F474577

General Info

Members Datasets Scaffolds Average Seq Length
677 268 1354 136

Family's Representative Sequence

Representative Sequence 3300006163|Ga0070715_10110711|Ga0070715_101107112
Length 159
Sequence VLPPYILETVLKVPMGISNETGGAMKRTAFAVLASGLIALVTGVPAWAHHSFAAAYDTTNAITVHGVISEVLLRNPHSWFVIDVKDASGKVERWSFEAGTPSGMIRNGYKKDVIKEGAEVTIKGFRARDASQNRGMLRELTTADGKTYGMFGPQEGPGK

Samples

Sample ID Description Type Environment
1 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
187 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
188 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
192 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
203 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
204 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
205 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
206 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
207 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
217 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
218 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
223 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
229 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
267 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 1.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 2.66
Rhizosphere 95.72
Stem 0
Stem Tuber 0
Unclassified 31.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070715_10110711 3300006163 Bacteria 1295
2 JGI24746J21847_1003537 3300001977 Bacteria 2462
3 JGI24749J21850_1073633 3300002076 Unclassified 530
4 JGI24035J26624_1041443 3300002126 Unclassified 515
5 JGI25406J46586_10000079 3300003203 Bacteria 43904
6 Ga0058859_11501312 3300004798 Unclassified 702
7 Ga0058860_10525193 3300004801 Unclassified 533
8 Ga0065712_10333200 3300005290 Bacteria 811
9 Ga0065715_10007395 3300005293 Bacteria 5916
10 Ga0065707_10512083 3300005295 Unclassified 749
11 Ga0070676_10012281 3300005328 Unclassified 4671
12 Ga0070676_10103226 3300005328 Bacteria 1765
13 Ga0070683_100008852 3300005329 Bacteria 8568
14 Ga0070683_100016107 3300005329 Bacteria 6581
15 Ga0070683_100023384 3300005329 Bacteria 5527
16 Ga0070683_101271661 3300005329 Unclassified 707
17 Ga0070690_100017642 3300005330 Bacteria 4297
18 Ga0070690_100102963 3300005330 Bacteria 1895
19 Ga0070690_100293089 3300005330 Bacteria 1164
20 Ga0070670_100001227 3300005331 Bacteria 20386
21 Ga0070670_100027891 3300005331 Bacteria 4859
22 Ga0070670_100546119 3300005331 Bacteria 1033
23 Ga0068869_100006419 3300005334 Bacteria 7457
24 Ga0068869_100056203 3300005334 Bacteria 2870
25 Ga0068869_100101990 3300005334 Unclassified 2171
26 Ga0068869_101001928 3300005334 Bacteria 727
27 Ga0070666_10003678 3300005335 Bacteria 9292
28 Ga0070666_10212479 3300005335 Bacteria 1363
29 Ga0070680_100038331 3300005336 Bacteria 3876
30 Ga0070680_100719591 3300005336 Unclassified 859
31 Ga0070682_100904273 3300005337 Bacteria 726
32 Ga0070682_101240881 3300005337 Unclassified 631
33 Ga0068868_100013382 3300005338 Bacteria 6018
34 Ga0068868_100036508 3300005338 Bacteria 3804
35 Ga0068868_100058600 3300005338 Bacteria 3044
36 Ga0068868_101493998 3300005338 Bacteria 632
37 Ga0070660_100093144 3300005339 Bacteria 2379
38 Ga0070660_100402013 3300005339 Unclassified 1133
39 Ga0070689_100025649 3300005340 Bacteria 4430
40 Ga0070689_100067203 3300005340 Bacteria 2794
41 Ga0070689_100070875 3300005340 Unclassified 2722
42 Ga0070689_100237477 3300005340 Unclassified 1500
43 Ga0070689_100501633 3300005340 Bacteria 1040
44 Ga0070689_100738594 3300005340 Unclassified 862
45 Ga0070691_10000025 3300005341 Bacteria 41015
46 Ga0070691_10771866 3300005341 Bacteria 583
47 Ga0070687_100020925 3300005343 Bacteria 3067
48 Ga0070687_100161646 3300005343 Unclassified 1324
49 Ga0070687_100543430 3300005343 Bacteria 789
50 Ga0070687_100647937 3300005343 Unclassified 732
51 Ga0070661_100015944 3300005344 Bacteria 5303
52 Ga0070661_100173815 3300005344 Bacteria 1637
53 Ga0070692_10187017 3300005345 Unclassified 1204
54 Ga0070692_10233683 3300005345 Bacteria 1093
55 Ga0070692_10488947 3300005345 Unclassified 795
56 Ga0070668_100038449 3300005347 Bacteria 3657
57 Ga0070669_100009639 3300005353 Bacteria 6878
58 Ga0070669_100092046 3300005353 Bacteria 2275
59 Ga0070669_100577250 3300005353 Unclassified 940
60 Ga0070669_101017313 3300005353 Unclassified 711
61 Ga0070675_100000982 3300005354 Bacteria 20393
62 Ga0070675_100003424 3300005354 Bacteria 12016
63 Ga0070675_100007422 3300005354 Bacteria 8469
64 Ga0070675_100022772 3300005354 Bacteria 5006
65 Ga0070675_100063916 3300005354 Unclassified 3043
66 Ga0070675_100268720 3300005354 Unclassified 1496
67 Ga0070671_100093634 3300005355 Bacteria 2518
68 Ga0070671_100184318 3300005355 Unclassified 1768
69 Ga0070671_100188146 3300005355 Bacteria 1749
70 Ga0070671_100340395 3300005355 Unclassified 1280
71 Ga0070671_101151008 3300005355 Unclassified 682
72 Ga0070674_100290089 3300005356 Bacteria 1300
73 Ga0070674_100445259 3300005356 Bacteria 1068
74 Ga0070674_100584641 3300005356 Unclassified 941
75 Ga0070673_100008570 3300005364 Bacteria 6806
76 Ga0070673_100014439 3300005364 Bacteria 5502
77 Ga0070673_100122759 3300005364 Bacteria 2169
78 Ga0070673_100131606 3300005364 Bacteria 2100
79 Ga0070673_100511938 3300005364 Unclassified 1087
80 Ga0070673_101904973 3300005364 Bacteria 564
81 Ga0070688_100100681 3300005365 Unclassified 1905
82 Ga0070659_100034053 3300005366 Bacteria 3961
83 Ga0070659_100268205 3300005366 Bacteria 1418
84 Ga0070667_100002779 3300005367 Bacteria 15108
85 Ga0070667_100031021 3300005367 Bacteria 4457
86 Ga0070667_100064274 3300005367 Unclassified 3113
87 Ga0070667_100779487 3300005367 Bacteria 887
88 Ga0070703_10079808 3300005406 Bacteria 1112
89 Ga0070709_10111461 3300005434 Unclassified 1840
90 Ga0070713_100265937 3300005436 Bacteria 1569
91 Ga0070701_10032548 3300005438 Bacteria 2598
92 Ga0070701_10229348 3300005438 Unclassified 1111
93 Ga0070701_10474833 3300005438 Unclassified 807
94 Ga0070711_100119494 3300005439 Bacteria 1947
95 Ga0070705_100672790 3300005440 Unclassified 810
96 Ga0070700_100037732 3300005441 Bacteria 2941
97 Ga0070694_100088856 3300005444 Bacteria 2164
98 Ga0070694_100187031 3300005444 Bacteria 1535
99 Ga0070694_100337585 3300005444 Bacteria 1164
100 Ga0070694_100356125 3300005444 Bacteria 1135
101 Ga0070694_101847637 3300005444 Unclassified 515
102 Ga0070708_100150790 3300005445 Bacteria 2162
103 Ga0070708_100935973 3300005445 Unclassified 813
104 Ga0070663_100141066 3300005455 Unclassified 1840
105 Ga0070663_101736902 3300005455 Unclassified 558
106 Ga0070678_100078895 3300005456 Bacteria 2488
107 Ga0070678_101745687 3300005456 Bacteria 586
108 Ga0070662_100052527 3300005457 Bacteria 2947
109 Ga0070662_101455126 3300005457 Unclassified 591
110 Ga0070681_10001329 3300005458 Bacteria 21604
111 Ga0070681_10633177 3300005458 Bacteria 984
112 Ga0070681_11664038 3300005458 Bacteria 564
113 Ga0068867_100079246 3300005459 Bacteria 2472
114 Ga0068867_100337771 3300005459 Unclassified 1253
115 Ga0068867_100371677 3300005459 Bacteria 1199
116 Ga0070685_10015580 3300005466 Bacteria 4039
117 Ga0070685_10023483 3300005466 Bacteria 3377
118 Ga0070685_11359885 3300005466 Bacteria 544
119 Ga0070707_100019810 3300005468 Bacteria 6342
120 Ga0070707_100480452 3300005468 Unclassified 1204
121 Ga0070698_100318782 3300005471 Bacteria 1485
122 Ga0070698_100797589 3300005471 Archaea 888
123 Ga0070699_100002432 3300005518 Bacteria 16705
124 Ga0070679_100002806 3300005530 Bacteria 15824
125 Ga0070684_100079900 3300005535 Bacteria 2892
126 Ga0070684_100161485 3300005535 Bacteria 2033
127 Ga0070684_100797490 3300005535 Bacteria 883
128 Ga0068853_100033006 3300005539 Bacteria 4389
129 Ga0068853_100106413 3300005539 Bacteria 2486
130 Ga0068853_100226012 3300005539 Unclassified 1711
131 Ga0068853_100664782 3300005539 Bacteria 992
132 Ga0070672_100218298 3300005543 Bacteria 1599
133 Ga0070672_100241537 3300005543 Unclassified 1519
134 Ga0070672_100252859 3300005543 Bacteria 1484
135 Ga0070672_100261415 3300005543 Bacteria 1460
136 Ga0070686_100010144 3300005544 Bacteria 5301
137 Ga0070686_100041087 3300005544 Bacteria 2889
138 Ga0070686_100047250 3300005544 Bacteria 2721
139 Ga0070686_100047807 3300005544 Bacteria 2707
140 Ga0070686_100053993 3300005544 Bacteria 2568
141 Ga0070695_100652391 3300005545 Unclassified 831
142 Ga0070695_101364499 3300005545 Bacteria 587
143 Ga0070665_100012089 3300005548 Bacteria 8710
144 Ga0070665_100211489 3300005548 Bacteria 1940
145 Ga0070665_100231190 3300005548 Bacteria 1849
146 Ga0070665_100901524 3300005548 Unclassified 897
147 Ga0070704_100174311 3300005549 Unclassified 1714
148 Ga0070704_100409742 3300005549 Bacteria 1158
149 Ga0068855_100002727 3300005563 Bacteria 21764
150 Ga0068855_100030314 3300005563 Bacteria 6470
151 Ga0070664_100000440 3300005564 Bacteria 31260
152 Ga0070664_100039550 3300005564 Bacteria 3974
153 Ga0070664_100312990 3300005564 Bacteria 1421
154 Ga0070664_100844280 3300005564 Unclassified 857
155 Ga0070664_101471215 3300005564 Bacteria 644
156 Ga0068857_100006026 3300005577 Bacteria 10352
157 Ga0068857_100019393 3300005577 Bacteria 5971
158 Ga0068857_100505546 3300005577 Unclassified 1134
159 Ga0068854_100614974 3300005578 Unclassified 929
160 Ga0068854_101006655 3300005578 Bacteria 738
161 Ga0068856_100031674 3300005614 Bacteria 5175
162 Ga0068856_100341922 3300005614 Bacteria 1515
163 Ga0070702_100750925 3300005615 Unclassified 749
164 Ga0070702_101017053 3300005615 Unclassified 657
165 Ga0068852_100005439 3300005616 Bacteria 9105
166 Ga0068852_101356674 3300005616 Bacteria 733
167 Ga0068852_101540700 3300005616 Unclassified 687
168 Ga0068859_100004489 3300005617 Bacteria 14237
169 Ga0068859_100075292 3300005617 Bacteria 3416
170 Ga0068859_101199363 3300005617 Unclassified 836
171 Ga0068859_101755698 3300005617 Unclassified 685
172 Ga0068864_100157014 3300005618 Unclassified 2065
173 Ga0068864_100310853 3300005618 Bacteria 1477
174 Ga0068864_100377221 3300005618 Bacteria 1343
175 Ga0068864_101273801 3300005618 Bacteria 735
176 Ga0068864_102496366 3300005618 Bacteria 523
177 Ga0068861_100014008 3300005719 Bacteria 5623
178 Ga0068861_100044877 3300005719 Bacteria 3326
179 Ga0068861_100176232 3300005719 Bacteria 1776
180 Ga0068861_100459970 3300005719 Unclassified 1142
181 Ga0068861_100590451 3300005719 Unclassified 1018
182 Ga0068851_10652488 3300005834 Unclassified 644
183 Ga0068870_10000383 3300005840 Bacteria 16597
184 Ga0068870_10319412 3300005840 Bacteria 986
185 Ga0068870_10643885 3300005840 Unclassified 725
186 Ga0068863_100002133 3300005841 Bacteria 19630
187 Ga0068863_100101987 3300005841 Unclassified 2728
188 Ga0068863_100205980 3300005841 Unclassified 1893
189 Ga0068863_100248198 3300005841 Bacteria 1719
190 Ga0068863_100486201 3300005841 Unclassified 1215
191 Ga0068863_101138128 3300005841 Bacteria 785
192 Ga0068858_100055177 3300005842 Bacteria 3672
193 Ga0068858_100116546 3300005842 Bacteria 2496
194 Ga0068858_100256851 3300005842 Bacteria 1660
195 Ga0068858_100288113 3300005842 Bacteria 1565
196 Ga0068858_100294504 3300005842 Bacteria 1547
197 Ga0068858_100439876 3300005842 Bacteria 1256
198 Ga0068858_100556265 3300005842 Bacteria 1111
199 Ga0068860_100007078 3300005843 Bacteria 11225
200 Ga0068860_100199408 3300005843 Bacteria 1939
201 Ga0068860_100254769 3300005843 Unclassified 1710
202 Ga0068860_100418578 3300005843 Bacteria 1328
203 Ga0068860_100720420 3300005843 Bacteria 1008
204 Ga0068862_100032498 3300005844 Bacteria 4409
205 Ga0068862_100102532 3300005844 Bacteria 2505
206 Ga0081455_10721374 3300005937 Unclassified 633
207 Ga0081539_10000089 3300005985 Bacteria 212146
208 Ga0070717_10491086 3300006028 Bacteria 1109
209 Ga0070715_10290917 3300006163 Unclassified 870
210 Ga0070712_100261728 3300006175 Bacteria 1386
211 Ga0097621_100011342 3300006237 Bacteria 6556
212 Ga0097621_100012115 3300006237 Bacteria 6380
213 Ga0097621_100209828 3300006237 Bacteria 1694
214 Ga0097621_100341664 3300006237 Bacteria 1329
215 Ga0097621_100795245 3300006237 Bacteria 876
216 Ga0068871_100032704 3300006358 Bacteria 4112
217 Ga0068871_100037139 3300006358 Bacteria 3883
218 Ga0068871_100066993 3300006358 Bacteria 2944
219 Ga0068871_100097999 3300006358 Bacteria 2452
220 Ga0068871_100145516 3300006358 Bacteria 2017
221 Ga0068871_100154781 3300006358 Unclassified 1957
222 Ga0068871_100211515 3300006358 Bacteria 1677
223 Ga0068871_100256344 3300006358 Bacteria 1525
224 Ga0068871_100339205 3300006358 Bacteria 1327
225 Ga0075428_100032591 3300006844 Bacteria 5755
226 Ga0075428_100552451 3300006844 Unclassified 1231
227 Ga0075430_100125638 3300006846 Bacteria 2138
228 Ga0075430_101070865 3300006846 Unclassified 664
229 Ga0075431_100441473 3300006847 Unclassified 1298
230 Ga0075433_10003942 3300006852 Bacteria 11492
231 Ga0075433_10033092 3300006852 Bacteria 4430
232 Ga0075433_10106541 3300006852 Bacteria 2485
233 Ga0075434_100005546 3300006871 Bacteria 11498
234 Ga0075434_100259148 3300006871 Bacteria 1758
235 Ga0068865_100080649 3300006881 Bacteria 2334
236 Ga0068865_100089051 3300006881 Bacteria 2234
237 Ga0068865_100105357 3300006881 Bacteria 2071
238 Ga0068865_101003566 3300006881 Unclassified 731
239 Ga0068865_101119064 3300006881 Bacteria 694
240 Ga0075436_101145674 3300006914 Unclassified 586
241 Ga0097620_100004489 3300006931 Bacteria 14237
242 Ga0097620_100075292 3300006931 Bacteria 3416
243 Ga0097620_101199393 3300006931 Unclassified 836
244 Ga0097620_101755794 3300006931 Unclassified 685
245 Ga0075435_100352326 3300007076 Bacteria 1262
246 Ga0105240_10002487 3300009093 Bacteria 29604
247 Ga0105240_10043597 3300009093 Bacteria 5706
248 Ga0105240_10329273 3300009093 Unclassified 1738
249 Ga0105240_10551304 3300009093 Bacteria 1275
250 Ga0111539_10009157 3300009094 Bacteria 12521
251 Ga0111539_10009960 3300009094 Bacteria 11985
252 Ga0111539_10281306 3300009094 Bacteria 1936
253 Ga0111539_10506803 3300009094 Bacteria 1406
254 Ga0111539_10745548 3300009094 Bacteria 1140
255 Ga0105245_10000428 3300009098 Bacteria 39167
256 Ga0105245_10011520 3300009098 Bacteria 7701
257 Ga0105245_10025047 3300009098 Bacteria 5245
258 Ga0105245_10167235 3300009098 Unclassified 2091
259 Ga0105245_10826525 3300009098 Unclassified 965
260 Ga0105245_10979529 3300009098 Bacteria 889
261 Ga0105245_11374801 3300009098 Bacteria 756
262 Ga0105245_12142322 3300009098 Bacteria 613
263 Ga0105245_13191658 3300009098 Unclassified 508
264 Ga0105247_10016148 3300009101 Bacteria 4474
265 Ga0105247_10879952 3300009101 Unclassified 690
266 Ga0114129_10030633 3300009147 Bacteria 7611
267 Ga0114129_12112017 3300009147 Bacteria 679
268 Ga0105243_10200115 3300009148 Unclassified 1751
269 Ga0105243_10673155 3300009148 Unclassified 1005
270 Ga0105243_12556706 3300009148 Unclassified 550
271 Ga0105241_10021400 3300009174 Bacteria 4780
272 Ga0105241_10084909 3300009174 Bacteria 2487
273 Ga0105241_10336460 3300009174 Unclassified 1306
274 Ga0105241_10739514 3300009174 Unclassified 901
275 Ga0105242_10007430 3300009176 Bacteria 8436
276 Ga0105242_10075968 3300009176 Bacteria 2799
277 Ga0105242_10672692 3300009176 Bacteria 1009
278 Ga0105242_12847584 3300009176 Unclassified 534
279 Ga0105242_12990012 3300009176 Unclassified 523
280 Ga0105248_10000212 3300009177 Bacteria 67170
281 Ga0105248_10025213 3300009177 Bacteria 6610
282 Ga0105248_10040934 3300009177 Bacteria 5195
283 Ga0105248_10380834 3300009177 Bacteria 1588
284 Ga0105248_10421388 3300009177 Bacteria 1503
285 Ga0105248_10442419 3300009177 Bacteria 1464
286 Ga0105248_10865704 3300009177 Bacteria 1020
287 Ga0105237_10001547 3300009545 Bacteria 30034
288 Ga0105237_10068458 3300009545 Bacteria 3543
289 Ga0105237_10629768 3300009545 Unclassified 1079
290 Ga0105237_10651585 3300009545 Bacteria 1060
291 Ga0105237_10807218 3300009545 Unclassified 945
292 Ga0105237_10874418 3300009545 Bacteria 906
293 Ga0105237_11175668 3300009545 Bacteria 774
294 Ga0105238_10002934 3300009551 Bacteria 17017
295 Ga0105238_10019933 3300009551 Bacteria 6826
296 Ga0105238_10095088 3300009551 Bacteria 2967
297 Ga0105238_10125672 3300009551 Bacteria 2543
298 Ga0105238_11038187 3300009551 Unclassified 841
299 Ga0105249_10056915 3300009553 Bacteria 3580
300 Ga0105249_10087348 3300009553 Unclassified 2909
301 Ga0105249_10246466 3300009553 Unclassified 1769
302 Ga0105249_10500383 3300009553 Bacteria 1260
303 Ga0105249_10936732 3300009553 Bacteria 934
304 Ga0105239_10000502 3300010375 Bacteria 56682
305 Ga0105239_10119390 3300010375 Unclassified 2926
306 Ga0105239_10196640 3300010375 Bacteria 2258
307 Ga0105246_10217279 3300011119 Bacteria 1496
308 Ga0105246_10732228 3300011119 Unclassified 870
309 Ga0105246_11116892 3300011119 Unclassified 721
310 Ga0157370_10005766 3300013104 Bacteria 13840
311 Ga0157370_10033139 3300013104 Bacteria 5036
312 Ga0157369_10002864 3300013105 Bacteria 20600
313 Ga0157369_10017489 3300013105 Bacteria 8057
314 Ga0157369_10344550 3300013105 Bacteria 1548
315 Ga0157369_10555204 3300013105 Bacteria 1187
316 Ga0157374_10058430 3300013296 Bacteria 3604
317 Ga0157374_10171688 3300013296 Bacteria 2115
318 Ga0157374_10687208 3300013296 Unclassified 1036
319 Ga0157378_10000890 3300013297 Bacteria 27558
320 Ga0157378_10348606 3300013297 Bacteria 1446
321 Ga0163162_10001964 3300013306 Bacteria 19322
322 Ga0163162_10007319 3300013306 Bacteria 10729
323 Ga0163162_10153958 3300013306 Bacteria 2418
324 Ga0163162_10184888 3300013306 Bacteria 2211
325 Ga0163162_10463309 3300013306 Bacteria 1399
326 Ga0163162_10538752 3300013306 Bacteria 1296
327 Ga0163162_10557640 3300013306 Bacteria 1274
328 Ga0163162_12156999 3300013306 Unclassified 639
329 Ga0157372_10005353 3300013307 Bacteria 13633
330 Ga0157372_10056075 3300013307 Bacteria 4403
331 Ga0157372_10122255 3300013307 Unclassified 2991
332 Ga0157375_10001322 3300013308 Bacteria 21380
333 Ga0157375_10041907 3300013308 Bacteria 4425
334 Ga0157375_10055772 3300013308 Bacteria 3897
335 Ga0157375_10111175 3300013308 Bacteria 2838
336 Ga0157375_10170271 3300013308 Bacteria 2325
337 Ga0157375_10264333 3300013308 Bacteria 1882
338 Ga0157375_11033986 3300013308 Unclassified 960
339 Ga0157375_12503210 3300013308 Bacteria 616
340 Ga0163163_10000353 3300014325 Bacteria 44237
341 Ga0163163_10031788 3300014325 Bacteria 5097
342 Ga0163163_10045885 3300014325 Unclassified 4291
343 Ga0163163_10062979 3300014325 Bacteria 3676
344 Ga0163163_10644804 3300014325 Bacteria 1123
345 Ga0163163_11934400 3300014325 Unclassified 650
346 Ga0157380_10015557 3300014326 Bacteria 5593
347 Ga0157380_10539620 3300014326 Bacteria 1142
348 Ga0157377_10331411 3300014745 Bacteria 1015
349 Ga0157379_10060381 3300014968 Bacteria 3389
350 Ga0157379_10085369 3300014968 Bacteria 2829
351 Ga0157379_10364784 3300014968 Bacteria 1324
352 Ga0157379_12139061 3300014968 Unclassified 555
353 Ga0157376_10007288 3300014969 Bacteria 7878
354 Ga0157376_10191713 3300014969 Bacteria 1875
355 Ga0157376_10630131 3300014969 Bacteria 1070
356 Ga0157376_11509507 3300014969 Bacteria 705
357 Ga0157376_11875001 3300014969 Unclassified 636
358 Ga0163161_10291818 3300017792 Bacteria 1282
359 Ga0206356_10142031 3300020070 Unclassified 501
360 Ga0213875_10006618 3300021388 Bacteria 6057
361 Ga0213875_10006844 3300021388 Bacteria 5948
362 Ga0207697_10002888 3300025315 Bacteria 8699
363 Ga0207642_10016690 3300025899 Bacteria 2773
364 Ga0207642_10394737 3300025899 Bacteria 826
365 Ga0207680_10097492 3300025903 Bacteria 1883
366 Ga0207680_10134684 3300025903 Bacteria 1632
367 Ga0207680_10182566 3300025903 Unclassified 1420
368 Ga0207645_10004565 3300025907 Bacteria 10223
369 Ga0207645_10089406 3300025907 Bacteria 1981
370 Ga0207643_10000940 3300025908 Bacteria 17466
371 Ga0207643_10307800 3300025908 Bacteria 987
372 Ga0207654_10023845 3300025911 Bacteria 3283
373 Ga0207654_10209209 3300025911 Unclassified 1288
374 Ga0207654_10530674 3300025911 Unclassified 834
375 Ga0207707_10001181 3300025912 Bacteria 24586
376 Ga0207695_10000808 3300025913 Bacteria 58272
377 Ga0207695_10005259 3300025913 Bacteria 17272
378 Ga0207695_11068415 3300025913 Unclassified 687
379 Ga0207671_10010883 3300025914 Bacteria 7458
380 Ga0207671_10426324 3300025914 Bacteria 1055
381 Ga0207671_10580991 3300025914 Unclassified 893
382 Ga0207671_10840898 3300025914 Bacteria 727
383 Ga0207693_10184278 3300025915 Bacteria 1643
384 Ga0207663_11098839 3300025916 Bacteria 639
385 Ga0207660_10042145 3300025917 Bacteria 3202
386 Ga0207660_10182481 3300025917 Bacteria 1630
387 Ga0207662_10004469 3300025918 Bacteria 7360
388 Ga0207662_10090726 3300025918 Bacteria 1879
389 Ga0207662_10401871 3300025918 Unclassified 929
390 Ga0207662_10862620 3300025918 Bacteria 640
391 Ga0207657_10457484 3300025919 Unclassified 1001
392 Ga0207649_10234154 3300025920 Bacteria 1315
393 Ga0207649_10466859 3300025920 Unclassified 955
394 Ga0207646_10002428 3300025922 Bacteria 21990
395 Ga0207646_10411597 3300025922 Unclassified 1221
396 Ga0207646_10998899 3300025922 Unclassified 739
397 Ga0207681_10022969 3300025923 Unclassified 3983
398 Ga0207681_10061493 3300025923 Bacteria 2582
399 Ga0207681_10999056 3300025923 Unclassified 702
400 Ga0207694_10005318 3300025924 Bacteria 9920
401 Ga0207694_10060646 3300025924 Bacteria 2944
402 Ga0207694_10128092 3300025924 Bacteria 2032
403 Ga0207650_10018703 3300025925 Bacteria 4865
404 Ga0207650_10059540 3300025925 Bacteria 2847
405 Ga0207650_10186435 3300025925 Bacteria 1655
406 Ga0207650_11688465 3300025925 Unclassified 537
407 Ga0207659_10017761 3300025926 Bacteria 4651
408 Ga0207659_10045355 3300025926 Unclassified 3099
409 Ga0207659_10054863 3300025926 Bacteria 2847
410 Ga0207659_10264160 3300025926 Bacteria 1401
411 Ga0207659_10611144 3300025926 Unclassified 930
412 Ga0207687_10004561 3300025927 Bacteria 9219
413 Ga0207687_10010183 3300025927 Bacteria 6143
414 Ga0207687_10021860 3300025927 Bacteria 4252
415 Ga0207687_10050389 3300025927 Bacteria 2898
416 Ga0207687_10303929 3300025927 Bacteria 1286
417 Ga0207687_10570887 3300025927 Bacteria 951
418 Ga0207687_10905493 3300025927 Bacteria 755
419 Ga0207700_10027774 3300025928 Bacteria 3969
420 Ga0207664_11102747 3300025929 Unclassified 709
421 Ga0207644_10040170 3300025931 Bacteria 3306
422 Ga0207644_10201474 3300025931 Bacteria 1570
423 Ga0207644_10811991 3300025931 Bacteria 782
424 Ga0207690_10074833 3300025932 Bacteria 2347
425 Ga0207706_10267578 3300025933 Unclassified 1492
426 Ga0207706_10283500 3300025933 Bacteria 1444
427 Ga0207706_10367680 3300025933 Unclassified 1249
428 Ga0207706_10436829 3300025933 Bacteria 1133
429 Ga0207709_10540837 3300025935 Unclassified 915
430 Ga0207709_10639635 3300025935 Unclassified 846
431 Ga0207670_10066186 3300025936 Unclassified 2482
432 Ga0207670_10124024 3300025936 Bacteria 1882
433 Ga0207670_10129213 3300025936 Unclassified 1848
434 Ga0207670_10504163 3300025936 Bacteria 983
435 Ga0207670_10664649 3300025936 Bacteria 860
436 Ga0207669_10318008 3300025937 Bacteria 1190
437 Ga0207669_10681412 3300025937 Archaea 843
438 Ga0207704_10155227 3300025938 Bacteria 1621
439 Ga0207704_11483731 3300025938 Bacteria 582
440 Ga0207691_10006797 3300025940 Bacteria 11030
441 Ga0207691_10013026 3300025940 Bacteria 7963
442 Ga0207691_10081666 3300025940 Bacteria 2905
443 Ga0207691_10097488 3300025940 Bacteria 2628
444 Ga0207691_10121868 3300025940 Bacteria 2310
445 Ga0207691_10655899 3300025940 Unclassified 886
446 Ga0207711_10001566 3300025941 Bacteria 21136
447 Ga0207711_10006540 3300025941 Bacteria 9813
448 Ga0207711_10029081 3300025941 Unclassified 4658
449 Ga0207711_10098718 3300025941 Bacteria 2580
450 Ga0207711_10202023 3300025941 Bacteria 1814
451 Ga0207711_10214474 3300025941 Unclassified 1759
452 Ga0207711_10251647 3300025941 Bacteria 1622
453 Ga0207711_10380971 3300025941 Bacteria 1309
454 Ga0207689_10000995 3300025942 Bacteria 27159
455 Ga0207689_10029298 3300025942 Bacteria 4598
456 Ga0207689_10146309 3300025942 Bacteria 1947
457 Ga0207689_10600386 3300025942 Bacteria 926
458 Ga0207661_10012167 3300025944 Bacteria 6248
459 Ga0207661_10061058 3300025944 Bacteria 3044
460 Ga0207661_10307013 3300025944 Bacteria 1423
461 Ga0207679_10035422 3300025945 Unclassified 3531
462 Ga0207679_10092462 3300025945 Bacteria 2344
463 Ga0207679_10335663 3300025945 Unclassified 1313
464 Ga0207679_10768235 3300025945 Unclassified 877
465 Ga0207667_10000673 3300025949 Bacteria 44277
466 Ga0207667_10002992 3300025949 Bacteria 20996
467 Ga0207651_10006146 3300025960 Bacteria 6246
468 Ga0207651_10006379 3300025960 Bacteria 6167
469 Ga0207651_10025172 3300025960 Bacteria 3696
470 Ga0207651_10044834 3300025960 Bacteria 2963
471 Ga0207651_10104679 3300025960 Bacteria 2109
472 Ga0207651_10276962 3300025960 Unclassified 1384
473 Ga0207712_10002476 3300025961 Bacteria 11900
474 Ga0207668_10020245 3300025972 Bacteria 4223
475 Ga0207640_10397587 3300025981 Unclassified 1121
476 Ga0207640_11427417 3300025981 Unclassified 621
477 Ga0207658_10012978 3300025986 Bacteria 5690
478 Ga0207658_10014416 3300025986 Bacteria 5412
479 Ga0207658_11530848 3300025986 Unclassified 610
480 Ga0207677_10062080 3300026023 Bacteria 2591
481 Ga0207677_10131044 3300026023 Unclassified 1904
482 Ga0207677_10412013 3300026023 Bacteria 1149
483 Ga0207677_10598722 3300026023 Unclassified 967
484 Ga0207677_10624970 3300026023 Bacteria 948
485 Ga0207677_10763596 3300026023 Unclassified 863
486 Ga0207677_10889000 3300026023 Bacteria 802
487 Ga0207703_10011912 3300026035 Bacteria 6772
488 Ga0207703_10067327 3300026035 Bacteria 2947
489 Ga0207703_10172154 3300026035 Bacteria 1905
490 Ga0207703_10265734 3300026035 Bacteria 1552
491 Ga0207703_10293122 3300026035 Unclassified 1481
492 Ga0207703_10801676 3300026035 Unclassified 899
493 Ga0207703_10936167 3300026035 Unclassified 830
494 Ga0207639_10019077 3300026041 Bacteria 4884
495 Ga0207639_10555542 3300026041 Unclassified 1054
496 Ga0207639_10783172 3300026041 Bacteria 888
497 Ga0207678_10075438 3300026067 Bacteria 2889
498 Ga0207708_10031555 3300026075 Bacteria 4022
499 Ga0207708_10917783 3300026075 Unclassified 758
500 Ga0207702_10088623 3300026078 Bacteria 2704
501 Ga0207702_10141105 3300026078 Bacteria 2180
502 Ga0207702_10170162 3300026078 Bacteria 1997
503 Ga0207641_10013094 3300026088 Bacteria 6802
504 Ga0207641_10024183 3300026088 Bacteria 5007
505 Ga0207641_10820665 3300026088 Unclassified 921
506 Ga0207641_11601131 3300026088 Unclassified 653
507 Ga0207648_10105109 3300026089 Bacteria 2477
508 Ga0207648_10105663 3300026089 Bacteria 2470
509 Ga0207648_11170736 3300026089 Bacteria 722
510 Ga0207648_12193171 3300026089 Unclassified 513
511 Ga0207676_10012329 3300026095 Bacteria 6121
512 Ga0207676_10291579 3300026095 Bacteria 1486
513 Ga0207676_10298536 3300026095 Bacteria 1470
514 Ga0207676_10594835 3300026095 Bacteria 1062
515 Ga0207674_10011373 3300026116 Bacteria 10002
516 Ga0207675_100023224 3300026118 Bacteria 5767
517 Ga0207675_100067950 3300026118 Bacteria 3331
518 Ga0207675_100148253 3300026118 Unclassified 2232
519 Ga0207675_100363568 3300026118 Unclassified 1420
520 Ga0207675_100651810 3300026118 Bacteria 1059
521 Ga0207675_101260269 3300026118 Unclassified 760
522 Ga0207683_10029317 3300026121 Bacteria 4764
523 Ga0207683_10112208 3300026121 Bacteria 2442
524 Ga0207683_11010728 3300026121 Bacteria 772
525 Ga0207698_10004976 3300026142 Bacteria 8147
526 Ga0207428_10003781 3300027907 Bacteria 14520
527 Ga0207428_10198559 3300027907 Bacteria 1510
528 Ga0207428_10253346 3300027907 Bacteria 1312
529 Ga0268266_10045056 3300028379 Bacteria 3772
530 Ga0268265_10082554 3300028380 Bacteria 2541
531 Ga0268265_10382625 3300028380 Bacteria 1295
532 Ga0268265_10502455 3300028380 Bacteria 1143
533 Ga0268265_10799387 3300028380 Unclassified 919
534 Ga0268264_10017863 3300028381 Bacteria 5806
535 Ga0268264_10019941 3300028381 Bacteria 5477
536 Ga0268264_10078341 3300028381 Bacteria 2818
537 Ga0268264_10222732 3300028381 Bacteria 1737
538 Ga0268264_11199699 3300028381 Bacteria 768
539 Ga0265777_120905 3300030877 Unclassified 540
540 Ga0265760_10075869 3300031090 Unclassified 1036
541 Ga0265330_10241337 3300031235 Unclassified 762
542 Ga0265340_10006447 3300031247 Bacteria 6459
543 Ga0265331_10158601 3300031250 Unclassified 1026
544 Ga0307408_102295918 3300031548 Unclassified 522
545 Ga0307409_102411614 3300031995 Unclassified 555
546 Ga0373934_0092294 3300035086 Bacteria 1221
547 Ga0373951_0194625 3300035091 Unclassified 588
548 Ga0373932_0013001 3300035112 Bacteria 2061
549 Ga0373953_0310460 3300035117 Bacteria 689
550 Ga0373954_0081331 3300035118 Bacteria 1548
551 Ga0373957_0054679 3300035120 Bacteria 1534
552 Ga0373960_0005181 3300035121 Bacteria 3013
553 Ga0373943_0172465 3300035170 Bacteria 1184
554 Ga0373946_0209954 3300035171 Unclassified 936
555 Ga0373955_0086463 3300035172 Bacteria 1781
556 Ga0373955_0288008 3300035172 Unclassified 989
557 Ga0373931_0103428 3300035691 Unclassified 1605
558 Ga0373927_0570934 3300035695 Bacteria 748
559 Ga0373933_0017079 3300035724 Bacteria 4069
560 Ga0373933_0882927 3300035724 Bacteria 589
561 Ga0373947_0315735 3300035725 Bacteria 1044
562 Ga0373947_0815054 3300035725 Bacteria 637
563 Ga0373937_0001838 3300036401 Bacteria 17833
564 Ga0373937_0062455 3300036401 Bacteria 3425
565 Ga0373937_0067013 3300036401 Unclassified 3307
566 Ga0373937_0231155 3300036401 Unclassified 1742
567 Ga0373937_0260892 3300036401 Unclassified 1634
568 Ga0373937_0309408 3300036401 Bacteria 1494
569 Ga0436364_0034860 3300037853 Bacteria 13671
570 Ga0436364_0192434 3300037853 Bacteria 4801
571 Ga0436362_0041599 3300039453 Unclassified 647
572 Ga0436362_0948343 3300039453 Unclassified 627
573 Ga0451802_1590899 3300041460 Unclassified 659
574 Ga0451807_0319198 3300041486 Bacteria 1231
575 Ga0451807_2611652 3300041486 Unclassified 874
576 Ga0451845_0385874 3300041501 Unclassified 773
577 Ga0451849_0960742 3300041505 Bacteria 539
578 Ga0451853_2276761 3300041512 Unclassified 928
579 Ga0451853_2629545 3300041512 Unclassified 500
580 Ga0451576_0050435 3300045051 Unclassified 4364
581 Ga0495592_0218289 3300046454 Unclassified 1276
582 Ga0495603_0202881 3300046455 Bacteria 1146
583 Ga0495603_0411311 3300046455 Bacteria 775
584 Ga0495603_0418545 3300046455 Unclassified 768
585 Ga0495629_0256443 3300046459 Bacteria 1203
586 Ga0495629_1139274 3300046459 Unclassified 503
587 Ga0495651_0282432 3300046462 Bacteria 1121
588 Ga0495651_0601316 3300046462 Unclassified 694
589 Ga0495653_0710510 3300046463 Unclassified 610
590 Ga0495580_0106434 3300046472 Bacteria 1948
591 Ga0495580_0192104 3300046472 Bacteria 1408
592 Ga0495582_0922675 3300046473 Unclassified 505
593 Ga0495639_0176998 3300046475 Bacteria 1037
594 Ga0495662_0434835 3300046476 Unclassified 644
595 Ga0495664_0449507 3300046477 Unclassified 772
596 Ga0495594_0516675 3300046499 Bacteria 678
597 Ga0495628_0724231 3300046516 Unclassified 701
598 Ga0495630_0631001 3300046517 Unclassified 821
599 Ga0495643_0002635 3300046522 Bacteria 13919
600 Ga0495666_0383040 3300046526 Bacteria 633
601 Ga0495652_0070646 3300046529 Bacteria 2917
602 Ga0495640_0837703 3300046533 Bacteria 547
603 Ga0495586_0276642 3300046535 Unclassified 960
604 Ga0495586_0480384 3300046535 Unclassified 717
605 Ga0495587_0000977 3300046536 Bacteria 18741
606 Ga0495587_0062357 3300046536 Bacteria 2183
607 Ga0495598_0258863 3300046537 Unclassified 647
608 Ga0495621_0197308 3300046539 Unclassified 809
609 Ga0495667_0307418 3300046559 Unclassified 1004
610 Ga0495634_0245732 3300046642 Bacteria 1096
611 Ga0495635_0206375 3300046663 Unclassified 1332
612 Ga0495635_0687458 3300046663 Unclassified 664
613 Ga0495599_0012686 3300046678 Bacteria 5197
614 Ga0495599_0367741 3300046678 Unclassified 860
615 Ga0495599_0650855 3300046678 Unclassified 610
616 Ga0495658_0081926 3300046683 Bacteria 1895
617 Ga0495658_0407769 3300046683 Bacteria 867
618 Ga0495624_0949524 3300046690 Unclassified 505
619 Ga0495581_0177081 3300047315 Unclassified 1247
620 Ga0495636_0502923 3300047318 Unclassified 586
621 Ga0495674_0276760 3300047319 Bacteria 1376
622 Ga0495674_0508143 3300047319 Bacteria 963
623 Ga0495674_0729174 3300047319 Unclassified 776
624 Ga0495675_0277883 3300047444 Unclassified 999
625 Ga0495675_0472646 3300047444 Bacteria 723
626 Ga0495684_0025415 3300047471 Bacteria 4551
627 Ga0495684_0123339 3300047471 Unclassified 1950
628 Ga0495684_0124847 3300047471 Unclassified 1936
629 Ga0495684_0461365 3300047471 Unclassified 881
630 Ga0495684_0709449 3300047471 Unclassified 666
631 Ga0495602_0014157 3300048088 Bacteria 8110
632 Ga0496100_0014333 3300048903 Bacteria 4600
633 Ga0496101_0002897 3300048904 Bacteria 10562
634 Ga0496102_0276082 3300048905 Bacteria 1584
635 Ga0496104_0028517 3300048907 Bacteria 5174
636 Ga0496105_0013872 3300048908 Bacteria 6402
637 Ga0496105_0481761 3300048908 Bacteria 976
638 Ga0496105_0873940 3300048908 Bacteria 679
639 Ga0496106_0031471 3300048909 Bacteria 3954
640 Ga0496107_0194015 3300048910 Bacteria 1509
641 Ga0496107_1071607 3300048910 Bacteria 583
642 Ga0496109_0826016 3300048912 Unclassified 865
643 Ga0496109_1184390 3300048912 Bacteria 701
644 Ga0496110_1399219 3300048913 Unclassified 609
645 Ga0496114_0293382 3300048917 Bacteria 1435
646 Ga0496114_0808327 3300048917 Bacteria 816
647 Ga0501074_1073392 3300049590 Unclassified 566
648 Ga0501216_071655 3300049660 Unclassified 717
649 Ga0501035_0909445 3300049822 Unclassified 697
650 nmdc:mga05p37_11865_c1 3300050507 Bacteria 10388
651 nmdc:mga05p37_72383_c1 3300050507 Bacteria 4241
652 nmdc:mga05p37_892847_c1 3300050507 Unclassified 959
653 nmdc:mga09592_1357344_c1 3300050508 Unclassified 582
654 nmdc:mga09592_19386_c1 3300050508 Bacteria 5584
655 nmdc:mga0qj67_242517_c1 3300050509 Bacteria 1462
656 nmdc:mga0qj67_963467_c1 3300050509 Unclassified 670
657 nmdc:mga06r32_48527_c1 3300050510 Bacteria 4058
658 nmdc:mga06r32_849804_c1 3300050510 Bacteria 871
659 nmdc:mga08y16_234408_c1 3300050511 Unclassified 1898
660 nmdc:mga08y16_362054_c1 3300050511 Bacteria 1489
661 nmdc:mga08y16_514443_c1 3300050511 Bacteria 1215
662 nmdc:mga08y16_807125_c1 3300050511 Bacteria 931
663 nmdc:mga08y16_8087_c1 3300050511 Bacteria 11004
664 nmdc:mga0n895_14784_c1 3300050512 Bacteria 7101
665 nmdc:mga0n895_7140_c1 3300050512 Bacteria 9551
666 nmdc:mga0rr50_403601_c1 3300050513 Unclassified 1155
667 nmdc:mga0rr50_488114_c1 3300050513 Bacteria 1046
668 nmdc:mga08x19_884516_c1 3300050514 Unclassified 634
669 nmdc:mga0a205_1913_c1 3300050515 Bacteria 12284
670 nmdc:mga0a205_417829_c1 3300050515 Unclassified 1203
671 nmdc:mga0a205_43088_c2 3300050515 Bacteria 2486
672 nmdc:mga0a205_986080_c1 3300050515 Unclassified 689
673 Ga0495595_0497318 3300053084 Unclassified 621
674 Ga0495619_0317856 3300053085 Bacteria 1078
675 Ga0500641_0031853 3300053096 Bacteria 2081
676 Ga0587117_110207 3300059627 Unclassified 534
677 Ga0587111_0234359 3300060346 Unclassified 536
678 Ga0070715_10110711
679 JGI24746J21847_1003537
680 JGI24749J21850_1073633
681 JGI24035J26624_1041443
682 JGI25406J46586_10000079
683 Ga0058859_11501312
684 Ga0058860_10525193
685 Ga0065712_10333200
686 Ga0065715_10007395
687 Ga0065707_10512083
688 Ga0070676_10012281
689 Ga0070676_10103226
690 Ga0070683_100008852
691 Ga0070683_100016107
692 Ga0070683_100023384
693 Ga0070683_101271661
694 Ga0070690_100017642
695 Ga0070690_100102963
696 Ga0070690_100293089
697 Ga0070670_100001227
698 Ga0070670_100027891
699 Ga0070670_100546119
700 Ga0068869_100006419
701 Ga0068869_100056203
702 Ga0068869_100101990
703 Ga0068869_101001928
704 Ga0070666_10003678
705 Ga0070666_10212479
706 Ga0070680_100038331
707 Ga0070680_100719591
708 Ga0070682_100904273
709 Ga0070682_101240881
710 Ga0068868_100013382
711 Ga0068868_100036508
712 Ga0068868_100058600
713 Ga0068868_101493998
714 Ga0070660_100093144
715 Ga0070660_100402013
716 Ga0070689_100025649
717 Ga0070689_100067203
718 Ga0070689_100070875
719 Ga0070689_100237477
720 Ga0070689_100501633
721 Ga0070689_100738594
722 Ga0070691_10000025
723 Ga0070691_10771866
724 Ga0070687_100020925
725 Ga0070687_100161646
726 Ga0070687_100543430
727 Ga0070687_100647937
728 Ga0070661_100015944
729 Ga0070661_100173815
730 Ga0070692_10187017
731 Ga0070692_10233683
732 Ga0070692_10488947
733 Ga0070668_100038449
734 Ga0070669_100009639
735 Ga0070669_100092046
736 Ga0070669_100577250
737 Ga0070669_101017313
738 Ga0070675_100000982
739 Ga0070675_100003424
740 Ga0070675_100007422
741 Ga0070675_100022772
742 Ga0070675_100063916
743 Ga0070675_100268720
744 Ga0070671_100093634
745 Ga0070671_100184318
746 Ga0070671_100188146
747 Ga0070671_100340395
748 Ga0070671_101151008
749 Ga0070674_100290089
750 Ga0070674_100445259
751 Ga0070674_100584641
752 Ga0070673_100008570
753 Ga0070673_100014439
754 Ga0070673_100122759
755 Ga0070673_100131606
756 Ga0070673_100511938
757 Ga0070673_101904973
758 Ga0070688_100100681
759 Ga0070659_100034053
760 Ga0070659_100268205
761 Ga0070667_100002779
762 Ga0070667_100031021
763 Ga0070667_100064274
764 Ga0070667_100779487
765 Ga0070703_10079808
766 Ga0070709_10111461
767 Ga0070713_100265937
768 Ga0070701_10032548
769 Ga0070701_10229348
770 Ga0070701_10474833
771 Ga0070711_100119494
772 Ga0070705_100672790
773 Ga0070700_100037732
774 Ga0070694_100088856
775 Ga0070694_100187031
776 Ga0070694_100337585
777 Ga0070694_100356125
778 Ga0070694_101847637
779 Ga0070708_100150790
780 Ga0070708_100935973
781 Ga0070663_100141066
782 Ga0070663_101736902
783 Ga0070678_100078895
784 Ga0070678_101745687
785 Ga0070662_100052527
786 Ga0070662_101455126
787 Ga0070681_10001329
788 Ga0070681_10633177
789 Ga0070681_11664038
790 Ga0068867_100079246
791 Ga0068867_100337771
792 Ga0068867_100371677
793 Ga0070685_10015580
794 Ga0070685_10023483
795 Ga0070685_11359885
796 Ga0070707_100019810
797 Ga0070707_100480452
798 Ga0070698_100318782
799 Ga0070698_100797589
800 Ga0070699_100002432
801 Ga0070679_100002806
802 Ga0070684_100079900
803 Ga0070684_100161485
804 Ga0070684_100797490
805 Ga0068853_100033006
806 Ga0068853_100106413
807 Ga0068853_100226012
808 Ga0068853_100664782
809 Ga0070672_100218298
810 Ga0070672_100241537
811 Ga0070672_100252859
812 Ga0070672_100261415
813 Ga0070686_100010144
814 Ga0070686_100041087
815 Ga0070686_100047250
816 Ga0070686_100047807
817 Ga0070686_100053993
818 Ga0070695_100652391
819 Ga0070695_101364499
820 Ga0070665_100012089
821 Ga0070665_100211489
822 Ga0070665_100231190
823 Ga0070665_100901524
824 Ga0070704_100174311
825 Ga0070704_100409742
826 Ga0068855_100002727
827 Ga0068855_100030314
828 Ga0070664_100000440
829 Ga0070664_100039550
830 Ga0070664_100312990
831 Ga0070664_100844280
832 Ga0070664_101471215
833 Ga0068857_100006026
834 Ga0068857_100019393
835 Ga0068857_100505546
836 Ga0068854_100614974
837 Ga0068854_101006655
838 Ga0068856_100031674
839 Ga0068856_100341922
840 Ga0070702_100750925
841 Ga0070702_101017053
842 Ga0068852_100005439
843 Ga0068852_101356674
844 Ga0068852_101540700
845 Ga0068859_100004489
846 Ga0068859_100075292
847 Ga0068859_101199363
848 Ga0068859_101755698
849 Ga0068864_100157014
850 Ga0068864_100310853
851 Ga0068864_100377221
852 Ga0068864_101273801
853 Ga0068864_102496366
854 Ga0068861_100014008
855 Ga0068861_100044877
856 Ga0068861_100176232
857 Ga0068861_100459970
858 Ga0068861_100590451
859 Ga0068851_10652488
860 Ga0068870_10000383
861 Ga0068870_10319412
862 Ga0068870_10643885
863 Ga0068863_100002133
864 Ga0068863_100101987
865 Ga0068863_100205980
866 Ga0068863_100248198
867 Ga0068863_100486201
868 Ga0068863_101138128
869 Ga0068858_100055177
870 Ga0068858_100116546
871 Ga0068858_100256851
872 Ga0068858_100288113
873 Ga0068858_100294504
874 Ga0068858_100439876
875 Ga0068858_100556265
876 Ga0068860_100007078
877 Ga0068860_100199408
878 Ga0068860_100254769
879 Ga0068860_100418578
880 Ga0068860_100720420
881 Ga0068862_100032498
882 Ga0068862_100102532
883 Ga0081455_10721374
884 Ga0081539_10000089
885 Ga0070717_10491086
886 Ga0070715_10290917
887 Ga0070712_100261728
888 Ga0097621_100011342
889 Ga0097621_100012115
890 Ga0097621_100209828
891 Ga0097621_100341664
892 Ga0097621_100795245
893 Ga0068871_100032704
894 Ga0068871_100037139
895 Ga0068871_100066993
896 Ga0068871_100097999
897 Ga0068871_100145516
898 Ga0068871_100154781
899 Ga0068871_100211515
900 Ga0068871_100256344
901 Ga0068871_100339205
902 Ga0075428_100032591
903 Ga0075428_100552451
904 Ga0075430_100125638
905 Ga0075430_101070865
906 Ga0075431_100441473
907 Ga0075433_10003942
908 Ga0075433_10033092
909 Ga0075433_10106541
910 Ga0075434_100005546
911 Ga0075434_100259148
912 Ga0068865_100080649
913 Ga0068865_100089051
914 Ga0068865_100105357
915 Ga0068865_101003566
916 Ga0068865_101119064
917 Ga0075436_101145674
918 Ga0097620_100004489
919 Ga0097620_100075292
920 Ga0097620_101199393
921 Ga0097620_101755794
922 Ga0075435_100352326
923 Ga0105240_10002487
924 Ga0105240_10043597
925 Ga0105240_10329273
926 Ga0105240_10551304
927 Ga0111539_10009157
928 Ga0111539_10009960
929 Ga0111539_10281306
930 Ga0111539_10506803
931 Ga0111539_10745548
932 Ga0105245_10000428
933 Ga0105245_10011520
934 Ga0105245_10025047
935 Ga0105245_10167235
936 Ga0105245_10826525
937 Ga0105245_10979529
938 Ga0105245_11374801
939 Ga0105245_12142322
940 Ga0105245_13191658
941 Ga0105247_10016148
942 Ga0105247_10879952
943 Ga0114129_10030633
944 Ga0114129_12112017
945 Ga0105243_10200115
946 Ga0105243_10673155
947 Ga0105243_12556706
948 Ga0105241_10021400
949 Ga0105241_10084909
950 Ga0105241_10336460
951 Ga0105241_10739514
952 Ga0105242_10007430
953 Ga0105242_10075968
954 Ga0105242_10672692
955 Ga0105242_12847584
956 Ga0105242_12990012
957 Ga0105248_10000212
958 Ga0105248_10025213
959 Ga0105248_10040934
960 Ga0105248_10380834
961 Ga0105248_10421388
962 Ga0105248_10442419
963 Ga0105248_10865704
964 Ga0105237_10001547
965 Ga0105237_10068458
966 Ga0105237_10629768
967 Ga0105237_10651585
968 Ga0105237_10807218
969 Ga0105237_10874418
970 Ga0105237_11175668
971 Ga0105238_10002934
972 Ga0105238_10019933
973 Ga0105238_10095088
974 Ga0105238_10125672
975 Ga0105238_11038187
976 Ga0105249_10056915
977 Ga0105249_10087348
978 Ga0105249_10246466
979 Ga0105249_10500383
980 Ga0105249_10936732
981 Ga0105239_10000502
982 Ga0105239_10119390
983 Ga0105239_10196640
984 Ga0105246_10217279
985 Ga0105246_10732228
986 Ga0105246_11116892
987 Ga0157370_10005766
988 Ga0157370_10033139
989 Ga0157369_10002864
990 Ga0157369_10017489
991 Ga0157369_10344550
992 Ga0157369_10555204
993 Ga0157374_10058430
994 Ga0157374_10171688
995 Ga0157374_10687208
996 Ga0157378_10000890
997 Ga0157378_10348606
998 Ga0163162_10001964
999 Ga0163162_10007319
1000 Ga0163162_10153958
1001 Ga0163162_10184888
1002 Ga0163162_10463309
1003 Ga0163162_10538752
1004 Ga0163162_10557640
1005 Ga0163162_12156999
1006 Ga0157372_10005353
1007 Ga0157372_10056075
1008 Ga0157372_10122255
1009 Ga0157375_10001322
1010 Ga0157375_10041907
1011 Ga0157375_10055772
1012 Ga0157375_10111175
1013 Ga0157375_10170271
1014 Ga0157375_10264333
1015 Ga0157375_11033986
1016 Ga0157375_12503210
1017 Ga0163163_10000353
1018 Ga0163163_10031788
1019 Ga0163163_10045885
1020 Ga0163163_10062979
1021 Ga0163163_10644804
1022 Ga0163163_11934400
1023 Ga0157380_10015557
1024 Ga0157380_10539620
1025 Ga0157377_10331411
1026 Ga0157379_10060381
1027 Ga0157379_10085369
1028 Ga0157379_10364784
1029 Ga0157379_12139061
1030 Ga0157376_10007288
1031 Ga0157376_10191713
1032 Ga0157376_10630131
1033 Ga0157376_11509507
1034 Ga0157376_11875001
1035 Ga0163161_10291818
1036 Ga0206356_10142031
1037 Ga0213875_10006618
1038 Ga0213875_10006844
1039 Ga0207697_10002888
1040 Ga0207642_10016690
1041 Ga0207642_10394737
1042 Ga0207680_10097492
1043 Ga0207680_10134684
1044 Ga0207680_10182566
1045 Ga0207645_10004565
1046 Ga0207645_10089406
1047 Ga0207643_10000940
1048 Ga0207643_10307800
1049 Ga0207654_10023845
1050 Ga0207654_10209209
1051 Ga0207654_10530674
1052 Ga0207707_10001181
1053 Ga0207695_10000808
1054 Ga0207695_10005259
1055 Ga0207695_11068415
1056 Ga0207671_10010883
1057 Ga0207671_10426324
1058 Ga0207671_10580991
1059 Ga0207671_10840898
1060 Ga0207693_10184278
1061 Ga0207663_11098839
1062 Ga0207660_10042145
1063 Ga0207660_10182481
1064 Ga0207662_10004469
1065 Ga0207662_10090726
1066 Ga0207662_10401871
1067 Ga0207662_10862620
1068 Ga0207657_10457484
1069 Ga0207649_10234154
1070 Ga0207649_10466859
1071 Ga0207646_10002428
1072 Ga0207646_10411597
1073 Ga0207646_10998899
1074 Ga0207681_10022969
1075 Ga0207681_10061493
1076 Ga0207681_10999056
1077 Ga0207694_10005318
1078 Ga0207694_10060646
1079 Ga0207694_10128092
1080 Ga0207650_10018703
1081 Ga0207650_10059540
1082 Ga0207650_10186435
1083 Ga0207650_11688465
1084 Ga0207659_10017761
1085 Ga0207659_10045355
1086 Ga0207659_10054863
1087 Ga0207659_10264160
1088 Ga0207659_10611144
1089 Ga0207687_10004561
1090 Ga0207687_10010183
1091 Ga0207687_10021860
1092 Ga0207687_10050389
1093 Ga0207687_10303929
1094 Ga0207687_10570887
1095 Ga0207687_10905493
1096 Ga0207700_10027774
1097 Ga0207664_11102747
1098 Ga0207644_10040170
1099 Ga0207644_10201474
1100 Ga0207644_10811991
1101 Ga0207690_10074833
1102 Ga0207706_10267578
1103 Ga0207706_10283500
1104 Ga0207706_10367680
1105 Ga0207706_10436829
1106 Ga0207709_10540837
1107 Ga0207709_10639635
1108 Ga0207670_10066186
1109 Ga0207670_10124024
1110 Ga0207670_10129213
1111 Ga0207670_10504163
1112 Ga0207670_10664649
1113 Ga0207669_10318008
1114 Ga0207669_10681412
1115 Ga0207704_10155227
1116 Ga0207704_11483731
1117 Ga0207691_10006797
1118 Ga0207691_10013026
1119 Ga0207691_10081666
1120 Ga0207691_10097488
1121 Ga0207691_10121868
1122 Ga0207691_10655899
1123 Ga0207711_10001566
1124 Ga0207711_10006540
1125 Ga0207711_10029081
1126 Ga0207711_10098718
1127 Ga0207711_10202023
1128 Ga0207711_10214474
1129 Ga0207711_10251647
1130 Ga0207711_10380971
1131 Ga0207689_10000995
1132 Ga0207689_10029298
1133 Ga0207689_10146309
1134 Ga0207689_10600386
1135 Ga0207661_10012167
1136 Ga0207661_10061058
1137 Ga0207661_10307013
1138 Ga0207679_10035422
1139 Ga0207679_10092462
1140 Ga0207679_10335663
1141 Ga0207679_10768235
1142 Ga0207667_10000673
1143 Ga0207667_10002992
1144 Ga0207651_10006146
1145 Ga0207651_10006379
1146 Ga0207651_10025172
1147 Ga0207651_10044834
1148 Ga0207651_10104679
1149 Ga0207651_10276962
1150 Ga0207712_10002476
1151 Ga0207668_10020245
1152 Ga0207640_10397587
1153 Ga0207640_11427417
1154 Ga0207658_10012978
1155 Ga0207658_10014416
1156 Ga0207658_11530848
1157 Ga0207677_10062080
1158 Ga0207677_10131044
1159 Ga0207677_10412013
1160 Ga0207677_10598722
1161 Ga0207677_10624970
1162 Ga0207677_10763596
1163 Ga0207677_10889000
1164 Ga0207703_10011912
1165 Ga0207703_10067327
1166 Ga0207703_10172154
1167 Ga0207703_10265734
1168 Ga0207703_10293122
1169 Ga0207703_10801676
1170 Ga0207703_10936167
1171 Ga0207639_10019077
1172 Ga0207639_10555542
1173 Ga0207639_10783172
1174 Ga0207678_10075438
1175 Ga0207708_10031555
1176 Ga0207708_10917783
1177 Ga0207702_10088623
1178 Ga0207702_10141105
1179 Ga0207702_10170162
1180 Ga0207641_10013094
1181 Ga0207641_10024183
1182 Ga0207641_10820665
1183 Ga0207641_11601131
1184 Ga0207648_10105109
1185 Ga0207648_10105663
1186 Ga0207648_11170736
1187 Ga0207648_12193171
1188 Ga0207676_10012329
1189 Ga0207676_10291579
1190 Ga0207676_10298536
1191 Ga0207676_10594835
1192 Ga0207674_10011373
1193 Ga0207675_100023224
1194 Ga0207675_100067950
1195 Ga0207675_100148253
1196 Ga0207675_100363568
1197 Ga0207675_100651810
1198 Ga0207675_101260269
1199 Ga0207683_10029317
1200 Ga0207683_10112208
1201 Ga0207683_11010728
1202 Ga0207698_10004976
1203 Ga0207428_10003781
1204 Ga0207428_10198559
1205 Ga0207428_10253346
1206 Ga0268266_10045056
1207 Ga0268265_10082554
1208 Ga0268265_10382625
1209 Ga0268265_10502455
1210 Ga0268265_10799387
1211 Ga0268264_10017863
1212 Ga0268264_10019941
1213 Ga0268264_10078341
1214 Ga0268264_10222732
1215 Ga0268264_11199699
1216 Ga0265777_120905
1217 Ga0265760_10075869
1218 Ga0265330_10241337
1219 Ga0265340_10006447
1220 Ga0265331_10158601
1221 Ga0307408_102295918
1222 Ga0307409_102411614
1223 Ga0373934_0092294
1224 Ga0373951_0194625
1225 Ga0373932_0013001
1226 Ga0373953_0310460
1227 Ga0373954_0081331
1228 Ga0373957_0054679
1229 Ga0373960_0005181
1230 Ga0373943_0172465
1231 Ga0373946_0209954
1232 Ga0373955_0086463
1233 Ga0373955_0288008
1234 Ga0373931_0103428
1235 Ga0373927_0570934
1236 Ga0373933_0017079
1237 Ga0373933_0882927
1238 Ga0373947_0315735
1239 Ga0373947_0815054
1240 Ga0373937_0001838
1241 Ga0373937_0062455
1242 Ga0373937_0067013
1243 Ga0373937_0231155
1244 Ga0373937_0260892
1245 Ga0373937_0309408
1246 Ga0436364_0034860
1247 Ga0436364_0192434
1248 Ga0436362_0041599
1249 Ga0436362_0948343
1250 Ga0451802_1590899
1251 Ga0451807_0319198
1252 Ga0451807_2611652
1253 Ga0451845_0385874
1254 Ga0451849_0960742
1255 Ga0451853_2276761
1256 Ga0451853_2629545
1257 Ga0451576_0050435
1258 Ga0495592_0218289
1259 Ga0495603_0202881
1260 Ga0495603_0411311
1261 Ga0495603_0418545
1262 Ga0495629_0256443
1263 Ga0495629_1139274
1264 Ga0495651_0282432
1265 Ga0495651_0601316
1266 Ga0495653_0710510
1267 Ga0495580_0106434
1268 Ga0495580_0192104
1269 Ga0495582_0922675
1270 Ga0495639_0176998
1271 Ga0495662_0434835
1272 Ga0495664_0449507
1273 Ga0495594_0516675
1274 Ga0495628_0724231
1275 Ga0495630_0631001
1276 Ga0495643_0002635
1277 Ga0495666_0383040
1278 Ga0495652_0070646
1279 Ga0495640_0837703
1280 Ga0495586_0276642
1281 Ga0495586_0480384
1282 Ga0495587_0000977
1283 Ga0495587_0062357
1284 Ga0495598_0258863
1285 Ga0495621_0197308
1286 Ga0495667_0307418
1287 Ga0495634_0245732
1288 Ga0495635_0206375
1289 Ga0495635_0687458
1290 Ga0495599_0012686
1291 Ga0495599_0367741
1292 Ga0495599_0650855
1293 Ga0495658_0081926
1294 Ga0495658_0407769
1295 Ga0495624_0949524
1296 Ga0495581_0177081
1297 Ga0495636_0502923
1298 Ga0495674_0276760
1299 Ga0495674_0508143
1300 Ga0495674_0729174
1301 Ga0495675_0277883
1302 Ga0495675_0472646
1303 Ga0495684_0025415
1304 Ga0495684_0123339
1305 Ga0495684_0124847
1306 Ga0495684_0461365
1307 Ga0495684_0709449
1308 Ga0495602_0014157
1309 Ga0496100_0014333
1310 Ga0496101_0002897
1311 Ga0496102_0276082
1312 Ga0496104_0028517
1313 Ga0496105_0013872
1314 Ga0496105_0481761
1315 Ga0496105_0873940
1316 Ga0496106_0031471
1317 Ga0496107_0194015
1318 Ga0496107_1071607
1319 Ga0496109_0826016
1320 Ga0496109_1184390
1321 Ga0496110_1399219
1322 Ga0496114_0293382
1323 Ga0496114_0808327
1324 Ga0501074_1073392
1325 Ga0501216_071655
1326 Ga0501035_0909445
1327 nmdc:mga05p37_11865_c1
1328 nmdc:mga05p37_72383_c1
1329 nmdc:mga05p37_892847_c1
1330 nmdc:mga09592_1357344_c1
1331 nmdc:mga09592_19386_c1
1332 nmdc:mga0qj67_242517_c1
1333 nmdc:mga0qj67_963467_c1
1334 nmdc:mga06r32_48527_c1
1335 nmdc:mga06r32_849804_c1
1336 nmdc:mga08y16_234408_c1
1337 nmdc:mga08y16_362054_c1
1338 nmdc:mga08y16_514443_c1
1339 nmdc:mga08y16_807125_c1
1340 nmdc:mga08y16_8087_c1
1341 nmdc:mga0n895_14784_c1
1342 nmdc:mga0n895_7140_c1
1343 nmdc:mga0rr50_403601_c1
1344 nmdc:mga0rr50_488114_c1
1345 nmdc:mga08x19_884516_c1
1346 nmdc:mga0a205_1913_c1
1347 nmdc:mga0a205_417829_c1
1348 nmdc:mga0a205_43088_c2
1349 nmdc:mga0a205_986080_c1
1350 Ga0495595_0497318
1351 Ga0495619_0317856
1352 Ga0500641_0031853
1353 Ga0587117_110207
1354 Ga0587111_0234359

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

37

136

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c4k-assembly1.cif.gz_A ancestral l-amino acid oxidase (anclaao-n5) ligand free form 0.8275 44 73
3dor-assembly1.cif.gz_B crystal structure of mature cpaf 0.7723 42 73
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7696 40 73
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7686 40 73
1sru-assembly1.cif.gz_C crystal structure of full length e. coli ssb protein 0.7637 36 101
ID Description Score Start End Superfamily
af_B2RYE5_272_368_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8734 43 73 2.30.29.30
af_Q9VKY7_200_296_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8671 43 71 2.30.29.30
af_Q09409_1034_1155_1.10.1410.10 Mainly Alpha;Orthogonal Bundle;Poly(a)-polymerase, middle domain; 0.7997 42 73 1.10.1410.10
2jjdF02 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.787 44 73 3.90.190.10
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.778 38 97 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2V9D702-F1-model_v4 DUF5666 domain-containing protein 0.9389 36 126
AF-A0A2W4Q999-F1-model_v4 DUF5666 domain-containing protein 0.9387 32 125
AF-A0A2E9JIJ5-F1-model_v4 DNA-binding protein 0.9251 32 127
AF-A0A0S1YL88-F1-model_v4 deleted 0.9228 25 126
AF-A0A383CUF3-F1-model_v4 OB domain-containing protein 0.922 33 129

Map