F474644

General Info

Members Datasets Scaffolds Average Seq Length
678 343 1356 123

Family's Representative Sequence

Representative Sequence 3300006178|Ga0075367_10449480|Ga0075367_104494802
Length 134
Sequence MVIRSEADGFAMRRRLKNFLPIVLIALVVQIFAPIGACWAASIAASDPLAGAVICHGNGAPGAGQADQTGHRAHDGCCSVCSVLQTGAPVDVPQIAAIHVDRVAERVAWFDFAFRLTNARAGSHAQARAPPSIS

Samples

Sample ID Description Type Environment
1 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
167 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
184 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
185 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
186 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
187 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
188 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
198 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
199 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
200 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
201 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
202 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
203 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
204 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
205 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
206 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
207 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
208 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
209 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
214 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
225 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
226 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
227 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
228 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
229 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
232 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
233 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
234 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
235 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
236 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
237 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
238 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
239 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
240 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
241 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
242 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
246 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
247 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
248 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
249 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
250 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
251 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
258 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
259 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
260 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
261 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
262 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
263 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
264 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
284 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
285 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
286 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
287 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
288 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
289 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
292 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
293 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
294 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
295 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
296 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
297 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
298 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
299 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
300 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
303 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
304 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
305 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
306 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
307 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
308 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
309 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
310 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
311 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
312 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
313 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
314 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
315 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
316 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
317 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
318 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
319 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
320 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
321 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
322 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
323 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
324 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
325 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
326 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
327 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
328 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
329 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
330 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
333 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
334 2791355199
335 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
336 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
337 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
338 2904699407
339 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
340 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
341 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
342 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
343 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0
Isolates 1.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.95
Nodule 1.03
Rhizoplane 10.47
Rhizosphere 71.39
Stem 0
Stem Tuber 0
Unclassified 1.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075367_10449480 3300006178 Bacteria 816
2 JGI24740J21852_10073634 3300001979 Bacteria 909
3 JGI25153J46596_10005083 3300003215 Bacteria 6954
4 rootH2_10213342 3300003320 Bacteria 1839
5 rootL2_10055011 3300003322 Bacteria 1806
6 rootL2_10055012 3300003322 Bacteria 2020
7 Ga0065704_10315572 3300005289 Bacteria 859
8 Ga0070658_10238179 3300005327 Bacteria 1542
9 Ga0070658_10646130 3300005327 Bacteria 918
10 Ga0070676_11592615 3300005328 Bacteria 504
11 Ga0070683_101400783 3300005329 Bacteria 672
12 Ga0070670_100169189 3300005331 Bacteria 1895
13 Ga0070670_100662370 3300005331 Bacteria 937
14 Ga0070677_10292180 3300005333 Bacteria 825
15 Ga0068869_100056396 3300005334 Bacteria 2865
16 Ga0068869_100399262 3300005334 Bacteria 1130
17 Ga0068869_102080934 3300005334 Bacteria 510
18 Ga0070680_100095798 3300005336 Bacteria 2461
19 Ga0070680_100435184 3300005336 Bacteria 1120
20 Ga0070682_100080269 3300005337 Bacteria 2109
21 Ga0070682_100681493 3300005337 Bacteria 822
22 Ga0068868_100019185 3300005338 Bacteria 5123
23 Ga0068868_100165966 3300005338 Bacteria 1826
24 Ga0068868_100630451 3300005338 Bacteria 953
25 Ga0068868_101006798 3300005338 Bacteria 762
26 Ga0070691_10420788 3300005341 Bacteria 757
27 Ga0070687_100840738 3300005343 Bacteria 654
28 Ga0070687_101265180 3300005343 Bacteria 547
29 Ga0070661_100099518 3300005344 Bacteria 2161
30 Ga0070661_100255312 3300005344 Bacteria 1354
31 Ga0070661_100341015 3300005344 Bacteria 1174
32 Ga0070692_10928493 3300005345 Bacteria 604
33 Ga0070668_100051506 3300005347 Bacteria 3172
34 Ga0070668_100415925 3300005347 Bacteria 1150
35 Ga0070669_100259041 3300005353 Bacteria 1387
36 Ga0070671_100375662 3300005355 Bacteria 1214
37 Ga0070671_100455655 3300005355 Bacteria 1097
38 Ga0070671_100770847 3300005355 Bacteria 837
39 Ga0070674_100077072 3300005356 Bacteria 2372
40 Ga0070674_100148910 3300005356 Bacteria 1764
41 Ga0070688_101400669 3300005365 Bacteria 567
42 Ga0070659_100170100 3300005366 Bacteria 1784
43 Ga0070667_100383102 3300005367 Bacteria 1278
44 Ga0070667_100873358 3300005367 Bacteria 836
45 Ga0070667_101024167 3300005367 Bacteria 771
46 Ga0070667_101243743 3300005367 Bacteria 697
47 Ga0070709_10565122 3300005434 Bacteria 872
48 Ga0070709_11224339 3300005434 Bacteria 604
49 Ga0070701_10439918 3300005438 Bacteria 835
50 Ga0070701_10809885 3300005438 Bacteria 639
51 Ga0070700_100005487 3300005441 Bacteria 6728
52 Ga0070663_100020471 3300005455 Bacteria 4381
53 Ga0070663_100057168 3300005455 Bacteria 2797
54 Ga0070663_100071881 3300005455 Bacteria 2519
55 Ga0070663_100154254 3300005455 Bacteria 1763
56 Ga0070678_100009855 3300005456 Bacteria 5808
57 Ga0070678_100047937 3300005456 Bacteria 3073
58 Ga0070678_101024444 3300005456 Bacteria 760
59 Ga0070662_100199568 3300005457 Bacteria 1586
60 Ga0070662_100335662 3300005457 Bacteria 1235
61 Ga0070662_100774402 3300005457 Bacteria 815
62 Ga0068867_100079211 3300005459 Bacteria 2472
63 Ga0068867_101021989 3300005459 Bacteria 751
64 Ga0068867_101119173 3300005459 Bacteria 720
65 Ga0070685_10938046 3300005466 Bacteria 646
66 Ga0070698_100165645 3300005471 Bacteria 2153
67 Ga0070698_100876976 3300005471 Bacteria 843
68 Ga0070699_100066644 3300005518 Bacteria 3126
69 Ga0070684_100417636 3300005535 Bacteria 1238
70 Ga0068853_100044516 3300005539 Bacteria 3799
71 Ga0068853_100214524 3300005539 Bacteria 1755
72 Ga0068853_100407473 3300005539 Bacteria 1273
73 Ga0068853_100422784 3300005539 Bacteria 1250
74 Ga0068853_100543779 3300005539 Bacteria 1100
75 Ga0068853_101335675 3300005539 Bacteria 693
76 Ga0070672_100072157 3300005543 Bacteria 2749
77 Ga0070686_100118031 3300005544 Bacteria 1818
78 Ga0070686_100613568 3300005544 Bacteria 858
79 Ga0070686_100822578 3300005544 Bacteria 750
80 Ga0070695_100191895 3300005545 Bacteria 1454
81 Ga0070696_100328616 3300005546 Bacteria 1179
82 Ga0070665_100035183 3300005548 Bacteria 5036
83 Ga0070665_100041041 3300005548 Bacteria 4650
84 Ga0070665_100060805 3300005548 Bacteria 3787
85 Ga0070665_100381389 3300005548 Bacteria 1417
86 Ga0070665_100491853 3300005548 Bacteria 1238
87 Ga0070665_100573231 3300005548 Bacteria 1141
88 Ga0070665_100640956 3300005548 Bacteria 1075
89 Ga0068855_100025716 3300005563 Bacteria 7040
90 Ga0068855_100119614 3300005563 Bacteria 3016
91 Ga0068855_101721295 3300005563 Bacteria 639
92 Ga0070664_100556735 3300005564 Bacteria 1060
93 Ga0070664_100764178 3300005564 Bacteria 902
94 Ga0068857_100151860 3300005577 Bacteria 2099
95 Ga0068854_100151364 3300005578 Bacteria 1789
96 Ga0068854_100310478 3300005578 Bacteria 1279
97 Ga0068854_100337646 3300005578 Bacteria 1229
98 Ga0068854_100926281 3300005578 Bacteria 767
99 Ga0068856_100060128 3300005614 Bacteria 3754
100 Ga0068856_100767783 3300005614 Bacteria 984
101 Ga0068856_101256627 3300005614 Bacteria 756
102 Ga0068852_100155737 3300005616 Bacteria 2128
103 Ga0068852_100301204 3300005616 Bacteria 1552
104 Ga0068859_100089045 3300005617 Bacteria 3136
105 Ga0068859_101361542 3300005617 Bacteria 782
106 Ga0068859_102247641 3300005617 Bacteria 602
107 Ga0068864_100016149 3300005618 Bacteria 6213
108 Ga0068864_101776233 3300005618 Bacteria 622
109 Ga0068866_10204182 3300005718 Bacteria 1182
110 Ga0068866_10871291 3300005718 Bacteria 631
111 Ga0068861_100048005 3300005719 Bacteria 3225
112 Ga0068861_100054501 3300005719 Bacteria 3046
113 Ga0068861_100318030 3300005719 Bacteria 1355
114 Ga0068861_100340447 3300005719 Bacteria 1312
115 Ga0068861_100882303 3300005719 Bacteria 846
116 Ga0068870_10088743 3300005840 Bacteria 1724
117 Ga0068870_10099486 3300005840 Bacteria 1641
118 Ga0068863_100112612 3300005841 Bacteria 2591
119 Ga0068863_100828350 3300005841 Bacteria 923
120 Ga0068858_100331769 3300005842 Bacteria 1455
121 Ga0068858_100864543 3300005842 Bacteria 883
122 Ga0068858_100930518 3300005842 Bacteria 850
123 Ga0068858_101447598 3300005842 Bacteria 677
124 Ga0068858_102050526 3300005842 Bacteria 565
125 Ga0068860_100135526 3300005843 Bacteria 2364
126 Ga0068860_100374104 3300005843 Bacteria 1405
127 Ga0068862_100138415 3300005844 Bacteria 2159
128 Ga0068862_100210791 3300005844 Bacteria 1755
129 Ga0068862_100851416 3300005844 Bacteria 893
130 Ga0068862_101891905 3300005844 Bacteria 607
131 Ga0081455_10007002 3300005937 Bacteria 11982
132 Ga0081455_10430204 3300005937 Bacteria 908
133 Ga0081455_10536900 3300005937 Bacteria 777
134 Ga0081538_10112350 3300005981 Bacteria 1334
135 Ga0081540_1003669 3300005983 Bacteria 12044
136 Ga0081540_1018032 3300005983 Bacteria 4346
137 Ga0081540_1040751 3300005983 Bacteria 2417
138 Ga0081540_1275413 3300005983 Bacteria 582
139 Ga0081539_10015987 3300005985 Bacteria 5404
140 Ga0081539_10074235 3300005985 Bacteria 1812
141 Ga0070717_10440889 3300006028 Bacteria 1173
142 Ga0075365_10037571 3300006038 Bacteria 3145
143 Ga0075365_10107814 3300006038 Bacteria 1912
144 Ga0075365_10134404 3300006038 Bacteria 1713
145 Ga0075365_10334131 3300006038 Bacteria 1067
146 Ga0075365_10530554 3300006038 Bacteria 832
147 Ga0075368_10016364 3300006042 Bacteria 2763
148 Ga0075368_10090434 3300006042 Bacteria 1252
149 Ga0075368_10384679 3300006042 Bacteria 614
150 Ga0075363_100004515 3300006048 Bacteria 6100
151 Ga0075363_100070112 3300006048 Bacteria 1903
152 Ga0075363_100129006 3300006048 Bacteria 1417
153 Ga0075364_10151097 3300006051 Bacteria 1565
154 Ga0070715_10501723 3300006163 Bacteria 695
155 Ga0070712_100047343 3300006175 Bacteria 2976
156 Ga0070712_101691219 3300006175 Bacteria 554
157 Ga0075362_10155066 3300006177 Bacteria 1100
158 Ga0075367_10027719 3300006178 Bacteria 3225
159 Ga0075367_10078861 3300006178 Bacteria 1989
160 Ga0075367_10218142 3300006178 Bacteria 1193
161 Ga0075367_10265224 3300006178 Bacteria 1078
162 Ga0075367_10936793 3300006178 Bacteria 553
163 Ga0075369_10116209 3300006186 Bacteria 1208
164 Ga0075369_10334390 3300006186 Bacteria 709
165 Ga0075369_10422184 3300006186 Bacteria 630
166 Ga0075366_10300793 3300006195 Bacteria 981
167 Ga0075366_11010106 3300006195 Unclassified 519
168 Ga0097621_100118801 3300006237 Bacteria 2241
169 Ga0097621_100469828 3300006237 Bacteria 1136
170 Ga0097621_100638251 3300006237 Bacteria 976
171 Ga0075370_10003619 3300006353 Bacteria 7392
172 Ga0075370_10026445 3300006353 Bacteria 3215
173 Ga0075370_10433995 3300006353 Bacteria 790
174 Ga0068871_100057645 3300006358 Bacteria 3160
175 Ga0068871_100160492 3300006358 Bacteria 1922
176 Ga0068871_101131566 3300006358 Bacteria 733
177 Ga0068871_101609550 3300006358 Bacteria 615
178 Ga0068871_101659786 3300006358 Bacteria 606
179 Ga0075428_100180848 3300006844 Bacteria 2282
180 Ga0075428_100348712 3300006844 Bacteria 1589
181 Ga0075433_11913366 3300006852 Bacteria 509
182 Ga0068865_100010414 3300006881 Bacteria 5787
183 Ga0068865_100216709 3300006881 Bacteria 1494
184 Ga0068865_100930306 3300006881 Bacteria 758
185 Ga0068865_101218783 3300006881 Bacteria 667
186 Ga0097620_100089032 3300006931 Bacteria 3136
187 Ga0097620_101361475 3300006931 Bacteria 782
188 Ga0097620_102247763 3300006931 Bacteria 602
189 Ga0075435_100129718 3300007076 Bacteria 2109
190 Ga0099795_10123788 3300007788 Bacteria 1037
191 Ga0105251_10094720 3300009011 Bacteria 1369
192 Ga0105250_10129388 3300009092 Bacteria 1041
193 Ga0105240_11024009 3300009093 Bacteria 882
194 Ga0105240_11152122 3300009093 Bacteria 823
195 Ga0111539_10042783 3300009094 Bacteria 5436
196 Ga0111539_11432783 3300009094 Bacteria 801
197 Ga0111539_11699341 3300009094 Bacteria 732
198 Ga0105245_10057704 3300009098 Bacteria 3492
199 Ga0105245_10067165 3300009098 Bacteria 3247
200 Ga0105245_10219755 3300009098 Bacteria 1833
201 Ga0105245_11394689 3300009098 Bacteria 751
202 Ga0105247_10014169 3300009101 Bacteria 4783
203 Ga0105247_10201440 3300009101 Bacteria 1338
204 Ga0114129_11676376 3300009147 Bacteria 776
205 Ga0105243_10480887 3300009148 Bacteria 1172
206 Ga0105243_10676049 3300009148 Bacteria 1003
207 Ga0105243_11164410 3300009148 Bacteria 782
208 Ga0105242_10595100 3300009176 Bacteria 1067
209 Ga0105242_11001605 3300009176 Bacteria 843
210 Ga0105248_10053451 3300009177 Bacteria 4532
211 Ga0105248_10137345 3300009177 Bacteria 2758
212 Ga0105248_10223053 3300009177 Bacteria 2122
213 Ga0105248_10579756 3300009177 Bacteria 1266
214 Ga0105248_10797975 3300009177 Bacteria 1066
215 Ga0105248_11636718 3300009177 Bacteria 730
216 Ga0105237_10071327 3300009545 Bacteria 3469
217 Ga0105237_10565264 3300009545 Bacteria 1144
218 Ga0105237_11057571 3300009545 Bacteria 818
219 Ga0105238_10048335 3300009551 Bacteria 4288
220 Ga0105238_10168291 3300009551 Bacteria 2168
221 Ga0105238_10326706 3300009551 Bacteria 1520
222 Ga0105249_10336400 3300009553 Bacteria 1525
223 Ga0105249_10340489 3300009553 Bacteria 1516
224 Ga0105249_10771700 3300009553 Bacteria 1024
225 Ga0105249_10843471 3300009553 Bacteria 982
226 Ga0099796_10066243 3300010159 Bacteria 1293
227 Ga0105239_10011854 3300010375 Bacteria 9725
228 Ga0105239_10063220 3300010375 Bacteria 4063
229 Ga0105239_10094202 3300010375 Bacteria 3307
230 Ga0105239_10144153 3300010375 Bacteria 2655
231 Ga0105246_10449424 3300011119 Bacteria 1083
232 Ga0105246_10786347 3300011119 Bacteria 843
233 Ga0157337_1003322 3300012483 Bacteria 968
234 Ga0157370_10147277 3300013104 Bacteria 2192
235 Ga0157370_11284138 3300013104 Bacteria 660
236 Ga0157374_10151653 3300013296 Bacteria 2253
237 Ga0157374_10195806 3300013296 Bacteria 1978
238 Ga0157378_10006063 3300013297 Bacteria 10593
239 Ga0157378_10048156 3300013297 Bacteria 3790
240 Ga0157378_10249068 3300013297 Bacteria 1700
241 Ga0157378_10653241 3300013297 Bacteria 1067
242 Ga0163162_10469478 3300013306 Bacteria 1390
243 Ga0163162_10588967 3300013306 Bacteria 1239
244 Ga0163162_10761449 3300013306 Bacteria 1087
245 Ga0163162_10921217 3300013306 Bacteria 986
246 Ga0163162_11190679 3300013306 Bacteria 864
247 Ga0163162_11690472 3300013306 Bacteria 723
248 Ga0157372_10758292 3300013307 Bacteria 1128
249 Ga0157375_10008002 3300013308 Bacteria 9257
250 Ga0157375_10073807 3300013308 Bacteria 3431
251 Ga0157375_10323690 3300013308 Bacteria 1706
252 Ga0157375_10456222 3300013308 Bacteria 1444
253 Ga0163163_10449306 3300014325 Bacteria 1349
254 Ga0163163_10534253 3300014325 Bacteria 1235
255 Ga0163163_11418133 3300014325 Bacteria 756
256 Ga0163163_12232918 3300014325 Bacteria 606
257 Ga0157380_10082220 3300014326 Bacteria 2636
258 Ga0157380_10231883 3300014326 Bacteria 1659
259 Ga0157380_10539263 3300014326 Bacteria 1142
260 Ga0157377_10128476 3300014745 Bacteria 1544
261 Ga0157377_10474275 3300014745 Bacteria 869
262 Ga0157377_11469170 3300014745 Bacteria 540
263 Ga0157379_10192695 3300014968 Bacteria 1842
264 Ga0157379_10350638 3300014968 Bacteria 1351
265 Ga0157379_10641291 3300014968 Bacteria 994
266 Ga0157379_11429712 3300014968 Bacteria 671
267 Ga0157376_10084016 3300014969 Bacteria 2740
268 Ga0157376_11078894 3300014969 Bacteria 828
269 Ga0157376_11326748 3300014969 Bacteria 750
270 Ga0157376_12266541 3300014969 Bacteria 582
271 Ga0163161_10016627 3300017792 Bacteria 5137
272 Ga0163161_10247811 3300017792 Bacteria 1388
273 Ga0163161_10431507 3300017792 Bacteria 1062
274 Ga0209758_1001586 3300025297 Bacteria 26013
275 Ga0209758_1101456 3300025297 Bacteria 817
276 Ga0207697_10124825 3300025315 Bacteria 1110
277 Ga0207653_10363984 3300025885 Bacteria 566
278 Ga0207692_10523505 3300025898 Bacteria 755
279 Ga0207642_10675704 3300025899 Bacteria 649
280 Ga0207688_10088446 3300025901 Bacteria 1776
281 Ga0207680_10342667 3300025903 Bacteria 1049
282 Ga0207680_10612531 3300025903 Bacteria 779
283 Ga0207647_10181474 3300025904 Bacteria 1222
284 Ga0207647_10401092 3300025904 Bacteria 773
285 Ga0207685_10102688 3300025905 Bacteria 1225
286 Ga0207645_10410435 3300025907 Bacteria 912
287 Ga0207705_10308490 3300025909 Bacteria 1214
288 Ga0207705_10481437 3300025909 Bacteria 963
289 Ga0207705_11034151 3300025909 Bacteria 634
290 Ga0207684_10307634 3300025910 Bacteria 1366
291 Ga0207654_10012184 3300025911 Bacteria 4402
292 Ga0207671_10034963 3300025914 Bacteria 3731
293 Ga0207671_10776194 3300025914 Bacteria 761
294 Ga0207693_10082875 3300025915 Bacteria 2512
295 Ga0207663_10541528 3300025916 Bacteria 909
296 Ga0207660_11075160 3300025917 Bacteria 656
297 Ga0207662_10430166 3300025918 Bacteria 900
298 Ga0207657_10129182 3300025919 Bacteria 2072
299 Ga0207657_10249307 3300025919 Bacteria 1416
300 Ga0207657_10365480 3300025919 Bacteria 1137
301 Ga0207652_10213839 3300025921 Bacteria 1736
302 Ga0207681_10177311 3300025923 Bacteria 1620
303 Ga0207681_10400083 3300025923 Bacteria 1109
304 Ga0207694_10760978 3300025924 Bacteria 818
305 Ga0207650_11319736 3300025925 Bacteria 614
306 Ga0207659_10065501 3300025926 Bacteria 2633
307 Ga0207659_11666291 3300025926 Bacteria 544
308 Ga0207687_10039959 3300025927 Bacteria 3214
309 Ga0207687_10084630 3300025927 Bacteria 2299
310 Ga0207687_11609027 3300025927 Bacteria 557
311 Ga0207644_10299225 3300025931 Bacteria 1296
312 Ga0207644_10705642 3300025931 Bacteria 841
313 Ga0207644_11085694 3300025931 Bacteria 672
314 Ga0207690_10031724 3300025932 Bacteria 3384
315 Ga0207706_10021355 3300025933 Bacteria 5816
316 Ga0207706_10080499 3300025933 Bacteria 2864
317 Ga0207706_10400444 3300025933 Bacteria 1190
318 Ga0207706_10425745 3300025933 Bacteria 1150
319 Ga0207686_10031881 3300025934 Bacteria 3132
320 Ga0207686_10344765 3300025934 Bacteria 1120
321 Ga0207686_10849133 3300025934 Bacteria 734
322 Ga0207709_10352675 3300025935 Bacteria 1111
323 Ga0207709_10513850 3300025935 Bacteria 937
324 Ga0207669_10073695 3300025937 Bacteria 2155
325 Ga0207669_10521827 3300025937 Bacteria 954
326 Ga0207704_10026146 3300025938 Bacteria 3197
327 Ga0207704_10309267 3300025938 Bacteria 1214
328 Ga0207691_10022479 3300025940 Bacteria 5947
329 Ga0207691_10041818 3300025940 Bacteria 4228
330 Ga0207711_10530075 3300025941 Bacteria 1098
331 Ga0207689_10012457 3300025942 Bacteria 7265
332 Ga0207689_10056730 3300025942 Bacteria 3223
333 Ga0207661_10425027 3300025944 Bacteria 1207
334 Ga0207679_10132065 3300025945 Bacteria 2005
335 Ga0207679_10687662 3300025945 Bacteria 927
336 Ga0207712_10817847 3300025961 Bacteria 820
337 Ga0207712_11413150 3300025961 Bacteria 623
338 Ga0207668_10053973 3300025972 Bacteria 2787
339 Ga0207668_10099608 3300025972 Bacteria 2156
340 Ga0207668_10182535 3300025972 Bacteria 1656
341 Ga0207668_10563678 3300025972 Bacteria 988
342 Ga0207668_10696667 3300025972 Bacteria 892
343 Ga0207668_11346804 3300025972 Bacteria 643
344 Ga0207640_10057571 3300025981 Bacteria 2557
345 Ga0207640_10308643 3300025981 Bacteria 1255
346 Ga0207640_10555448 3300025981 Bacteria 965
347 Ga0207640_11006094 3300025981 Bacteria 733
348 Ga0207658_10234852 3300025986 Bacteria 1550
349 Ga0207658_10361722 3300025986 Bacteria 1266
350 Ga0207658_11649816 3300025986 Bacteria 586
351 Ga0207677_10080372 3300026023 Bacteria 2336
352 Ga0207677_10658066 3300026023 Bacteria 925
353 Ga0207703_10045954 3300026035 Bacteria 3514
354 Ga0207703_10343252 3300026035 Bacteria 1373
355 Ga0207703_11163321 3300026035 Bacteria 741
356 Ga0207703_12034919 3300026035 Bacteria 550
357 Ga0207639_10071820 3300026041 Bacteria 2709
358 Ga0207639_10177090 3300026041 Bacteria 1811
359 Ga0207639_10460492 3300026041 Bacteria 1156
360 Ga0207639_10644425 3300026041 Bacteria 980
361 Ga0207678_10011040 3300026067 Bacteria 7934
362 Ga0207678_10037309 3300026067 Bacteria 4227
363 Ga0207678_10090221 3300026067 Bacteria 2620
364 Ga0207678_10495227 3300026067 Bacteria 1065
365 Ga0207678_10776105 3300026067 Bacteria 845
366 Ga0207702_10321858 3300026078 Bacteria 1473
367 Ga0207702_10388966 3300026078 Bacteria 1343
368 Ga0207702_10689889 3300026078 Bacteria 1006
369 Ga0207641_10718819 3300026088 Bacteria 984
370 Ga0207641_10972294 3300026088 Bacteria 845
371 Ga0207676_10053782 3300026095 Bacteria 3152
372 Ga0207676_10309257 3300026095 Bacteria 1446
373 Ga0207676_10727596 3300026095 Bacteria 963
374 Ga0207675_100146067 3300026118 Bacteria 2249
375 Ga0207675_100608920 3300026118 Bacteria 1096
376 Ga0207675_100673064 3300026118 Bacteria 1042
377 Ga0207675_101108968 3300026118 Bacteria 811
378 Ga0207683_10014657 3300026121 Bacteria 6677
379 Ga0207683_10019107 3300026121 Bacteria 5849
380 Ga0207683_10022988 3300026121 Bacteria 5358
381 Ga0207683_10120230 3300026121 Bacteria 2357
382 Ga0207683_11189554 3300026121 Bacteria 707
383 Ga0207698_10367427 3300026142 Bacteria 1364
384 Ga0209813_10016521 3300027866 Bacteria 2015
385 Ga0268266_10003029 3300028379 Bacteria 17259
386 Ga0268266_10024907 3300028379 Bacteria 5091
387 Ga0268266_10028431 3300028379 Bacteria 4753
388 Ga0268266_10073224 3300028379 Bacteria 2972
389 Ga0268266_10138040 3300028379 Bacteria 2185
390 Ga0268266_10166526 3300028379 Bacteria 1997
391 Ga0268266_10375761 3300028379 Bacteria 1339
392 Ga0268266_10638741 3300028379 Bacteria 1024
393 Ga0268266_11154486 3300028379 Bacteria 749
394 Ga0268266_11290226 3300028379 Bacteria 705
395 Ga0268265_10414122 3300028380 Bacteria 1249
396 Ga0268265_10500802 3300028380 Bacteria 1144
397 Ga0268265_10655324 3300028380 Bacteria 1010
398 Ga0268265_10842710 3300028380 Bacteria 896
399 Ga0268264_10716687 3300028381 Bacteria 994
400 Ga0268264_11394952 3300028381 Bacteria 711
401 Ga0307517_10000111 3300028786 Bacteria 120304
402 Ga0307517_10253763 3300028786 Bacteria 1029
403 Ga0307515_10013645 3300028794 Bacteria 15142
404 Ga0307515_10385508 3300028794 Bacteria 1032
405 Ga0265331_10318071 3300031250 Bacteria 697
406 Ga0307509_10192693 3300031507 Bacteria 1887
407 Ga0307408_100367333 3300031548 Bacteria 1226
408 Ga0307508_10473696 3300031616 Bacteria 846
409 Ga0265314_10041341 3300031711 Bacteria 3301
410 Ga0307516_10364489 3300031730 Bacteria 1109
411 Ga0307516_10806689 3300031730 Unclassified 600
412 Ga0307405_10664337 3300031731 Bacteria 859
413 Ga0307413_10459381 3300031824 Bacteria 1013
414 Ga0307410_11876878 3300031852 Bacteria 533
415 Ga0307406_10134105 3300031901 Bacteria 1743
416 Ga0307406_10715774 3300031901 Bacteria 837
417 Ga0307407_10155509 3300031903 Bacteria 1491
418 Ga0307409_102017739 3300031995 Bacteria 606
419 Ga0307416_100557398 3300032002 Bacteria 1220
420 Ga0307411_10290628 3300032005 Bacteria 1306
421 Ga0307415_101344139 3300032126 Bacteria 678
422 Ga0307510_10002931 3300033180 Bacteria 19626
423 Ga0307510_10040352 3300033180 Bacteria 5125
424 Ga0307510_10254598 3300033180 Bacteria 1241
425 Ga0373950_0110330 3300034818 Bacteria 600
426 Ga0373944_0110319 3300035089 Bacteria 939
427 Ga0373951_0108416 3300035091 Bacteria 745
428 Ga0373932_0052650 3300035112 Bacteria 1213
429 Ga0373939_0128307 3300035114 Bacteria 902
430 Ga0373931_0016670 3300035691 Bacteria 3620
431 Ga0373931_0081607 3300035691 Bacteria 1786
432 Ga0373931_0235194 3300035691 Bacteria 1108
433 Ga0373931_0320247 3300035691 Bacteria 963
434 Ga0373935_0117507 3300035692 Bacteria 1773
435 Ga0373927_0023010 3300035695 Bacteria 4082
436 Ga0373947_0255856 3300035725 Bacteria 1159
437 Ga0373947_0670519 3300035725 Bacteria 707
438 Ga0373925_0062707 3300037068 Bacteria 2796
439 Ga0373925_0181541 3300037068 Bacteria 1666
440 Ga0395900_1169840 3300037418 Bacteria 685
441 Ga0395898_0317679 3300037466 Bacteria 1486
442 Ga0395901_0299913 3300038443 Bacteria 1666
443 Ga0439465_0191574 3300041413 Bacteria 743
444 Ga0451789_0784806 3300041443 Bacteria 1192
445 Ga0451797_0215939 3300041453 Bacteria 969
446 Ga0451795_0796094 3300041456 Bacteria 758
447 Ga0451802_0846820 3300041460 Bacteria 702
448 Ga0451804_0062892 3300041463 Bacteria 1240
449 Ga0451807_1125749 3300041486 Unclassified 616
450 Ga0451837_0562748 3300041494 Bacteria 843
451 Ga0451839_1121592 3300041496 Bacteria 1118
452 Ga0451855_1314449 3300041511 Bacteria 910
453 Ga0451853_0186591 3300041512 Bacteria 1238
454 Ga0451853_3272995 3300041512 Bacteria 618
455 Ga0439459_0051010 3300042438 Bacteria 909
456 Ga0495617_150913 3300046452 Bacteria 739
457 Ga0495603_0205602 3300046455 Bacteria 1137
458 Ga0495629_0695446 3300046459 Bacteria 675
459 Ga0495638_0570826 3300046460 Bacteria 559
460 Ga0495641_0142418 3300046461 Bacteria 1071
461 Ga0495650_0082086 3300046471 Bacteria 1241
462 Ga0495582_0047327 3300046473 Bacteria 2369
463 Ga0495605_0195968 3300046474 Bacteria 882
464 Ga0495639_0207618 3300046475 Bacteria 960
465 Ga0495664_0469354 3300046477 Unclassified 753
466 Ga0495585_0088687 3300046492 Bacteria 1668
467 Ga0495594_0562992 3300046499 Bacteria 647
468 Ga0495596_0038327 3300046500 Bacteria 1895
469 Ga0495596_0310966 3300046500 Bacteria 613
470 Ga0495607_0177935 3300046501 Bacteria 1069
471 Ga0495608_0267226 3300046511 Bacteria 1064
472 Ga0495616_0300795 3300046513 Bacteria 677
473 Ga0495616_0412127 3300046513 Bacteria 553
474 Ga0495620_0117213 3300046515 Bacteria 1052
475 Ga0495631_0227004 3300046518 Bacteria 797
476 Ga0495632_0158350 3300046519 Bacteria 1044
477 Ga0495632_0420049 3300046519 Bacteria 582
478 Ga0495643_0169788 3300046522 Bacteria 1067
479 Ga0495644_0137686 3300046523 Bacteria 932
480 Ga0495644_0408655 3300046523 Bacteria 538
481 Ga0495648_0063538 3300046524 Bacteria 2179
482 Ga0495663_0339993 3300046525 Bacteria 545
483 Ga0495642_0407516 3300046528 Bacteria 600
484 Ga0495654_0034844 3300046530 Bacteria 2538
485 Ga0495598_0042862 3300046537 Bacteria 1330
486 Ga0495609_0292031 3300046538 Bacteria 665
487 Ga0495597_0188743 3300046542 Bacteria 830
488 Ga0495633_0102378 3300046558 Bacteria 1329
489 Ga0495656_0264527 3300046615 Bacteria 872
490 Ga0495668_0496565 3300046616 Bacteria 672
491 Ga0495668_0747972 3300046616 Bacteria 541
492 Ga0495611_0063986 3300046648 Bacteria 1674
493 Ga0495611_0122038 3300046648 Bacteria 1215
494 Ga0495625_0090908 3300046660 Bacteria 2110
495 Ga0495625_0353348 3300046660 Bacteria 928
496 Ga0495625_0440551 3300046660 Unclassified 807
497 Ga0495625_0666859 3300046660 Unclassified 618
498 Ga0495661_0632356 3300046665 Bacteria 501
499 Ga0495588_0049973 3300046674 Bacteria 2151
500 Ga0495588_0401415 3300046674 Bacteria 720
501 Ga0495658_0624535 3300046683 Bacteria 690
502 Ga0495669_0011057 3300046684 Bacteria 3823
503 Ga0495669_0037419 3300046684 Bacteria 2147
504 Ga0495624_0185668 3300046690 Bacteria 1266
505 Ga0495624_0864290 3300046690 Bacteria 533
506 Ga0495670_0404779 3300046691 Bacteria 737
507 Ga0495671_0226806 3300046692 Bacteria 904
508 Ga0495671_0336165 3300046692 Bacteria 725
509 Ga0495649_0359583 3300046694 Bacteria 735
510 Ga0495649_0431753 3300046694 Bacteria 659
511 Ga0495589_0205040 3300046794 Bacteria 930
512 Ga0495589_0300433 3300046794 Bacteria 744
513 Ga0495660_0133191 3300046810 Bacteria 1245
514 Ga0495581_0453186 3300047315 Bacteria 747
515 Ga0495604_0227471 3300047317 Bacteria 1281
516 Ga0495636_0511874 3300047318 Bacteria 581
517 Ga0495674_0188374 3300047319 Bacteria 1716
518 Ga0495674_0338663 3300047319 Bacteria 1223
519 Ga0495676_0120725 3300047321 Bacteria 1907
520 Ga0495683_0443407 3300047323 Bacteria 534
521 Ga0495677_0031169 3300047445 Bacteria 1941
522 Ga0495679_035292 3300047446 Bacteria 1586
523 Ga0495685_100834 3300047447 Bacteria 954
524 Ga0495673_0200304 3300047469 Bacteria 747
525 Ga0495681_0075815 3300047470 Bacteria 1513
526 Ga0495686_0455805 3300047472 Unclassified 679
527 Ga0495593_0391735 3300047673 Bacteria 695
528 Ga0495602_0492126 3300048088 Bacteria 859
529 Ga0496100_0323874 3300048903 Bacteria 1158
530 Ga0496100_1668902 3300048903 Bacteria 504
531 Ga0496101_0012724 3300048904 Bacteria 5624
532 Ga0496101_0245015 3300048904 Bacteria 1395
533 Ga0496101_1387914 3300048904 Bacteria 548
534 Ga0496102_0039253 3300048905 Bacteria 4277
535 Ga0496102_0193445 3300048905 Bacteria 1917
536 Ga0496102_0268733 3300048905 Bacteria 1608
537 Ga0496102_0612105 3300048905 Bacteria 1012
538 Ga0496102_0679991 3300048905 Bacteria 952
539 Ga0496102_0837274 3300048905 Bacteria 842
540 Ga0496102_1195404 3300048905 Bacteria 680
541 Ga0496103_0010521 3300048906 Bacteria 5478
542 Ga0496103_0043749 3300048906 Bacteria 2758
543 Ga0496103_0569136 3300048906 Bacteria 723
544 Ga0496103_1021239 3300048906 Bacteria 514
545 Ga0496104_0045947 3300048907 Bacteria 4108
546 Ga0496104_0059018 3300048907 Bacteria 3632
547 Ga0496104_0200041 3300048907 Bacteria 1910
548 Ga0496104_0790747 3300048907 Bacteria 855
549 Ga0496105_0013417 3300048908 Bacteria 6503
550 Ga0496105_0015008 3300048908 Bacteria 6164
551 Ga0496106_0020169 3300048909 Bacteria 4945
552 Ga0496106_0046236 3300048909 Bacteria 3271
553 Ga0496106_0187458 3300048909 Bacteria 1644
554 Ga0496106_0246962 3300048909 Bacteria 1426
555 Ga0496107_0018119 3300048910 Bacteria 4954
556 Ga0496107_0053762 3300048910 Bacteria 2905
557 Ga0496107_0122953 3300048910 Bacteria 1912
558 Ga0496107_0374093 3300048910 Bacteria 1060
559 Ga0496108_0085368 3300048911 Bacteria 2679
560 Ga0496108_0086137 3300048911 Bacteria 2667
561 Ga0496108_0340063 3300048911 Bacteria 1309
562 Ga0496108_0624494 3300048911 Bacteria 938
563 Ga0496108_0629545 3300048911 Bacteria 933
564 Ga0496108_0959154 3300048911 Bacteria 732
565 Ga0496109_0046895 3300048912 Bacteria 3926
566 Ga0496109_0158214 3300048912 Bacteria 2122
567 Ga0496109_0299783 3300048912 Bacteria 1515
568 Ga0496109_0358270 3300048912 Bacteria 1378
569 Ga0496110_0016079 3300048913 Bacteria 6239
570 Ga0496110_0204472 3300048913 Bacteria 1794
571 Ga0496110_0227804 3300048913 Bacteria 1695
572 Ga0496110_0406937 3300048913 Bacteria 1240
573 Ga0496111_0039170 3300048914 Bacteria 3397
574 Ga0496111_0080281 3300048914 Bacteria 2380
575 Ga0496111_0258520 3300048914 Bacteria 1292
576 Ga0496111_0596885 3300048914 Bacteria 808
577 Ga0496112_0023082 3300048915 Bacteria 5938
578 Ga0496112_0030050 3300048915 Bacteria 5257
579 Ga0496112_0045416 3300048915 Bacteria 4306
580 Ga0496112_0107381 3300048915 Bacteria 2761
581 Ga0496112_1338800 3300048915 Bacteria 631
582 Ga0496113_0004920 3300048916 Bacteria 8276
583 Ga0496113_0034345 3300048916 Bacteria 3700
584 Ga0496113_0265857 3300048916 Bacteria 1370
585 Ga0496113_1029656 3300048916 Bacteria 648
586 Ga0496113_1279127 3300048916 Bacteria 571
587 Ga0496114_0042300 3300048917 Bacteria 3776
588 Ga0496114_0104274 3300048917 Bacteria 2424
589 Ga0496114_1095367 3300048917 Bacteria 681
590 Ga0496115_0006396 3300048918 Bacteria 8633
591 Ga0496115_0033912 3300048918 Bacteria 4033
592 Ga0496115_0569136 3300048918 Bacteria 904
593 Ga0496115_1187753 3300048918 Bacteria 574
594 Ga0496117_0166153 3300048920 Bacteria 1287
595 Ga0496118_0171404 3300048921 Bacteria 1325
596 Ga0496120_0179223 3300048923 Bacteria 1042
597 Ga0496121_0056722 3300048924 Bacteria 3251
598 Ga0496121_0069632 3300048924 Bacteria 2838
599 Ga0496121_0239856 3300048924 Bacteria 1264
600 Ga0496121_0351418 3300048924 Bacteria 982
601 Ga0496121_0387609 3300048924 Bacteria 919
602 Ga0496121_0389062 3300048924 Bacteria 917
603 Ga0496125_0504953 3300048928 Bacteria 680
604 Ga0496126_0008787 3300048929 Bacteria 10843
605 Ga0496126_0587040 3300048929 Bacteria 879
606 Ga0495678_082179 3300049459 Bacteria 1154
607 Ga0501036_0409545 3300049572 Bacteria 1131
608 Ga0501040_0752609 3300049576 Bacteria 705
609 Ga0501067_0343560 3300049583 Bacteria 832
610 Ga0501068_0349117 3300049584 Bacteria 951
611 Ga0501076_0151174 3300049592 Bacteria 1889
612 nmdc:mga03n38_116720_c1 3300050490 Bacteria 1307
613 nmdc:mga03n38_73348_c1 3300050490 Bacteria 1589
614 nmdc:mga00v17_143251_c1 3300050491 Bacteria 1533
615 nmdc:mga00v17_538834_c1 3300050491 Bacteria 755
616 nmdc:mga00v17_71280_c1 3300050491 Bacteria 2154
617 nmdc:mga0yw44_1114339_c1 3300050492 Bacteria 533
618 nmdc:mga0yw44_192692_c1 3300050492 Bacteria 1345
619 nmdc:mga0yw44_243685_c1 3300050492 Bacteria 1195
620 nmdc:mga0yw44_25096_c1 3300050492 Bacteria 3384
621 nmdc:mga0yw44_654849_c1 3300050492 Unclassified 714
622 nmdc:mga0k408_143672_c1 3300050493 Bacteria 1420
623 nmdc:mga0k408_164665_c1 3300050493 Bacteria 1321
624 nmdc:mga0k408_54272_c2 3300050493 Bacteria 1890
625 nmdc:mga06z11_21232_c1 3300050494 Bacteria 3015
626 nmdc:mga06z11_54754_c1 3300050494 Bacteria 2057
627 nmdc:mga06z11_736868_c1 3300050494 Bacteria 600
628 nmdc:mga06z11_874298_c1 3300050494 Bacteria 548
629 nmdc:mga04h51_17237_c1 3300050495 Bacteria 2109
630 nmdc:mga04h51_206764_c1 3300050495 Bacteria 773
631 nmdc:mga07m45_1291_c2 3300050496 Bacteria 8407
632 nmdc:mga07m45_566355_c1 3300050496 Bacteria 657
633 nmdc:mga08y16_198366_c1 3300050511 Bacteria 2080
634 nmdc:mga08y16_820819_c1 3300050511 Bacteria 921
635 nmdc:mga0rr50_1031276_c1 3300050513 Bacteria 700
636 nmdc:mga0a205_915762_c1 3300050515 Bacteria 723
637 nmdc:mga0sz30_203111_c1 3300050516 Bacteria 880
638 Ga0495655_0163422 3300053083 Bacteria 708
639 Ga0500643_040422 3300053087 Bacteria 1373
640 Ga0500646_0376678 3300053090 Bacteria 521
641 Ga0500583_0098521 3300053092 Bacteria 1429
642 Ga0500651_0730929 3300053093 Bacteria 527
643 Ga0500566_0002846 3300053094 Bacteria 10302
644 Ga0500641_0002256 3300053096 Bacteria 6826
645 Ga0500641_0016694 3300053096 Bacteria 2736
646 Ga0500650_0410330 3300053098 Unclassified 585
647 Ga0500654_107178 3300053099 Bacteria 1162
648 Ga0500554_184835 3300053102 Bacteria 700
649 Ga0500555_021515 3300053103 Bacteria 1858
650 Ga0500562_136563 3300053108 Bacteria 668
651 Ga0500569_213641 3300053109 Bacteria 656
652 Ga0500595_004876 3300053119 Bacteria 5936
653 Ga0500608_157113 3300053122 Bacteria 990
654 Ga0500655_010576 3300053133 Bacteria 1667
655 Ga0500559_0087716 3300053136 Bacteria 1421
656 Ga0500588_0070263 3300053146 Bacteria 1146
657 Ga0500589_066574 3300053147 Bacteria 1638
658 Ga0500590_084521 3300053148 Bacteria 1553
659 Ga0500603_006533 3300053150 Bacteria 2537
660 Ga0500622_0131568 3300053156 Bacteria 1202
661 Ga0500627_0444403 3300053158 Unclassified 547
662 Ga0500633_0350352 3300053160 Bacteria 538
663 Ga0500634_0141638 3300053161 Bacteria 1138
664 Ga0500634_0189764 3300053161 Bacteria 914
665 Ga0500637_0000171 3300053178 Bacteria 24172
666 Ga0501084_1471995 3300054114 Bacteria 570
667 Ga0500661_000551 3300055283 Bacteria 6991
668 2524536838 2524023228 Bacteria 10118060
669 2793077296
670 2874609647 2874604998 Bacteria 7834745
671 2879118487 2879110137 Bacteria 8907982
672 2889040546 2889033259 Bacteria 9099371
673 2904702603
674 2922392429 2922386360 Bacteria 7017218
675 8006967370 8006964411 Bacteria 8966052
676 8006988171 8006984368 Bacteria 9651211
677 8006997687 8006994254 Bacteria 8309700
678 8056674480 8056673599 Bacteria 7871253
679 Ga0075367_10449480
680 JGI24740J21852_10073634
681 JGI25153J46596_10005083
682 rootH2_10213342
683 rootL2_10055011
684 rootL2_10055012
685 Ga0065704_10315572
686 Ga0070658_10238179
687 Ga0070658_10646130
688 Ga0070676_11592615
689 Ga0070683_101400783
690 Ga0070670_100169189
691 Ga0070670_100662370
692 Ga0070677_10292180
693 Ga0068869_100056396
694 Ga0068869_100399262
695 Ga0068869_102080934
696 Ga0070680_100095798
697 Ga0070680_100435184
698 Ga0070682_100080269
699 Ga0070682_100681493
700 Ga0068868_100019185
701 Ga0068868_100165966
702 Ga0068868_100630451
703 Ga0068868_101006798
704 Ga0070691_10420788
705 Ga0070687_100840738
706 Ga0070687_101265180
707 Ga0070661_100099518
708 Ga0070661_100255312
709 Ga0070661_100341015
710 Ga0070692_10928493
711 Ga0070668_100051506
712 Ga0070668_100415925
713 Ga0070669_100259041
714 Ga0070671_100375662
715 Ga0070671_100455655
716 Ga0070671_100770847
717 Ga0070674_100077072
718 Ga0070674_100148910
719 Ga0070688_101400669
720 Ga0070659_100170100
721 Ga0070667_100383102
722 Ga0070667_100873358
723 Ga0070667_101024167
724 Ga0070667_101243743
725 Ga0070709_10565122
726 Ga0070709_11224339
727 Ga0070701_10439918
728 Ga0070701_10809885
729 Ga0070700_100005487
730 Ga0070663_100020471
731 Ga0070663_100057168
732 Ga0070663_100071881
733 Ga0070663_100154254
734 Ga0070678_100009855
735 Ga0070678_100047937
736 Ga0070678_101024444
737 Ga0070662_100199568
738 Ga0070662_100335662
739 Ga0070662_100774402
740 Ga0068867_100079211
741 Ga0068867_101021989
742 Ga0068867_101119173
743 Ga0070685_10938046
744 Ga0070698_100165645
745 Ga0070698_100876976
746 Ga0070699_100066644
747 Ga0070684_100417636
748 Ga0068853_100044516
749 Ga0068853_100214524
750 Ga0068853_100407473
751 Ga0068853_100422784
752 Ga0068853_100543779
753 Ga0068853_101335675
754 Ga0070672_100072157
755 Ga0070686_100118031
756 Ga0070686_100613568
757 Ga0070686_100822578
758 Ga0070695_100191895
759 Ga0070696_100328616
760 Ga0070665_100035183
761 Ga0070665_100041041
762 Ga0070665_100060805
763 Ga0070665_100381389
764 Ga0070665_100491853
765 Ga0070665_100573231
766 Ga0070665_100640956
767 Ga0068855_100025716
768 Ga0068855_100119614
769 Ga0068855_101721295
770 Ga0070664_100556735
771 Ga0070664_100764178
772 Ga0068857_100151860
773 Ga0068854_100151364
774 Ga0068854_100310478
775 Ga0068854_100337646
776 Ga0068854_100926281
777 Ga0068856_100060128
778 Ga0068856_100767783
779 Ga0068856_101256627
780 Ga0068852_100155737
781 Ga0068852_100301204
782 Ga0068859_100089045
783 Ga0068859_101361542
784 Ga0068859_102247641
785 Ga0068864_100016149
786 Ga0068864_101776233
787 Ga0068866_10204182
788 Ga0068866_10871291
789 Ga0068861_100048005
790 Ga0068861_100054501
791 Ga0068861_100318030
792 Ga0068861_100340447
793 Ga0068861_100882303
794 Ga0068870_10088743
795 Ga0068870_10099486
796 Ga0068863_100112612
797 Ga0068863_100828350
798 Ga0068858_100331769
799 Ga0068858_100864543
800 Ga0068858_100930518
801 Ga0068858_101447598
802 Ga0068858_102050526
803 Ga0068860_100135526
804 Ga0068860_100374104
805 Ga0068862_100138415
806 Ga0068862_100210791
807 Ga0068862_100851416
808 Ga0068862_101891905
809 Ga0081455_10007002
810 Ga0081455_10430204
811 Ga0081455_10536900
812 Ga0081538_10112350
813 Ga0081540_1003669
814 Ga0081540_1018032
815 Ga0081540_1040751
816 Ga0081540_1275413
817 Ga0081539_10015987
818 Ga0081539_10074235
819 Ga0070717_10440889
820 Ga0075365_10037571
821 Ga0075365_10107814
822 Ga0075365_10134404
823 Ga0075365_10334131
824 Ga0075365_10530554
825 Ga0075368_10016364
826 Ga0075368_10090434
827 Ga0075368_10384679
828 Ga0075363_100004515
829 Ga0075363_100070112
830 Ga0075363_100129006
831 Ga0075364_10151097
832 Ga0070715_10501723
833 Ga0070712_100047343
834 Ga0070712_101691219
835 Ga0075362_10155066
836 Ga0075367_10027719
837 Ga0075367_10078861
838 Ga0075367_10218142
839 Ga0075367_10265224
840 Ga0075367_10936793
841 Ga0075369_10116209
842 Ga0075369_10334390
843 Ga0075369_10422184
844 Ga0075366_10300793
845 Ga0075366_11010106
846 Ga0097621_100118801
847 Ga0097621_100469828
848 Ga0097621_100638251
849 Ga0075370_10003619
850 Ga0075370_10026445
851 Ga0075370_10433995
852 Ga0068871_100057645
853 Ga0068871_100160492
854 Ga0068871_101131566
855 Ga0068871_101609550
856 Ga0068871_101659786
857 Ga0075428_100180848
858 Ga0075428_100348712
859 Ga0075433_11913366
860 Ga0068865_100010414
861 Ga0068865_100216709
862 Ga0068865_100930306
863 Ga0068865_101218783
864 Ga0097620_100089032
865 Ga0097620_101361475
866 Ga0097620_102247763
867 Ga0075435_100129718
868 Ga0099795_10123788
869 Ga0105251_10094720
870 Ga0105250_10129388
871 Ga0105240_11024009
872 Ga0105240_11152122
873 Ga0111539_10042783
874 Ga0111539_11432783
875 Ga0111539_11699341
876 Ga0105245_10057704
877 Ga0105245_10067165
878 Ga0105245_10219755
879 Ga0105245_11394689
880 Ga0105247_10014169
881 Ga0105247_10201440
882 Ga0114129_11676376
883 Ga0105243_10480887
884 Ga0105243_10676049
885 Ga0105243_11164410
886 Ga0105242_10595100
887 Ga0105242_11001605
888 Ga0105248_10053451
889 Ga0105248_10137345
890 Ga0105248_10223053
891 Ga0105248_10579756
892 Ga0105248_10797975
893 Ga0105248_11636718
894 Ga0105237_10071327
895 Ga0105237_10565264
896 Ga0105237_11057571
897 Ga0105238_10048335
898 Ga0105238_10168291
899 Ga0105238_10326706
900 Ga0105249_10336400
901 Ga0105249_10340489
902 Ga0105249_10771700
903 Ga0105249_10843471
904 Ga0099796_10066243
905 Ga0105239_10011854
906 Ga0105239_10063220
907 Ga0105239_10094202
908 Ga0105239_10144153
909 Ga0105246_10449424
910 Ga0105246_10786347
911 Ga0157337_1003322
912 Ga0157370_10147277
913 Ga0157370_11284138
914 Ga0157374_10151653
915 Ga0157374_10195806
916 Ga0157378_10006063
917 Ga0157378_10048156
918 Ga0157378_10249068
919 Ga0157378_10653241
920 Ga0163162_10469478
921 Ga0163162_10588967
922 Ga0163162_10761449
923 Ga0163162_10921217
924 Ga0163162_11190679
925 Ga0163162_11690472
926 Ga0157372_10758292
927 Ga0157375_10008002
928 Ga0157375_10073807
929 Ga0157375_10323690
930 Ga0157375_10456222
931 Ga0163163_10449306
932 Ga0163163_10534253
933 Ga0163163_11418133
934 Ga0163163_12232918
935 Ga0157380_10082220
936 Ga0157380_10231883
937 Ga0157380_10539263
938 Ga0157377_10128476
939 Ga0157377_10474275
940 Ga0157377_11469170
941 Ga0157379_10192695
942 Ga0157379_10350638
943 Ga0157379_10641291
944 Ga0157379_11429712
945 Ga0157376_10084016
946 Ga0157376_11078894
947 Ga0157376_11326748
948 Ga0157376_12266541
949 Ga0163161_10016627
950 Ga0163161_10247811
951 Ga0163161_10431507
952 Ga0209758_1001586
953 Ga0209758_1101456
954 Ga0207697_10124825
955 Ga0207653_10363984
956 Ga0207692_10523505
957 Ga0207642_10675704
958 Ga0207688_10088446
959 Ga0207680_10342667
960 Ga0207680_10612531
961 Ga0207647_10181474
962 Ga0207647_10401092
963 Ga0207685_10102688
964 Ga0207645_10410435
965 Ga0207705_10308490
966 Ga0207705_10481437
967 Ga0207705_11034151
968 Ga0207684_10307634
969 Ga0207654_10012184
970 Ga0207671_10034963
971 Ga0207671_10776194
972 Ga0207693_10082875
973 Ga0207663_10541528
974 Ga0207660_11075160
975 Ga0207662_10430166
976 Ga0207657_10129182
977 Ga0207657_10249307
978 Ga0207657_10365480
979 Ga0207652_10213839
980 Ga0207681_10177311
981 Ga0207681_10400083
982 Ga0207694_10760978
983 Ga0207650_11319736
984 Ga0207659_10065501
985 Ga0207659_11666291
986 Ga0207687_10039959
987 Ga0207687_10084630
988 Ga0207687_11609027
989 Ga0207644_10299225
990 Ga0207644_10705642
991 Ga0207644_11085694
992 Ga0207690_10031724
993 Ga0207706_10021355
994 Ga0207706_10080499
995 Ga0207706_10400444
996 Ga0207706_10425745
997 Ga0207686_10031881
998 Ga0207686_10344765
999 Ga0207686_10849133
1000 Ga0207709_10352675
1001 Ga0207709_10513850
1002 Ga0207669_10073695
1003 Ga0207669_10521827
1004 Ga0207704_10026146
1005 Ga0207704_10309267
1006 Ga0207691_10022479
1007 Ga0207691_10041818
1008 Ga0207711_10530075
1009 Ga0207689_10012457
1010 Ga0207689_10056730
1011 Ga0207661_10425027
1012 Ga0207679_10132065
1013 Ga0207679_10687662
1014 Ga0207712_10817847
1015 Ga0207712_11413150
1016 Ga0207668_10053973
1017 Ga0207668_10099608
1018 Ga0207668_10182535
1019 Ga0207668_10563678
1020 Ga0207668_10696667
1021 Ga0207668_11346804
1022 Ga0207640_10057571
1023 Ga0207640_10308643
1024 Ga0207640_10555448
1025 Ga0207640_11006094
1026 Ga0207658_10234852
1027 Ga0207658_10361722
1028 Ga0207658_11649816
1029 Ga0207677_10080372
1030 Ga0207677_10658066
1031 Ga0207703_10045954
1032 Ga0207703_10343252
1033 Ga0207703_11163321
1034 Ga0207703_12034919
1035 Ga0207639_10071820
1036 Ga0207639_10177090
1037 Ga0207639_10460492
1038 Ga0207639_10644425
1039 Ga0207678_10011040
1040 Ga0207678_10037309
1041 Ga0207678_10090221
1042 Ga0207678_10495227
1043 Ga0207678_10776105
1044 Ga0207702_10321858
1045 Ga0207702_10388966
1046 Ga0207702_10689889
1047 Ga0207641_10718819
1048 Ga0207641_10972294
1049 Ga0207676_10053782
1050 Ga0207676_10309257
1051 Ga0207676_10727596
1052 Ga0207675_100146067
1053 Ga0207675_100608920
1054 Ga0207675_100673064
1055 Ga0207675_101108968
1056 Ga0207683_10014657
1057 Ga0207683_10019107
1058 Ga0207683_10022988
1059 Ga0207683_10120230
1060 Ga0207683_11189554
1061 Ga0207698_10367427
1062 Ga0209813_10016521
1063 Ga0268266_10003029
1064 Ga0268266_10024907
1065 Ga0268266_10028431
1066 Ga0268266_10073224
1067 Ga0268266_10138040
1068 Ga0268266_10166526
1069 Ga0268266_10375761
1070 Ga0268266_10638741
1071 Ga0268266_11154486
1072 Ga0268266_11290226
1073 Ga0268265_10414122
1074 Ga0268265_10500802
1075 Ga0268265_10655324
1076 Ga0268265_10842710
1077 Ga0268264_10716687
1078 Ga0268264_11394952
1079 Ga0307517_10000111
1080 Ga0307517_10253763
1081 Ga0307515_10013645
1082 Ga0307515_10385508
1083 Ga0265331_10318071
1084 Ga0307509_10192693
1085 Ga0307408_100367333
1086 Ga0307508_10473696
1087 Ga0265314_10041341
1088 Ga0307516_10364489
1089 Ga0307516_10806689
1090 Ga0307405_10664337
1091 Ga0307413_10459381
1092 Ga0307410_11876878
1093 Ga0307406_10134105
1094 Ga0307406_10715774
1095 Ga0307407_10155509
1096 Ga0307409_102017739
1097 Ga0307416_100557398
1098 Ga0307411_10290628
1099 Ga0307415_101344139
1100 Ga0307510_10002931
1101 Ga0307510_10040352
1102 Ga0307510_10254598
1103 Ga0373950_0110330
1104 Ga0373944_0110319
1105 Ga0373951_0108416
1106 Ga0373932_0052650
1107 Ga0373939_0128307
1108 Ga0373931_0016670
1109 Ga0373931_0081607
1110 Ga0373931_0235194
1111 Ga0373931_0320247
1112 Ga0373935_0117507
1113 Ga0373927_0023010
1114 Ga0373947_0255856
1115 Ga0373947_0670519
1116 Ga0373925_0062707
1117 Ga0373925_0181541
1118 Ga0395900_1169840
1119 Ga0395898_0317679
1120 Ga0395901_0299913
1121 Ga0439465_0191574
1122 Ga0451789_0784806
1123 Ga0451797_0215939
1124 Ga0451795_0796094
1125 Ga0451802_0846820
1126 Ga0451804_0062892
1127 Ga0451807_1125749
1128 Ga0451837_0562748
1129 Ga0451839_1121592
1130 Ga0451855_1314449
1131 Ga0451853_0186591
1132 Ga0451853_3272995
1133 Ga0439459_0051010
1134 Ga0495617_150913
1135 Ga0495603_0205602
1136 Ga0495629_0695446
1137 Ga0495638_0570826
1138 Ga0495641_0142418
1139 Ga0495650_0082086
1140 Ga0495582_0047327
1141 Ga0495605_0195968
1142 Ga0495639_0207618
1143 Ga0495664_0469354
1144 Ga0495585_0088687
1145 Ga0495594_0562992
1146 Ga0495596_0038327
1147 Ga0495596_0310966
1148 Ga0495607_0177935
1149 Ga0495608_0267226
1150 Ga0495616_0300795
1151 Ga0495616_0412127
1152 Ga0495620_0117213
1153 Ga0495631_0227004
1154 Ga0495632_0158350
1155 Ga0495632_0420049
1156 Ga0495643_0169788
1157 Ga0495644_0137686
1158 Ga0495644_0408655
1159 Ga0495648_0063538
1160 Ga0495663_0339993
1161 Ga0495642_0407516
1162 Ga0495654_0034844
1163 Ga0495598_0042862
1164 Ga0495609_0292031
1165 Ga0495597_0188743
1166 Ga0495633_0102378
1167 Ga0495656_0264527
1168 Ga0495668_0496565
1169 Ga0495668_0747972
1170 Ga0495611_0063986
1171 Ga0495611_0122038
1172 Ga0495625_0090908
1173 Ga0495625_0353348
1174 Ga0495625_0440551
1175 Ga0495625_0666859
1176 Ga0495661_0632356
1177 Ga0495588_0049973
1178 Ga0495588_0401415
1179 Ga0495658_0624535
1180 Ga0495669_0011057
1181 Ga0495669_0037419
1182 Ga0495624_0185668
1183 Ga0495624_0864290
1184 Ga0495670_0404779
1185 Ga0495671_0226806
1186 Ga0495671_0336165
1187 Ga0495649_0359583
1188 Ga0495649_0431753
1189 Ga0495589_0205040
1190 Ga0495589_0300433
1191 Ga0495660_0133191
1192 Ga0495581_0453186
1193 Ga0495604_0227471
1194 Ga0495636_0511874
1195 Ga0495674_0188374
1196 Ga0495674_0338663
1197 Ga0495676_0120725
1198 Ga0495683_0443407
1199 Ga0495677_0031169
1200 Ga0495679_035292
1201 Ga0495685_100834
1202 Ga0495673_0200304
1203 Ga0495681_0075815
1204 Ga0495686_0455805
1205 Ga0495593_0391735
1206 Ga0495602_0492126
1207 Ga0496100_0323874
1208 Ga0496100_1668902
1209 Ga0496101_0012724
1210 Ga0496101_0245015
1211 Ga0496101_1387914
1212 Ga0496102_0039253
1213 Ga0496102_0193445
1214 Ga0496102_0268733
1215 Ga0496102_0612105
1216 Ga0496102_0679991
1217 Ga0496102_0837274
1218 Ga0496102_1195404
1219 Ga0496103_0010521
1220 Ga0496103_0043749
1221 Ga0496103_0569136
1222 Ga0496103_1021239
1223 Ga0496104_0045947
1224 Ga0496104_0059018
1225 Ga0496104_0200041
1226 Ga0496104_0790747
1227 Ga0496105_0013417
1228 Ga0496105_0015008
1229 Ga0496106_0020169
1230 Ga0496106_0046236
1231 Ga0496106_0187458
1232 Ga0496106_0246962
1233 Ga0496107_0018119
1234 Ga0496107_0053762
1235 Ga0496107_0122953
1236 Ga0496107_0374093
1237 Ga0496108_0085368
1238 Ga0496108_0086137
1239 Ga0496108_0340063
1240 Ga0496108_0624494
1241 Ga0496108_0629545
1242 Ga0496108_0959154
1243 Ga0496109_0046895
1244 Ga0496109_0158214
1245 Ga0496109_0299783
1246 Ga0496109_0358270
1247 Ga0496110_0016079
1248 Ga0496110_0204472
1249 Ga0496110_0227804
1250 Ga0496110_0406937
1251 Ga0496111_0039170
1252 Ga0496111_0080281
1253 Ga0496111_0258520
1254 Ga0496111_0596885
1255 Ga0496112_0023082
1256 Ga0496112_0030050
1257 Ga0496112_0045416
1258 Ga0496112_0107381
1259 Ga0496112_1338800
1260 Ga0496113_0004920
1261 Ga0496113_0034345
1262 Ga0496113_0265857
1263 Ga0496113_1029656
1264 Ga0496113_1279127
1265 Ga0496114_0042300
1266 Ga0496114_0104274
1267 Ga0496114_1095367
1268 Ga0496115_0006396
1269 Ga0496115_0033912
1270 Ga0496115_0569136
1271 Ga0496115_1187753
1272 Ga0496117_0166153
1273 Ga0496118_0171404
1274 Ga0496120_0179223
1275 Ga0496121_0056722
1276 Ga0496121_0069632
1277 Ga0496121_0239856
1278 Ga0496121_0351418
1279 Ga0496121_0387609
1280 Ga0496121_0389062
1281 Ga0496125_0504953
1282 Ga0496126_0008787
1283 Ga0496126_0587040
1284 Ga0495678_082179
1285 Ga0501036_0409545
1286 Ga0501040_0752609
1287 Ga0501067_0343560
1288 Ga0501068_0349117
1289 Ga0501076_0151174
1290 nmdc:mga03n38_116720_c1
1291 nmdc:mga03n38_73348_c1
1292 nmdc:mga00v17_143251_c1
1293 nmdc:mga00v17_538834_c1
1294 nmdc:mga00v17_71280_c1
1295 nmdc:mga0yw44_1114339_c1
1296 nmdc:mga0yw44_192692_c1
1297 nmdc:mga0yw44_243685_c1
1298 nmdc:mga0yw44_25096_c1
1299 nmdc:mga0yw44_654849_c1
1300 nmdc:mga0k408_143672_c1
1301 nmdc:mga0k408_164665_c1
1302 nmdc:mga0k408_54272_c2
1303 nmdc:mga06z11_21232_c1
1304 nmdc:mga06z11_54754_c1
1305 nmdc:mga06z11_736868_c1
1306 nmdc:mga06z11_874298_c1
1307 nmdc:mga04h51_17237_c1
1308 nmdc:mga04h51_206764_c1
1309 nmdc:mga07m45_1291_c2
1310 nmdc:mga07m45_566355_c1
1311 nmdc:mga08y16_198366_c1
1312 nmdc:mga08y16_820819_c1
1313 nmdc:mga0rr50_1031276_c1
1314 nmdc:mga0a205_915762_c1
1315 nmdc:mga0sz30_203111_c1
1316 Ga0495655_0163422
1317 Ga0500643_040422
1318 Ga0500646_0376678
1319 Ga0500583_0098521
1320 Ga0500651_0730929
1321 Ga0500566_0002846
1322 Ga0500641_0002256
1323 Ga0500641_0016694
1324 Ga0500650_0410330
1325 Ga0500654_107178
1326 Ga0500554_184835
1327 Ga0500555_021515
1328 Ga0500562_136563
1329 Ga0500569_213641
1330 Ga0500595_004876
1331 Ga0500608_157113
1332 Ga0500655_010576
1333 Ga0500559_0087716
1334 Ga0500588_0070263
1335 Ga0500589_066574
1336 Ga0500590_084521
1337 Ga0500603_006533
1338 Ga0500622_0131568
1339 Ga0500627_0444403
1340 Ga0500633_0350352
1341 Ga0500634_0141638
1342 Ga0500634_0189764
1343 Ga0500637_0000171
1344 Ga0501084_1471995
1345 Ga0500661_000551
1346 2524536838
1347 2793077296
1348 2874609647
1349 2879118487
1350 2889040546
1351 2904702603
1352 2922392429
1353 8006967370
1354 8006988171
1355 8006997687
1356 8056674480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11162

DUF2946

Protein of unknown function (DUF2946)

21

131

0.93

Map