451577_0065992_1032_1907 | 291 |
| 117 | 3300044712 | Ga0453684_0036941 | Ga0453684_0036941_4371_5246 | 291 |
| 118 | 3300045051 | Ga0451576_0185197 | Ga0451576_0185197_493_1368 | 291 |
| 119 | 3300046513 | Ga0495616_0137327 | Ga0495616_0137327_222_1106 | 291 |
| 120 | 3300049518 | Ga0501295_003521 | Ga0501295_003521_313_1188 | 291 |
| 121 | 3300050491 | nmdc:mga00v17_14722_c1 | nmdc:mga00v17_14722_c1_1347_2249 | 291 |
| 122 | 3300005367 | Ga0070667_100018956 | Ga0070667_1000189566 | 292 |
| 123 | 3300005458 | Ga0070681_10099831 | Ga0070681_100998312 | 292 |
| 124 | 3300005617 | Ga0068859_100108094 | Ga0068859_1001080943 | 292 |
| 125 | 3300006931 | Ga0097620_100108096 | Ga0097620_1001080963 | 292 |
| 126 | 3300025986 | Ga0207658_10356999 | Ga0207658_103569991 | 292 |
| 127 | 3300027360 | Ga0209969_1005305 | Ga0209969_10053051 | 292 |
| 128 | 3300027364 | Ga0209967_1001171 | Ga0209967_10011711 | 292 |
| 129 | 3300027462 | Ga0210000_1000390 | Ga0210000_10003903 | 292 |
| 130 | 3300027543 | Ga0209999_1003339 | Ga0209999_10033392 | 292 |
| 131 | 3300027682 | Ga0209971_1004564 | Ga0209971_10045643 | 292 |
| 132 | 3300027876 | Ga0209974_10002238 | Ga0209974_100022382 | 292 |
| 133 | 3300042001 | Ga0439441_001142 | Ga0439441_001142_811_1695 | 292 |
| 134 | 3300048928 | Ga0496125_0004893 | Ga0496125_0004893_6310_7188 | 292 |
| 135 | 3300049569 | Ga0501032_0010705 | Ga0501032_0010705_4785_5663 | 292 |
| 136 | 3300049571 | Ga0501034_0076671 | Ga0501034_0076671_695_1573 | 292 |
| 137 | 3300049574 | Ga0501038_0016387 | Ga0501038_0016387_5416_6294 | 292 |
| 138 | 3300049575 | Ga0501039_0013917 | Ga0501039_0013917_2372_3250 | 292 |
| 139 | 3300049822 | Ga0501035_0105994 | Ga0501035_0105994_222_1100 | 292 |
| 140 | 3300005335 | Ga0070666_10008975 | Ga0070666_100089753 | 293 |
| 141 | 3300005336 | Ga0070680_100056629 | Ga0070680_1000566294 | 293 |
| 142 | 3300005338 | Ga0068868_100021617 | Ga0068868_1000216175 | 293 |
| 143 | 3300005338 | Ga0068868_100034010 | Ga0068868_1000340103 | 293 |
| 144 | 3300005338 | Ga0068868_100244029 | Ga0068868_1002440292 | 293 |
| 145 | 3300005340 | Ga0070689_100063093 | Ga0070689_1000630932 | 293 |
| 146 | 3300005347 | Ga0070668_100003734 | Ga0070668_1000037342 | 293 |
| 147 | 3300005353 | Ga0070669_100070730 | Ga0070669_1000707302 | 293 |
| 148 | 3300005354 | Ga0070675_100010306 | Ga0070675_1000103064 | 293 |
| 149 | 3300005356 | Ga0070674_100055549 | Ga0070674_1000555492 | 293 |
| 150 | 3300005364 | Ga0070673_100008338 | Ga0070673_1000083386 | 293 |
| 151 | 3300005364 | Ga0070673_100008627 | Ga0070673_1000086272 | 293 |
| 152 | 3300005366 | Ga0070659_100131719 | Ga0070659_1001317192 | 293 |
| 153 | 3300005367 | Ga0070667_100060585 | Ga0070667_1000605853 | 293 |
| 154 | 3300005367 | Ga0070667_100078737 | Ga0070667_1000787372 | 293 |
| 155 | 3300005406 | Ga0070703_10031298 | Ga0070703_100312982 | 293 |
| 156 | 3300005434 | Ga0070709_10181128 | Ga0070709_101811281 | 293 |
| 157 | 3300005436 | Ga0070713_100000606 | Ga0070713_10000060621 | 293 |
| 158 | 3300005437 | Ga0070710_10018911 | Ga0070710_100189113 | 293 |
| 159 | 3300005440 | Ga0070705_100156937 | Ga0070705_1001569372 | 293 |
| 160 | 3300005445 | Ga0070708_100013449 | Ga0070708_1000134498 | 293 |
| 161 | 3300005445 | Ga0070708_100074023 | Ga0070708_1000740233 | 293 |
| 162 | 3300005455 | Ga0070663_100052457 | Ga0070663_1000524572 | 293 |
| 163 | 3300005456 | Ga0070678_100003883 | Ga0070678_1000038835 | 293 |
| 164 | 3300005457 | Ga0070662_100026496 | Ga0070662_1000264962 | 293 |
| 165 | 3300005457 | Ga0070662_100057168 | Ga0070662_1000571682 | 293 |
| 166 | 3300005457 | Ga0070662_100129055 | Ga0070662_1001290552 | 293 |
| 167 | 3300005466 | Ga0070685_10040072 | Ga0070685_100400723 | 293 |
| 168 | 3300005467 | Ga0070706_100010757 | Ga0070706_1000107578 | 293 |
| 169 | 3300005467 | Ga0070706_100010778 | Ga0070706_1000107785 | 293 |
| 170 | 3300005468 | Ga0070707_100049758 | Ga0070707_1000497584 | 293 |
| 171 | 3300005468 | Ga0070707_100061201 | Ga0070707_1000612013 | 293 |
| 172 | 3300005471 | Ga0070698_100049554 | Ga0070698_1000495543 | 293 |
| 173 | 3300005471 | Ga0070698_100109233 | Ga0070698_1001092332 | 293 |
| 174 | 3300005518 | Ga0070699_100030219 | Ga0070699_1000302192 | 293 |
| 175 | 3300005518 | Ga0070699_100040381 | Ga0070699_1000403812 | 293 |
| 176 | 3300005535 | Ga0070684_100056429 | Ga0070684_1000564292 | 293 |
| 177 | 3300005536 | Ga0070697_100261942 | Ga0070697_1002619422 | 293 |
| 178 | 3300005543 | Ga0070672_100003540 | Ga0070672_1000035406 | 293 |
| 179 | 3300005544 | Ga0070686_100063416 | Ga0070686_1000634162 | 293 |
| 180 | 3300005547 | Ga0070693_100005955 | Ga0070693_1000059553 | 293 |
| 181 | 3300005548 | Ga0070665_100032204 | Ga0070665_1000322044 | 293 |
| 182 | 3300005549 | Ga0070704_100034104 | Ga0070704_1000341043 | 293 |
| 183 | 3300005564 | Ga0070664_100316395 | Ga0070664_1003163952 | 293 |
| 184 | 3300005578 | Ga0068854_100051327 | Ga0068854_1000513273 | 293 |
| 185 | 3300005614 | Ga0068856_100567002 | Ga0068856_1005670021 | 293 |
| 186 | 3300005615 | Ga0070702_100012295 | Ga0070702_1000122952 | 293 |
| 187 | 3300005617 | Ga0068859_100003361 | Ga0068859_10000336111 | 293 |
| 188 | 3300005618 | Ga0068864_100001097 | Ga0068864_1000010973 | 293 |
| 189 | 3300005719 | Ga0068861_100046676 | Ga0068861_1000466761 | 293 |
| 190 | 3300005841 | Ga0068863_100003162 | Ga0068863_10000316217 | 293 |
| 191 | 3300005841 | Ga0068863_100053703 | Ga0068863_1000537033 | 293 |
| 192 | 3300005843 | Ga0068860_100141533 | Ga0068860_1001415332 | 293 |
| 193 | 3300006028 | Ga0070717_10159017 | Ga0070717_101590172 | 293 |
| 194 | 3300006163 | Ga0070715_10044702 | Ga0070715_100447022 | 293 |
| 195 | 3300006173 | Ga0070716_100008591 | Ga0070716_1000085915 | 293 |
| 196 | 3300006173 | Ga0070716_100147579 | Ga0070716_1001475792 | 293 |
| 197 | 3300006175 | Ga0070712_100013349 | Ga0070712_1000133493 | 293 |
| 198 | 3300006175 | Ga0070712_100073754 | Ga0070712_1000737543 | 293 |
| 199 | 3300006237 | Ga0097621_100084093 | Ga0097621_1000840932 | 293 |
| 200 | 3300006358 | Ga0068871_100170280 | Ga0068871_1001702802 | 293 |
| 201 | 3300006852 | Ga0075433_10005211 | Ga0075433_100052119 | 293 |
| 202 | 3300006871 | Ga0075434_100018414 | Ga0075434_1000184145 | 293 |
| 203 | 3300006871 | Ga0075434_100138553 | Ga0075434_1001385533 | 293 |
| 204 | 3300006881 | Ga0068865_100102797 | Ga0068865_1001027971 | 293 |
| 205 | 3300006931 | Ga0097620_100003360 | Ga0097620_10000336011 | 293 |
| 206 | 3300009093 | Ga0105240_10118721 | Ga0105240_101187212 | 293 |
| 207 | 3300009098 | Ga0105245_10004771 | Ga0105245_100047715 | 293 |
| 208 | 3300009098 | Ga0105245_10061355 | Ga0105245_100613552 | 293 |
| 209 | 3300009098 | Ga0105245_10091908 | Ga0105245_100919083 | 293 |
| 210 | 3300009101 | Ga0105247_10325563 | Ga0105247_103255632 | 293 |
| 211 | 3300009147 | Ga0114129_10627454 | Ga0114129_106274542 | 293 |
| 212 | 3300009174 | Ga0105241_10307166 | Ga0105241_103071662 | 293 |
| 213 | 3300009176 | Ga0105242_10395569 | Ga0105242_103955692 | 293 |
| 214 | 3300009545 | Ga0105237_10186671 | Ga0105237_101866711 | 293 |
| 215 | 3300011119 | Ga0105246_10031113 | Ga0105246_100311134 | 293 |
| 216 | 3300011119 | Ga0105246_10087977 | Ga0105246_100879773 | 293 |
| 217 | 3300013104 | Ga0157370_10028315 | Ga0157370_100283155 | 293 |
| 218 | 3300013296 | Ga0157374_10000720 | Ga0157374_1000072025 | 293 |
| 219 | 3300013297 | Ga0157378_10004135 | Ga0157378_100041353 | 293 |
| 220 | 3300013306 | Ga0163162_10055310 | Ga0163162_100553102 | 293 |
| 221 | 3300013306 | Ga0163162_10092185 | Ga0163162_100921854 | 293 |
| 222 | 3300013308 | Ga0157375_10010931 | Ga0157375_100109312 | 293 |
| 223 | 3300013308 | Ga0157375_10046469 | Ga0157375_100464695 | 293 |
| 224 | 3300014325 | Ga0163163_10013776 | Ga0163163_100137768 | 293 |
| 225 | 3300014326 | Ga0157380_10046805 | Ga0157380_100468054 | 293 |
| 226 | 3300014745 | Ga0157377_10013266 | Ga0157377_100132664 | 293 |
| 227 | 3300014968 | Ga0157379_10021187 | Ga0157379_100211876 | 293 |
| 228 | 3300014969 | Ga0157376_10068460 | Ga0157376_100684604 | 293 |
| 229 | 3300014969 | Ga0157376_10320279 | Ga0157376_103202792 | 293 |
| 230 | 3300017792 | Ga0163161_10041147 | Ga0163161_100411473 | 293 |
| 231 | 3300020082 | Ga0206353_10486998 | Ga0206353_104869982 | 293 |
| 232 | 3300025898 | Ga0207692_10008605 | Ga0207692_100086053 | 293 |
| 233 | 3300025898 | Ga0207692_10045043 | Ga0207692_100450432 | 293 |
| 234 | 3300025899 | Ga0207642_10050958 | Ga0207642_100509582 | 293 |
| 235 | 3300025903 | Ga0207680_10002794 | Ga0207680_100027948 | 293 |
| 236 | 3300025910 | Ga0207684_10092365 | Ga0207684_100923653 | 293 |
| 237 | 3300025911 | Ga0207654_10129481 | Ga0207654_101294812 | 293 |
| 238 | 3300025911 | Ga0207654_10303432 | Ga0207654_103034321 | 293 |
| 239 | 3300025914 | Ga0207671_10180276 | Ga0207671_101802761 | 293 |
| 240 | 3300025915 | Ga0207693_10011584 | Ga0207693_100115844 | 293 |
| 241 | 3300025915 | Ga0207693_10015406 | Ga0207693_100154066 | 293 |
| 242 | 3300025915 | Ga0207693_10221888 | Ga0207693_102218881 | 293 |
| 243 | 3300025919 | Ga0207657_10003754 | Ga0207657_1000375417 | 293 |
| 244 | 3300025920 | Ga0207649_10085182 | Ga0207649_100851822 | 293 |
| 245 | 3300025922 | Ga0207646_10004149 | Ga0207646_100041495 | 293 |
| 246 | 3300025922 | Ga0207646_10069153 | Ga0207646_100691533 | 293 |
| 247 | 3300025925 | Ga0207650_10013214 | Ga0207650_100132144 | 293 |
| 248 | 3300025926 | Ga0207659_10102955 | Ga0207659_101029551 | 293 |
| 249 | 3300025927 | Ga0207687_10000317 | Ga0207687_100003176 | 293 |
| 250 | 3300025927 | Ga0207687_10065574 | Ga0207687_100655742 | 293 |
| 251 | 3300025928 | Ga0207700_10000045 | Ga0207700_1000004522 | 293 |
| 252 | 3300025929 | Ga0207664_10009841 | Ga0207664_100098412 | 293 |
| 253 | 3300025931 | Ga0207644_10057709 | Ga0207644_100577092 | 293 |
| 254 | 3300025933 | Ga0207706_10003686 | Ga0207706_100036865 | 293 |
| 255 | 3300025933 | Ga0207706_10007830 | Ga0207706_100078302 | 293 |
| 256 | 3300025934 | Ga0207686_10107057 | Ga0207686_101070572 | 293 |
| 257 | 3300025936 | Ga0207670_10046494 | Ga0207670_100464943 | 293 |
| 258 | 3300025938 | Ga0207704_10021641 | Ga0207704_100216412 | 293 |
| 259 | 3300025939 | Ga0207665_10022079 | Ga0207665_100220793 | 293 |
| 260 | 3300025939 | Ga0207665_10070385 | Ga0207665_100703853 | 293 |
| 261 | 3300025940 | Ga0207691_10001760 | Ga0207691_100017606 | 293 |
| 262 | 3300025940 | Ga0207691_10068280 | Ga0207691_100682802 | 293 |
| 263 | 3300025941 | Ga0207711_10000115 | Ga0207711_1000011519 | 293 |
| 264 | 3300025942 | Ga0207689_10085962 | Ga0207689_100859623 | 293 |
| 265 | 3300025945 | Ga0207679_10555816 | Ga0207679_105558161 | 293 |
| 266 | 3300025949 | Ga0207667_10073737 | Ga0207667_100737374 | 293 |
| 267 | 3300025960 | Ga0207651_10021228 | Ga0207651_100212281 | 293 |
| 268 | 3300025960 | Ga0207651_10084579 | Ga0207651_100845793 | 293 |
| 269 | 3300025981 | Ga0207640_10004249 | Ga0207640_100042493 | 293 |
| 270 | 3300025986 | Ga0207658_10005849 | Ga0207658_100058499 | 293 |
| 271 | 3300025986 | Ga0207658_10089993 | Ga0207658_100899932 | 293 |
| 272 | 3300025986 | Ga0207658_10104660 | Ga0207658_101046603 | 293 |
| 273 | 3300026023 | Ga0207677_10000395 | Ga0207677_1000039517 | 293 |
| 274 | 3300026023 | Ga0207677_10087400 | Ga0207677_100874003 | 293 |
| 275 | 3300026023 | Ga0207677_10094308 | Ga0207677_100943082 | 293 |
| 276 | 3300026035 | Ga0207703_10012230 | Ga0207703_100122301 | 293 |
| 277 | 3300026078 | Ga0207702_10021255 | Ga0207702_100212553 | 293 |
| 278 | 3300026088 | Ga0207641_10006084 | Ga0207641_100060849 | 293 |
| 279 | 3300026088 | Ga0207641_10044920 | Ga0207641_100449204 | 293 |
| 280 | 3300026089 | Ga0207648_10041222 | Ga0207648_100412224 | 293 |
| 281 | 3300026095 | Ga0207676_10001026 | Ga0207676_1000102613 | 293 |
| 282 | 3300026116 | Ga0207674_10010118 | Ga0207674_100101189 | 293 |
| 283 | 3300026118 | Ga0207675_100025786 | Ga0207675_1000257866 | 293 |
| 284 | 3300026118 | Ga0207675_100309682 | Ga0207675_1003096822 | 293 |
| 285 | 3300026121 | Ga0207683_10001225 | Ga0207683_1000122522 | 293 |
| 286 | 3300026142 | Ga0207698_10477969 | Ga0207698_104779691 | 293 |
| 287 | 3300028379 | Ga0268266_10005648 | Ga0268266_1000564810 | 293 |
| 288 | 3300028379 | Ga0268266_10544288 | Ga0268266_105442882 | 293 |
| 289 | 3300028381 | Ga0268264_10004260 | Ga0268264_100042604 | 293 |
| 290 | 3300028381 | Ga0268264_10174869 | Ga0268264_101748692 | 293 |
| 291 | 3300035083 | Ga0373926_0032886 | Ga0373926_0032886_731_1612 | 293 |
| 292 | 3300035111 | Ga0373923_0007418 | Ga0373923_0007418_2278_3159 | 293 |
| 293 | 3300035118 | Ga0373954_0012955 | Ga0373954_0012955_1245_2126 | 293 |
| 294 | 3300035172 | Ga0373955_0028201 | Ga0373955_0028201_937_1818 | 293 |
| 295 | 3300035172 | Ga0373955_0061871 | Ga0373955_0061871_818_1699 | 293 |
| 296 | 3300035410 | Ga0373924_0017273 | Ga0373924_0017273_58_939 | 293 |
| 297 | 3300035695 | Ga0373927_0070101 | Ga0373927_0070101_492_1373 | 293 |
| 298 | 3300035724 | Ga0373933_0046053 | Ga0373933_0046053_278_1159 | 293 |
| 299 | 3300035724 | Ga0373933_0228326 | Ga0373933_0228326_173_1054 | 293 |
| 300 | 3300036401 | Ga0373937_0310981 | Ga0373937_0310981_132_1019 | 293 |
| 301 | 3300037068 | Ga0373925_0017257 | Ga0373925_0017257_2733_3614 | 293 |
| 302 | 3300037068 | Ga0373925_0027475 | Ga0373925_0027475_617_1504 | 293 |
| 303 | 3300042005 | Ga0439448_0040343 | Ga0439448_0040343_612_1493 | 293 |
| 304 | 3300046472 | Ga0495580_0007298 | Ga0495580_0007298_5853_6755 | 293 |
| 305 | 3300046473 | Ga0495582_0021865 | Ga0495582_0021865_1043_1924 | 293 |
| 306 | 3300046475 | Ga0495639_0057288 | Ga0495639_0057288_349_1230 | 293 |
| 307 | 3300046477 | Ga0495664_0019930 | Ga0495664_0019930_1674_2564 | 293 |
| 308 | 3300046511 | Ga0495608_0264253 | Ga0495608_0264253_107_988 | 293 |
| 309 | 3300046516 | Ga0495628_0192156 | Ga0495628_0192156_423_1313 | 293 |
| 310 | 3300046531 | Ga0495665_0012100 | Ga0495665_0012100_2759_3640 | 293 |
| 311 | 3300046533 | Ga0495640_0168999 | Ga0495640_0168999_268_1149 | 293 |
| 312 | 3300046539 | Ga0495621_0002301 | Ga0495621_0002301_1879_2760 | 293 |
| 313 | 3300046663 | Ga0495635_0002903 | Ga0495635_0002903_5926_6807 | 293 |
| 314 | 3300046675 | Ga0495657_0129632 | Ga0495657_0129632_91_972 | 293 |
| 315 | 3300046681 | Ga0495647_0005522 | Ga0495647_0005522_717_1598 | 293 |
| 316 | 3300046683 | Ga0495658_0066125 | Ga0495658_0066125_220_1101 | 293 |
| 317 | 3300046689 | Ga0495613_0078176 | Ga0495613_0078176_1232_2113 | 293 |
| 318 | 3300046809 | Ga0495600_0139991 | Ga0495600_0139991_362_1243 | 293 |
| 319 | 3300047315 | Ga0495581_0000877 | Ga0495581_0000877_10795_11676 | 293 |
| 320 | 3300047322 | Ga0495680_0178056 | Ga0495680_0178056_255_1136 | 293 |
| 321 | 3300047444 | Ga0495675_0095241 | Ga0495675_0095241_664_1545 | 293 |
| 322 | 3300048089 | Ga0495614_0029641 | Ga0495614_0029641_864_1745 | 293 |
| 323 | 3300048903 | Ga0496100_0101355 | Ga0496100_0101355_1047_1928 | 293 |
| 324 | 3300048904 | Ga0496101_0046735 | Ga0496101_0046735_460_1341 | 293 |
| 325 | 3300048907 | Ga0496104_0020039 | Ga0496104_0020039_1764_2645 | 293 |
| 326 | 3300048909 | Ga0496106_0026769 | Ga0496106_0026769_147_1028 | 293 |
| 327 | 3300048911 | Ga0496108_0194232 | Ga0496108_0194232_622_1503 | 293 |
| 328 | 3300048912 | Ga0496109_0087837 | Ga0496109_0087837_1596_2477 | 293 |
| 329 | 3300048915 | Ga0496112_0019696 | Ga0496112_0019696_1815_2696 | 293 |
| 330 | 3300048918 | Ga0496115_0140125 | Ga0496115_0140125_510_1391 | 293 |
| 331 | 3300050514 | nmdc:mga08x19_35613_c1 | nmdc:mga08x19_35613_c1_449_1336 | 293 |
| 332 | 3300050514 | nmdc:mga08x19_84874_c1 | nmdc:mga08x19_84874_c1_470_1351 | 293 |
| 333 | 3300050515 | nmdc:mga0a205_7849_c2 | nmdc:mga0a205_7849_c2_3509_4396 | 293 |
| 334 | 3300053085 | Ga0495619_0009678 | Ga0495619_0009678_4376_5257 | 293 |
| 335 | 3300005328 | Ga0070676_10000122 | Ga0070676_100001226 | 294 |
| 336 | 3300005331 | Ga0070670_100052303 | Ga0070670_1000523032 | 294 |
| 337 | 3300005333 | Ga0070677_10000198 | Ga0070677_1000019811 | 294 |
| 338 | 3300005335 | Ga0070666_10002386 | Ga0070666_100023869 | 294 |
| 339 | 3300005335 | Ga0070666_10111721 | Ga0070666_101117212 | 294 |
| 340 | 3300005338 | Ga0068868_100001830 | Ga0068868_1000018309 | 294 |
| 341 | 3300005347 | Ga0070668_100003210 | Ga0070668_1000032109 | 294 |
| 342 | 3300005347 | Ga0070668_100015694 | Ga0070668_1000156942 | 294 |
| 343 | 3300005354 | Ga0070675_100000526 | Ga0070675_10000052616 | 294 |
| 344 | 3300005355 | Ga0070671_100013069 | Ga0070671_1000130695 | 294 |
| 345 | 3300005364 | Ga0070673_100003819 | Ga0070673_1000038194 | 294 |
| 346 | 3300005367 | Ga0070667_100000942 | Ga0070667_10000094219 | 294 |
| 347 | 3300005434 | Ga0070709_10329318 | Ga0070709_103293181 | 294 |
| 348 | 3300005455 | Ga0070663_100026977 | Ga0070663_1000269772 | 294 |
| 349 | 3300005456 | Ga0070678_100000351 | Ga0070678_1000003514 | 294 |
| 350 | 3300005457 | Ga0070662_100155600 | Ga0070662_1001556002 | 294 |
| 351 | 3300005457 | Ga0070662_100381032 | Ga0070662_1003810321 | 294 |
| 352 | 3300005458 | Ga0070681_10006101 | Ga0070681_100061016 | 294 |
| 353 | 3300005459 | Ga0068867_100004136 | Ga0068867_1000041367 | 294 |
| 354 | 3300005530 | Ga0070679_100049641 | Ga0070679_1000496412 | 294 |
| 355 | 3300005539 | Ga0068853_100012806 | Ga0068853_1000128066 | 294 |
| 356 | 3300005539 | Ga0068853_100049413 | Ga0068853_1000494132 | 294 |
| 357 | 3300005543 | Ga0070672_100000518 | Ga0070672_10000051815 | 294 |
| 358 | 3300005548 | Ga0070665_100004668 | Ga0070665_10000466811 | 294 |
| 359 | 3300005618 | Ga0068864_100049791 | Ga0068864_1000497912 | 294 |
| 360 | 3300005719 | Ga0068861_100135983 | Ga0068861_1001359832 | 294 |
| 361 | 3300005834 | Ga0068851_10000630 | Ga0068851_1000063010 | 294 |
| 362 | 3300005840 | Ga0068870_10024046 | Ga0068870_100240462 | 294 |
| 363 | 3300005841 | Ga0068863_100021594 | Ga0068863_1000215946 | 294 |
| 364 | 3300005842 | Ga0068858_100004484 | Ga0068858_10000448413 | 294 |
| 365 | 3300005843 | Ga0068860_100008422 | Ga0068860_1000084229 | 294 |
| 366 | 3300006237 | Ga0097621_100021844 | Ga0097621_1000218444 | 294 |
| 367 | 3300006358 | Ga0068871_100005276 | Ga0068871_1000052769 | 294 |
| 368 | 3300006881 | Ga0068865_100050783 | Ga0068865_1000507833 | 294 |
| 369 | 3300013104 | Ga0157370_10265757 | Ga0157370_102657571 | 294 |
| 370 | 3300013296 | Ga0157374_10024529 | Ga0157374_100245295 | 294 |
| 371 | 3300013297 | Ga0157378_10008005 | Ga0157378_100080057 | 294 |
| 372 | 3300013306 | Ga0163162_10060334 | Ga0163162_100603342 | 294 |
| 373 | 3300013307 | Ga0157372_10009553 | Ga0157372_100095535 | 294 |
| 374 | 3300013308 | Ga0157375_10014430 | Ga0157375_100144304 | 294 |
| 375 | 3300014325 | Ga0163163_10015054 | Ga0163163_100150544 | 294 |
| 376 | 3300014968 | Ga0157379_10002330 | Ga0157379_1000233010 | 294 |
| 377 | 3300014969 | Ga0157376_10220029 | Ga0157376_102200292 | 294 |
| 378 | 3300017792 | Ga0163161_10120829 | Ga0163161_101208292 | 294 |
| 379 | 3300025321 | Ga0207656_10001098 | Ga0207656_100010984 | 294 |
| 380 | 3300025893 | Ga0207682_10000078 | Ga0207682_1000007819 | 294 |
| 381 | 3300025903 | Ga0207680_10011741 | Ga0207680_100117414 | 294 |
| 382 | 3300025907 | Ga0207645_10000139 | Ga0207645_1000013937 | 294 |
| 383 | 3300025916 | Ga0207663_10266408 | Ga0207663_102664081 | 294 |
| 384 | 3300025921 | Ga0207652_10043799 | Ga0207652_100437993 | 294 |
| 385 | 3300025925 | Ga0207650_10057043 | Ga0207650_100570433 | 294 |
| 386 | 3300025926 | Ga0207659_10023410 | Ga0207659_100234103 | 294 |
| 387 | 3300025931 | Ga0207644_10015521 | Ga0207644_100155211 | 294 |
| 388 | 3300025933 | Ga0207706_10075986 | Ga0207706_100759862 | 294 |
| 389 | 3300025937 | Ga0207669_10004151 | Ga0207669_100041515 | 294 |
| 390 | 3300025938 | Ga0207704_10024013 | Ga0207704_100240134 | 294 |
| 391 | 3300025940 | Ga0207691_10000040 | Ga0207691_1000004033 | 294 |
| 392 | 3300025941 | Ga0207711_10123889 | Ga0207711_101238891 | 294 |
| 393 | 3300025960 | Ga0207651_10007535 | Ga0207651_100075356 | 294 |
| 394 | 3300025972 | Ga0207668_10016655 | Ga0207668_100166553 | 294 |
| 395 | 3300025972 | Ga0207668_10023002 | Ga0207668_100230022 | 294 |
| 396 | 3300025986 | Ga0207658_10012579 | Ga0207658_100125793 | 294 |
| 397 | 3300025986 | Ga0207658_10018810 | Ga0207658_100188106 | 294 |
| 398 | 3300026023 | Ga0207677_10007177 | Ga0207677_100071774 | 294 |
| 399 | 3300026035 | Ga0207703_10034169 | Ga0207703_100341692 | 294 |
| 400 | 3300026041 | Ga0207639_10017622 | Ga0207639_100176224 | 294 |
| 401 | 3300026067 | Ga0207678_10031953 | Ga0207678_100319536 | 294 |
| 402 | 3300026088 | Ga0207641_10005149 | Ga0207641_100051499 | 294 |
| 403 | 3300026089 | Ga0207648_10005981 | Ga0207648_100059817 | 294 |
| 404 | 3300026095 | Ga0207676_10074551 | Ga0207676_100745512 | 294 |
| 405 | 3300026118 | Ga0207675_100020246 | Ga0207675_1000202466 | 294 |
| 406 | 3300026121 | Ga0207683_10000059 | Ga0207683_1000005938 | 294 |
| 407 | 3300028379 | Ga0268266_10020068 | Ga0268266_100200685 | 294 |
| 408 | 3300028379 | Ga0268266_10244913 | Ga0268266_102449132 | 294 |
| 409 | 3300028381 | Ga0268264_10020915 | Ga0268264_100209154 | 294 |
| 410 | 3300035691 | Ga0373931_0005073 | Ga0373931_0005073_706_1590 | 294 |
| 411 | 3300046460 | Ga0495638_0045596 | Ga0495638_0045596_1268_2152 | 294 |
| 412 | 3300046460 | Ga0495638_0057570 | Ga0495638_0057570_652_1536 | 294 |
| 413 | 3300046492 | Ga0495585_0000183 | Ga0495585_0000183_45783_46679 | 294 |
| 414 | 3300046492 | Ga0495585_0010876 | Ga0495585_0010876_1838_2722 | 294 |
| 415 | 3300046507 | Ga0495606_0006253 | Ga0495606_0006253_776_1660 | 294 |
| 416 | 3300046528 | Ga0495642_0004167 | Ga0495642_0004167_717_1601 | 294 |
| 417 | 3300046528 | Ga0495642_0021154 | Ga0495642_0021154_711_1595 | 294 |
| 418 | 3300046543 | Ga0495645_0071531 | Ga0495645_0071531_118_1017 | 294 |
| 419 | 3300046665 | Ga0495661_0064947 | Ga0495661_0064947_846_1730 | 294 |
| 420 | 3300046679 | Ga0495623_0137887 | Ga0495623_0137887_541_1425 | 294 |
| 421 | 3300047317 | Ga0495604_0029175 | Ga0495604_0029175_1465_2349 | 294 |
| 422 | 3300048090 | Ga0495615_0006487 | Ga0495615_0006487_908_1792 | 294 |
| 423 | 3300048918 | Ga0496115_0006889 | Ga0496115_0006889_1665_2549 | 294 |
| 424 | 3300050492 | nmdc:mga0yw44_46271_c1 | nmdc:mga0yw44_46271_c1_1468_2364 | 297 |
| 425 | 3300005543 | Ga0070672_100026550 | Ga0070672_1000265506 | 299 |
| 426 | 3300005459 | Ga0068867_100007487 | Ga0068867_1000074877 | 300 |
| 427 | 3300005518 | Ga0070699_100186248 | Ga0070699_1001862482 | 300 |
| 428 | 3300005544 | Ga0070686_100000567 | Ga0070686_10000056722 | 300 |
| 429 | 3300005617 | Ga0068859_100311319 | Ga0068859_1003113192 | 300 |
| 430 | 3300005840 | Ga0068870_10027081 | Ga0068870_100270812 | 300 |
| 431 | 3300005842 | Ga0068858_100008247 | Ga0068858_1000082472 | 300 |
| 432 | 3300006844 | Ga0075428_100002681 | Ga0075428_10000268110 | 300 |
| 433 | 3300006846 | Ga0075430_100044747 | Ga0075430_1000447473 | 300 |
| 434 | 3300006880 | Ga0075429_100055891 | Ga0075429_1000558914 | 300 |
| 435 | 3300006881 | Ga0068865_100001499 | Ga0068865_1000014993 | 300 |
| 436 | 3300006931 | Ga0097620_100311320 | Ga0097620_1003113202 | 300 |
| 437 | 3300007076 | Ga0075435_100154580 | Ga0075435_1001545802 | 300 |
| 438 | 3300009093 | Ga0105240_10109143 | Ga0105240_101091433 | 300 |
| 439 | 3300009098 | Ga0105245_10000577 | Ga0105245_1000057726 | 300 |
| 440 | 3300009148 | Ga0105243_10001035 | Ga0105243_100010356 | 300 |
| 441 | 3300013297 | Ga0157378_10003500 | Ga0157378_100035009 | 300 |
| 442 | 3300014325 | Ga0163163_10002600 | Ga0163163_1000260013 | 300 |
| 443 | 3300025908 | Ga0207643_10003122 | Ga0207643_100031227 | 300 |
| 444 | 3300025913 | Ga0207695_10117276 | Ga0207695_101172763 | 300 |
| 445 | 3300025949 | Ga0207667_10046434 | Ga0207667_100464343 | 300 |
| 446 | 3300026035 | Ga0207703_10001683 | Ga0207703_100016832 | 300 |
| 447 | 3300026078 | Ga0207702_10044739 | Ga0207702_100447391 | 300 |
| 448 | 3300026088 | Ga0207641_10067943 | Ga0207641_100679433 | 300 |
| 449 | 3300027907 | Ga0207428_10002668 | Ga0207428_1000266814 | 300 |
| 450 | 3300035692 | Ga0373935_0084733 | Ga0373935_0084733_381_1289 | 300 |
| 451 | 3300035724 | Ga0373933_0268493 | Ga0373933_0268493_31_939 | 300 |
| 452 | 3300049570 | Ga0501033_0066257 | Ga0501033_0066257_909_1823 | 300 |
| 453 | 3300049571 | Ga0501034_0153436 | Ga0501034_0153436_1268_2173 | 300 |
| 454 | 3300049575 | Ga0501039_0000901 | Ga0501039_0000901_12577_13491 | 300 |
| 455 | 3300049576 | Ga0501040_0089042 | Ga0501040_0089042_1019_1933 | 300 |
| 456 | 3300049577 | Ga0501041_0007189 | Ga0501041_0007189_1795_2709 | 300 |
| 457 | 3300049578 | Ga0501042_0008620 | Ga0501042_0008620_5656_6570 | 300 |
| 458 | 3300049580 | Ga0501046_0151018 | Ga0501046_0151018_753_1667 | 300 |
| 459 | 3300049582 | Ga0501048_0094128 | Ga0501048_0094128_1042_1956 | 300 |
| 460 | 3300049587 | Ga0501071_0022730 | Ga0501071_0022730_368_1282 | 300 |
| 461 | 3300049591 | Ga0501075_0019282 | Ga0501075_0019282_440_1354 | 300 |
| 462 | 3300049592 | Ga0501076_0000468 | Ga0501076_0000468_9661_10575 | 300 |
| 463 | 3300049741 | Ga0501079_0014141 | Ga0501079_0014141_4450_5364 | 300 |
| 464 | 3300049742 | Ga0501080_0010515 | Ga0501080_0010515_6340_7254 | 300 |
| 465 | 3300049743 | Ga0501081_0000619 | Ga0501081_0000619_12897_13811 | 300 |
| 466 | 3300049824 | Ga0501045_0042010 | Ga0501045_0042010_2089_3003 | 300 |
| 467 | 3300050509 | nmdc:mga0qj67_63803_c1 | nmdc:mga0qj67_63803_c1_95_1009 | 300 |
| 468 | 3300050511 | nmdc:mga08y16_309869_c1 | nmdc:mga08y16_309869_c1_254_1168 | 300 |
| 469 | 3300053098 | Ga0500650_0063687 | Ga0500650_0063687_609_1514 | 300 |
| 470 | 3300054114 | Ga0501084_0028010 | Ga0501084_0028010_3241_4155 | 300 |
| 471 | 3300060353 | Ga0501082_0002263 | Ga0501082_0002263_10936_11850 | 300 |
| 472 | 3300005335 | Ga0070666_10078321 | Ga0070666_100783213 | 301 |
| 473 | 3300005456 | Ga0070678_100005593 | Ga0070678_1000055937 | 301 |
| 474 | 3300005548 | Ga0070665_100016453 | Ga0070665_1000164535 | 301 |
| 475 | 3300005843 | Ga0068860_100063817 | Ga0068860_1000638172 | 301 |
| 476 | 3300014969 | Ga0157376_10010402 | Ga0157376_100104025 | 301 |
| 477 | 3300025903 | Ga0207680_10008989 | Ga0207680_100089892 | 301 |
| 478 | 3300026121 | Ga0207683_10001439 | Ga0207683_1000143918 | 301 |
| 479 | 3300005327 | Ga0070658_10035996 | Ga0070658_100359962 | 302 |
| 480 | 3300005328 | Ga0070676_10042311 | Ga0070676_100423113 | 302 |
| 481 | 3300005328 | Ga0070676_10138217 | Ga0070676_101382172 | 302 |
| 482 | 3300005329 | Ga0070683_100006372 | Ga0070683_1000063728 | 302 |
| 483 | 3300005329 | Ga0070683_100031130 | Ga0070683_1000311306 | 302 |
| 484 | 3300005329 | Ga0070683_100067797 | Ga0070683_1000677972 | 302 |
| 485 | 3300005330 | Ga0070690_100010115 | Ga0070690_1000101157 | 302 |
| 486 | 3300005331 | Ga0070670_100103301 | Ga0070670_1001033012 | 302 |
| 487 | 3300005331 | Ga0070670_100201903 | Ga0070670_1002019031 | 302 |
| 488 | 3300005333 | Ga0070677_10014858 | Ga0070677_100148582 | 302 |
| 489 | 3300005334 | Ga0068869_100032922 | Ga0068869_1000329224 | 302 |
| 490 | 3300005334 | Ga0068869_100140270 | Ga0068869_1001402702 | 302 |
| 491 | 3300005335 | Ga0070666_10072266 | Ga0070666_100722663 | 302 |
| 492 | 3300005338 | Ga0068868_100135471 | Ga0068868_1001354712 | 302 |
| 493 | 3300005339 | Ga0070660_100039103 | Ga0070660_1000391032 | 302 |
| 494 | 3300005340 | Ga0070689_100028222 | Ga0070689_1000282226 | 302 |
| 495 | 3300005343 | Ga0070687_100043468 | Ga0070687_1000434682 | 302 |
| 496 | 3300005344 | Ga0070661_100005534 | Ga0070661_1000055344 | 302 |
| 497 | 3300005344 | Ga0070661_100066443 | Ga0070661_1000664432 | 302 |
| 498 | 3300005344 | Ga0070661_100123918 | Ga0070661_1001239182 | 302 |
| 499 | 3300005345 | Ga0070692_10016975 | Ga0070692_100169752 | 302 |
| 500 | 3300005353 | Ga0070669_100050083 | Ga0070669_1000500832 | 302 |
| 501 | 3300005354 | Ga0070675_100048168 | Ga0070675_1000481683 | 302 |
| 502 | 3300005354 | Ga0070675_100246507 | Ga0070675_1002465072 | 302 |
| 503 | 3300005355 | Ga0070671_100032665 | Ga0070671_1000326654 | 302 |
| 504 | 3300005355 | Ga0070671_100113830 | Ga0070671_1001138302 | 302 |
| 505 | 3300005365 | Ga0070688_100024345 | Ga0070688_1000243452 | 302 |
| 506 | 3300005366 | Ga0070659_100012612 | Ga0070659_1000126123 | 302 |
| 507 | 3300005434 | Ga0070709_10060769 | Ga0070709_100607692 | 302 |
| 508 | 3300005437 | Ga0070710_10158256 | Ga0070710_101582562 | 302 |
| 509 | 3300005438 | Ga0070701_10091983 | Ga0070701_100919832 | 302 |
| 510 | 3300005441 | Ga0070700_100025478 | Ga0070700_1000254782 | 302 |
| 511 | 3300005455 | Ga0070663_100073688 | Ga0070663_1000736883 | 302 |
| 512 | 3300005458 | Ga0070681_10144404 | Ga0070681_101444041 | 302 |
| 513 | 3300005466 | Ga0070685_10041500 | Ga0070685_100415003 | 302 |
| 514 | 3300005518 | Ga0070699_100079095 | Ga0070699_1000790953 | 302 |
| 515 | 3300005530 | Ga0070679_100063137 | Ga0070679_1000631374 | 302 |
| 516 | 3300005530 | Ga0070679_100090121 | Ga0070679_1000901211 | 302 |
| 517 | 3300005530 | Ga0070679_100116914 | Ga0070679_1001169143 | 302 |
| 518 | 3300005535 | Ga0070684_100005461 | Ga0070684_1000054612 | 302 |
| 519 | 3300005535 | Ga0070684_100022585 | Ga0070684_1000225852 | 302 |
| 520 | 3300005539 | Ga0068853_100019887 | Ga0068853_1000198873 | 302 |
| 521 | 3300005539 | Ga0068853_100138755 | Ga0068853_1001387552 | 302 |
| 522 | 3300005548 | Ga0070665_100126390 | Ga0070665_1001263902 | 302 |
| 523 | 3300005548 | Ga0070665_100229541 | Ga0070665_1002295412 | 302 |
| 524 | 3300005563 | Ga0068855_100092597 | Ga0068855_1000925971 | 302 |
| 525 | 3300005564 | Ga0070664_100043363 | Ga0070664_1000433633 | 302 |
| 526 | 3300005564 | Ga0070664_100055612 | Ga0070664_1000556123 | 302 |
| 527 | 3300005564 | Ga0070664_100063023 | Ga0070664_1000630233 | 302 |
| 528 | 3300005577 | Ga0068857_100127113 | Ga0068857_1001271132 | 302 |
| 529 | 3300005578 | Ga0068854_100021151 | Ga0068854_1000211514 | 302 |
| 530 | 3300005578 | Ga0068854_100033312 | Ga0068854_1000333122 | 302 |
| 531 | 3300005614 | Ga0068856_100005096 | Ga0068856_10000509612 | 302 |
| 532 | 3300005614 | Ga0068856_100156590 | Ga0068856_1001565902 | 302 |
| 533 | 3300005615 | Ga0070702_100001177 | Ga0070702_10000117711 | 302 |
| 534 | 3300005616 | Ga0068852_100008165 | Ga0068852_1000081657 | 302 |
| 535 | 3300005616 | Ga0068852_100515901 | Ga0068852_1005159011 | 302 |
| 536 | 3300005617 | Ga0068859_100099642 | Ga0068859_1000996423 | 302 |
| 537 | 3300005618 | Ga0068864_100093271 | Ga0068864_1000932712 | 302 |
| 538 | 3300005718 | Ga0068866_10018639 | Ga0068866_100186393 | 302 |
| 539 | 3300005719 | Ga0068861_100014407 | Ga0068861_1000144072 | 302 |
| 540 | 3300005834 | Ga0068851_10008701 | Ga0068851_100087015 | 302 |
| 541 | 3300005834 | Ga0068851_10019037 | Ga0068851_100190372 | 302 |
| 542 | 3300005840 | Ga0068870_10074719 | Ga0068870_100747192 | 302 |
| 543 | 3300005843 | Ga0068860_100214407 | Ga0068860_1002144072 | 302 |
| 544 | 3300005844 | Ga0068862_100031244 | Ga0068862_1000312442 | 302 |
| 545 | 3300006173 | Ga0070716_100324360 | Ga0070716_1003243601 | 302 |
| 546 | 3300006237 | Ga0097621_100147409 | Ga0097621_1001474092 | 302 |
| 547 | 3300006881 | Ga0068865_100110970 | Ga0068865_1001109702 | 302 |
| 548 | 3300006914 | Ga0075436_100087423 | Ga0075436_1000874233 | 302 |
| 549 | 3300006914 | Ga0075436_100156812 | Ga0075436_1001568122 | 302 |
| 550 | 3300006931 | Ga0097620_100099631 | Ga0097620_1000996313 | 302 |
| 551 | 3300009093 | Ga0105240_10009886 | Ga0105240_1000988610 | 302 |
| 552 | 3300009093 | Ga0105240_10013824 | Ga0105240_1001382411 | 302 |
| 553 | 3300009094 | Ga0111539_10012858 | Ga0111539_100128586 | 302 |
| 554 | 3300009098 | Ga0105245_10085625 | Ga0105245_100856251 | 302 |
| 555 | 3300009148 | Ga0105243_10208908 | Ga0105243_102089082 | 302 |
| 556 | 3300009174 | Ga0105241_10007912 | Ga0105241_100079123 | 302 |
| 557 | 3300009174 | Ga0105241_10478785 | Ga0105241_104787851 | 302 |
| 558 | 3300009176 | Ga0105242_10212304 | Ga0105242_102123042 | 302 |
| 559 | 3300009177 | Ga0105248_10011849 | Ga0105248_100118499 | 302 |
| 560 | 3300009545 | Ga0105237_10047979 | Ga0105237_100479793 | 302 |
| 561 | 3300009545 | Ga0105237_10095930 | Ga0105237_100959302 | 302 |
| 562 | 3300009545 | Ga0105237_10425134 | Ga0105237_104251341 | 302 |
| 563 | 3300009551 | Ga0105238_10046317 | Ga0105238_100463174 | 302 |
| 564 | 3300009553 | Ga0105249_10018015 | Ga0105249_100180156 | 302 |
| 565 | 3300010375 | Ga0105239_10021034 | Ga0105239_100210347 | 302 |
| 566 | 3300013102 | Ga0157371_10058932 | Ga0157371_100589322 | 302 |
| 567 | 3300013102 | Ga0157371_10164120 | Ga0157371_101641202 | 302 |
| 568 | 3300013104 | Ga0157370_10023604 | Ga0157370_100236042 | 302 |
| 569 | 3300013104 | Ga0157370_10232186 | Ga0157370_102321862 | 302 |
| 570 | 3300013105 | Ga0157369_10144654 | Ga0157369_101446542 | 302 |
| 571 | 3300013296 | Ga0157374_10062777 | Ga0157374_100627772 | 302 |
| 572 | 3300013296 | Ga0157374_10126570 | Ga0157374_101265702 | 302 |
| 573 | 3300013307 | Ga0157372_10047798 | Ga0157372_100477982 | 302 |
| 574 | 3300013307 | Ga0157372_10050509 | Ga0157372_100505093 | 302 |
| 575 | 3300013307 | Ga0157372_10190453 | Ga0157372_101904532 | 302 |
| 576 | 3300013307 | Ga0157372_10224984 | Ga0157372_102249841 | 302 |
| 577 | 3300013307 | Ga0157372_10468728 | Ga0157372_104687282 | 302 |
| 578 | 3300013308 | Ga0157375_10007014 | Ga0157375_100070146 | 302 |
| 579 | 3300014325 | Ga0163163_10230113 | Ga0163163_102301132 | 302 |
| 580 | 3300014326 | Ga0157380_10056834 | Ga0157380_100568343 | 302 |
| 581 | 3300014968 | Ga0157379_10014911 | Ga0157379_100149116 | 302 |
| 582 | 3300014969 | Ga0157376_10015366 | Ga0157376_100153662 | 302 |
| 583 | 3300020070 | Ga0206356_10058451 | Ga0206356_100584512 | 302 |
| 584 | 3300025271 | Ga0207666_1001100 | Ga0207666_10011004 | 302 |
| 585 | 3300025290 | Ga0207673_1000515 | Ga0207673_10005152 | 302 |
| 586 | 3300025315 | Ga0207697_10000008 | Ga0207697_1000000828 | 302 |
| 587 | 3300025321 | Ga0207656_10007827 | Ga0207656_100078273 | 302 |
| 588 | 3300025893 | Ga0207682_10000117 | Ga0207682_1000011732 | 302 |
| 589 | 3300025898 | Ga0207692_10080625 | Ga0207692_100806252 | 302 |
| 590 | 3300025899 | Ga0207642_10024182 | Ga0207642_100241822 | 302 |
| 591 | 3300025901 | Ga0207688_10002921 | Ga0207688_100029216 | 302 |
| 592 | 3300025907 | Ga0207645_10002794 | Ga0207645_100027947 | 302 |
| 593 | 3300025908 | Ga0207643_10000089 | Ga0207643_1000008910 | 302 |
| 594 | 3300025909 | Ga0207705_10026936 | Ga0207705_100269363 | 302 |
| 595 | 3300025912 | Ga0207707_10005597 | Ga0207707_100055979 | 302 |
| 596 | 3300025912 | Ga0207707_10009551 | Ga0207707_100095516 | 302 |
| 597 | 3300025913 | Ga0207695_10029445 | Ga0207695_100294456 | 302 |
| 598 | 3300025913 | Ga0207695_10031252 | Ga0207695_100312523 | 302 |
| 599 | 3300025914 | Ga0207671_10056495 | Ga0207671_100564952 | 302 |
| 600 | 3300025914 | Ga0207671_10449201 | Ga0207671_104492011 | 302 |
| 601 | 3300025915 | Ga0207693_10127184 | Ga0207693_101271842 | 302 |
| 602 | 3300025918 | Ga0207662_10007173 | Ga0207662_100071732 | 302 |
| 603 | 3300025919 | Ga0207657_10000240 | Ga0207657_1000024010 | 302 |
| 604 | 3300025919 | Ga0207657_10039050 | Ga0207657_100390504 | 302 |
| 605 | 3300025920 | Ga0207649_10010697 | Ga0207649_100106975 | 302 |
| 606 | 3300025920 | Ga0207649_10010878 | Ga0207649_100108783 | 302 |
| 607 | 3300025921 | Ga0207652_10007096 | Ga0207652_100070967 | 302 |
| 608 | 3300025921 | Ga0207652_10009720 | Ga0207652_100097202 | 302 |
| 609 | 3300025923 | Ga0207681_10041160 | Ga0207681_100411603 | 302 |
| 610 | 3300025924 | Ga0207694_10022444 | Ga0207694_100224446 | 302 |
| 611 | 3300025925 | Ga0207650_10015761 | Ga0207650_100157614 | 302 |
| 612 | 3300025926 | Ga0207659_10005051 | Ga0207659_100050516 | 302 |
| 613 | 3300025926 | Ga0207659_10047517 | Ga0207659_100475172 | 302 |
| 614 | 3300025929 | Ga0207664_10009563 | Ga0207664_100095632 | 302 |
| 615 | 3300025931 | Ga0207644_10009740 | Ga0207644_100097404 | 302 |
| 616 | 3300025931 | Ga0207644_10024382 | Ga0207644_100243824 | 302 |
| 617 | 3300025932 | Ga0207690_10109872 | Ga0207690_101098722 | 302 |
| 618 | 3300025933 | Ga0207706_10000456 | Ga0207706_1000045641 | 302 |
| 619 | 3300025934 | Ga0207686_10110601 | Ga0207686_101106012 | 302 |
| 620 | 3300025936 | Ga0207670_10130384 | Ga0207670_101303842 | 302 |
| 621 | 3300025939 | Ga0207665_10029662 | Ga0207665_100296624 | 302 |
| 622 | 3300025941 | Ga0207711_10004590 | Ga0207711_100045906 | 302 |
| 623 | 3300025942 | Ga0207689_10001313 | Ga0207689_100013138 | 302 |
| 624 | 3300025944 | Ga0207661_10035054 | Ga0207661_100350543 | 302 |
| 625 | 3300025944 | Ga0207661_10119628 | Ga0207661_101196282 | 302 |
| 626 | 3300025944 | Ga0207661_10291948 | Ga0207661_102919482 | 302 |
| 627 | 3300025945 | Ga0207679_10030342 | Ga0207679_100303423 | 302 |
| 628 | 3300025945 | Ga0207679_10066160 | Ga0207679_100661603 | 302 |
| 629 | 3300025945 | Ga0207679_10066682 | Ga0207679_100666822 | 302 |
| 630 | 3300025949 | Ga0207667_10007251 | Ga0207667_100072515 | 302 |
| 631 | 3300025949 | Ga0207667_10085333 | Ga0207667_100853334 | 302 |
| 632 | 3300025949 | Ga0207667_10129035 | Ga0207667_101290353 | 302 |
| 633 | 3300025960 | Ga0207651_10061490 | Ga0207651_100614902 | 302 |
| 634 | 3300025960 | Ga0207651_10096875 | Ga0207651_100968752 | 302 |
| 635 | 3300025981 | Ga0207640_10052028 | Ga0207640_100520283 | 302 |
| 636 | 3300025981 | Ga0207640_10058583 | Ga0207640_100585833 | 302 |
| 637 | 3300025986 | Ga0207658_10075987 | Ga0207658_100759872 | 302 |
| 638 | 3300026023 | Ga0207677_10063315 | Ga0207677_100633153 | 302 |
| 639 | 3300026035 | Ga0207703_10104793 | Ga0207703_101047932 | 302 |
| 640 | 3300026041 | Ga0207639_10056721 | Ga0207639_100567213 | 302 |
| 641 | 3300026067 | Ga0207678_10002147 | Ga0207678_100021473 | 302 |
| 642 | 3300026067 | Ga0207678_10011219 | Ga0207678_100112196 | 302 |
| 643 | 3300026067 | Ga0207678_10198229 | Ga0207678_101982292 | 302 |
| 644 | 3300026075 | Ga0207708_10007905 | Ga0207708_100079057 | 302 |
| 645 | 3300026078 | Ga0207702_10046379 | Ga0207702_100463794 | 302 |
| 646 | 3300026078 | Ga0207702_10148459 | Ga0207702_101484592 | 302 |
| 647 | 3300026088 | Ga0207641_10356311 | Ga0207641_103563111 | 302 |
| 648 | 3300026089 | Ga0207648_10001517 | Ga0207648_1000151717 | 302 |
| 649 | 3300026095 | Ga0207676_10065012 | Ga0207676_100650123 | 302 |
| 650 | 3300026116 | Ga0207674_10000974 | Ga0207674_1000097427 | 302 |
| 651 | 3300026116 | Ga0207674_10002009 | Ga0207674_1000200913 | 302 |
| 652 | 3300026121 | Ga0207683_10005472 | Ga0207683_100054725 | 302 |
| 653 | 3300026142 | Ga0207698_10015380 | Ga0207698_100153804 | 302 |
| 654 | 3300026142 | Ga0207698_10024627 | Ga0207698_100246274 | 302 |
| 655 | 3300027462 | Ga0210000_1004354 | Ga0210000_10043542 | 302 |
| 656 | 3300027552 | Ga0209982_1006994 | Ga0209982_10069942 | 302 |
| 657 | 3300027617 | Ga0210002_1017817 | Ga0210002_10178171 | 302 |
| 658 | 3300027717 | Ga0209998_10002472 | Ga0209998_100024722 | 302 |
| 659 | 3300027876 | Ga0209974_10001154 | Ga0209974_100011548 | 302 |
| 660 | 3300028379 | Ga0268266_10136609 | Ga0268266_101366092 | 302 |
| 661 | 3300035118 | Ga0373954_0188308 | Ga0373954_0188308_44_952 | 302 |
| 662 | 3300035120 | Ga0373957_0007641 | Ga0373957_0007641_204_1112 | 302 |
| 663 | 3300035695 | Ga0373927_0141833 | Ga0373927_0141833_31_939 | 302 |
| 664 | 3300035725 | Ga0373947_0047985 | Ga0373947_0047985_359_1267 | 302 |
| 665 | 3300041512 | Ga0451853_1015325 | Ga0451853_1015325_539_1450 | 302 |
| 666 | 3300045976 | Ga0466967_0196621 | Ga0466967_0196621_365_1273 | 302 |
| 667 | 3300046455 | Ga0495603_0239913 | Ga0495603_0239913_46_954 | 302 |
| 668 | 3300046459 | Ga0495629_0140560 | Ga0495629_0140560_415_1323 | 302 |
| 669 | 3300046537 | Ga0495598_0008674 | Ga0495598_0008674_53_961 | 302 |
| 670 | 3300048905 | Ga0496102_0289759 | Ga0496102_0289759_490_1464 | 302 |
| 671 | 3300048906 | Ga0496103_0105954 | Ga0496103_0105954_94_1002 | 302 |
| 672 | 3300048907 | Ga0496104_0241354 | Ga0496104_0241354_568_1476 | 302 |
| 673 | 3300048908 | Ga0496105_0003430 | Ga0496105_0003430_10075_10983 | 302 |
| 674 | 3300048909 | Ga0496106_0031246 | Ga0496106_0031246_1994_2902 | 302 |
| 675 | 3300048910 | Ga0496107_0062535 | Ga0496107_0062535_282_1190 | 302 |
| 676 | 3300048912 | Ga0496109_0013547 | Ga0496109_0013547_5546_6454 | 302 |
| 677 | 3300048912 | Ga0496109_0055446 | Ga0496109_0055446_1227_2201 | 302 |
| 678 | 3300048913 | Ga0496110_0015445 | Ga0496110_0015445_245_1153 | 302 |
| 679 | 3300048918 | Ga0496115_0174452 | Ga0496115_0174452_669_1577 | 302 |
| 680 | 3300050514 | nmdc:mga08x19_76133_c1 | nmdc:mga08x19_76133_c1_1207_2115 | 302 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6mqh-assembly1.cif.gz_A | crystal structure of 4-hydroxy-tetrahydrodipicolinate synthase (htpa synthase) from burkholderia mallei | 0.981 | 1 | 293 |
| 6p90-assembly1.cif.gz_B | crystal structure of padhdps2-h56q mutant | 0.98 | 1 | 293 |
| 3qze-assembly2.cif.gz_D | crystal structure of dapa (pa1010) at 1.6 a resolution | 0.9788 | 3 | 293 |
| 3noe-assembly1.cif.gz_A | crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa | 0.9786 | 1 | 294 |
| 3pud-assembly1.cif.gz_A | crystal structure of dhydrodipicolinate synthase from acinetobacter baumannii at 2.8a resolution | 0.9785 | 1 | 293 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6nvaA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9732 | 3 | 293 | 3.20.20.70 |
| 2rfgB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9716 | 1 | 289 | 3.20.20.70 |
| 3di0A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9664 | 3 | 290 | 3.20.20.70 |
| 3a5fA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9657 | 3 | 293 | 3.20.20.70 |
| 2yxgD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9645 | 3 | 293 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K2AWC9-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate synthase | 0.9853 | 183 | 290 |
GO:0005829
GO:0008840 |
| AF-A0A7R6PD14-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) | 0.9844 | 7 | 293 |
GO:0005829
GO:0008840 GO:0009089 GO:0019877 |
| AF-A0A2T5K103-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) | 0.983 | 2 | 291 |
GO:0005829
GO:0008840 GO:0009089 GO:0019877 |
| AF-A0A7V1PHF2-F1-model_v4 | N-acetylneuraminate lyase (EC 4.1.3.3) | 0.9829 | 1 | 107 |
GO:0005829
GO:0008747 GO:0008840 GO:0019262 |
| AF-A0A521ZAB2-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) | 0.9823 | 1 | 294 |
GO:0005829
GO:0008840 GO:0009089 GO:0019877 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar