F474413

General Info

Members Datasets Scaffolds Average Seq Length
675 217 675 221

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100489322|Ga0070670_1004893221
Length 253
Sequence MTSPTPFVGNSLLRIITRRAIAGVSKDWLMTKTNRWTPELGVLGTGRMGSRLAAMFARAGRKVVLGSRDSDRAEQIVRKLELPTLRSGCYADAVRAPAVLPAVFIRDGLLDLLERYCSALRGKLLIDISNPFNADYSDFVTPWDTSGAEELQHRFPQVRVVGAFKNVFWEVFDHPQFGDVVSDVLVTGDDRLAKDAFMALAEGTPFRYLDAGPLISSRAIERLTFITSSLGQQLNSYPRMNWRLLTQPESKAA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
163 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
164 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
165 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
166 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
167 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
171 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
199 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
207 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
208 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
209 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
210 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
211 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.22
Metatranscriptomes 1.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 5.19
Rhizosphere 94.37
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004638 3300001979 Bacteria 5897
2 JGI24737J22298_10010811 3300001990 Bacteria 3002
3 Ga0065715_10019182 3300005293 Bacteria 2347
4 Ga0070658_10014288 3300005327 Bacteria 6371
5 Ga0070658_10224706 3300005327 Bacteria 1588
6 Ga0070658_10363362 3300005327 Bacteria 1240
7 Ga0070658_10527239 3300005327 Bacteria 1021
8 Ga0070676_10054260 3300005328 Bacteria 2362
9 Ga0070676_10068663 3300005328 Bacteria 2122
10 Ga0070676_10207448 3300005328 Bacteria 1287
11 Ga0070676_10245460 3300005328 Bacteria 1193
12 Ga0070683_100039994 3300005329 Bacteria 4308
13 Ga0070670_100005108 3300005331 Bacteria 11046
14 Ga0070670_100007621 3300005331 Bacteria 9195
15 Ga0070670_100009847 3300005331 Bacteria 8163
16 Ga0070670_100052974 3300005331 Bacteria 3485
17 Ga0070670_100056692 3300005331 Bacteria 3363
18 Ga0070670_100215658 3300005331 Bacteria 1669
19 Ga0070670_100277982 3300005331 Unclassified 1462
20 Ga0070670_100489322 3300005331 Unclassified 1093
21 Ga0070670_100509356 3300005331 Bacteria 1071
22 Ga0070677_10017560 3300005333 Bacteria 2564
23 Ga0070677_10024853 3300005333 Bacteria 2232
24 Ga0070677_10036872 3300005333 Unclassified 1905
25 Ga0068869_100056398 3300005334 Bacteria 2865
26 Ga0068869_100304533 3300005334 Bacteria 1288
27 Ga0070666_10000253 3300005335 Bacteria 35588
28 Ga0070666_10075538 3300005335 Bacteria 2298
29 Ga0070666_10363896 3300005335 Bacteria 1036
30 Ga0070680_100273109 3300005336 Bacteria 1431
31 Ga0070682_100085989 3300005337 Bacteria 2047
32 Ga0070682_100523148 3300005337 Bacteria 923
33 Ga0068868_100003858 3300005338 Bacteria 10464
34 Ga0068868_100063804 3300005338 Bacteria 2922
35 Ga0068868_100641079 3300005338 Bacteria 945
36 Ga0070660_100000767 3300005339 Bacteria 21303
37 Ga0070660_100015886 3300005339 Bacteria 5450
38 Ga0070660_100022463 3300005339 Bacteria 4665
39 Ga0070660_100117017 3300005339 Bacteria 2125
40 Ga0070660_100209420 3300005339 Bacteria 1582
41 Ga0070689_100743806 3300005340 Bacteria 859
42 Ga0070661_100011576 3300005344 Bacteria 6148
43 Ga0070661_100034120 3300005344 Bacteria 3690
44 Ga0070661_100075203 3300005344 Bacteria 2488
45 Ga0070661_100090922 3300005344 Bacteria 2260
46 Ga0070661_100092352 3300005344 Bacteria 2243
47 Ga0070661_100095835 3300005344 Bacteria 2201
48 Ga0070661_100281348 3300005344 Bacteria 1290
49 Ga0070661_100379720 3300005344 Bacteria 1114
50 Ga0070692_10073701 3300005345 Bacteria 1824
51 Ga0070668_100017368 3300005347 Bacteria 5389
52 Ga0070668_100256291 3300005347 Bacteria 1454
53 Ga0070669_100000699 3300005353 Bacteria 24602
54 Ga0070669_100114359 3300005353 Bacteria 2051
55 Ga0070669_100280725 3300005353 Unclassified 1334
56 Ga0070675_100063336 3300005354 Bacteria 3057
57 Ga0070675_100073038 3300005354 Bacteria 2848
58 Ga0070675_100254350 3300005354 Unclassified 1538
59 Ga0070671_100010935 3300005355 Bacteria 7290
60 Ga0070671_100021869 3300005355 Bacteria 5224
61 Ga0070671_100024219 3300005355 Bacteria 4968
62 Ga0070671_100218805 3300005355 Bacteria 1616
63 Ga0070671_100255644 3300005355 Bacteria 1488
64 Ga0070674_100008703 3300005356 Bacteria 6054
65 Ga0070674_100014760 3300005356 Bacteria 4862
66 Ga0070674_100032534 3300005356 Bacteria 3464
67 Ga0070674_100095518 3300005356 Bacteria 2155
68 Ga0070674_100250893 3300005356 Bacteria 1390
69 Ga0070674_100512662 3300005356 Unclassified 1001
70 Ga0070673_100000937 3300005364 Bacteria 16526
71 Ga0070673_100003743 3300005364 Bacteria 9537
72 Ga0070673_100052436 3300005364 Bacteria 3200
73 Ga0070673_100129135 3300005364 Bacteria 2118
74 Ga0070659_100000753 3300005366 Bacteria 23494
75 Ga0070659_100015914 3300005366 Bacteria 5641
76 Ga0070659_100018048 3300005366 Bacteria 5321
77 Ga0070659_100031636 3300005366 Bacteria 4099
78 Ga0070659_100046857 3300005366 Bacteria 3389
79 Ga0070659_100101042 3300005366 Bacteria 2321
80 Ga0070659_100577291 3300005366 Bacteria 964
81 Ga0070667_100001558 3300005367 Bacteria 20556
82 Ga0070667_100008033 3300005367 Bacteria 8754
83 Ga0070667_100009679 3300005367 Bacteria 7991
84 Ga0070667_100020506 3300005367 Bacteria 5487
85 Ga0070667_100032398 3300005367 Bacteria 4359
86 Ga0070667_100035505 3300005367 Bacteria 4177
87 Ga0070667_100159917 3300005367 Bacteria 1983
88 Ga0070667_100538478 3300005367 Bacteria 1072
89 Ga0070667_100543098 3300005367 Unclassified 1068
90 Ga0070705_100273864 3300005440 Bacteria 1197
91 Ga0070694_100028795 3300005444 Bacteria 3618
92 Ga0070694_100065073 3300005444 Bacteria 2497
93 Ga0070663_100008713 3300005455 Bacteria 6253
94 Ga0070663_100167850 3300005455 Unclassified 1694
95 Ga0070663_100333367 3300005455 Bacteria 1223
96 Ga0070663_100438451 3300005455 Bacteria 1074
97 Ga0070678_100001158 3300005456 Bacteria 13960
98 Ga0070678_100006078 3300005456 Bacteria 7045
99 Ga0070678_100084622 3300005456 Bacteria 2415
100 Ga0070678_100251745 3300005456 Bacteria 1481
101 Ga0070662_100002248 3300005457 Bacteria 11841
102 Ga0070662_100003550 3300005457 Bacteria 9726
103 Ga0070662_100008161 3300005457 Bacteria 6821
104 Ga0070662_100028839 3300005457 Bacteria 3867
105 Ga0070662_100038370 3300005457 Bacteria 3402
106 Ga0070662_100101431 3300005457 Bacteria 2178
107 Ga0070662_100306067 3300005457 Bacteria 1292
108 Ga0070662_100370192 3300005457 Bacteria 1177
109 Ga0070662_100827085 3300005457 Bacteria 788
110 Ga0070681_10330554 3300005458 Bacteria 1434
111 Ga0068867_100001924 3300005459 Bacteria 14465
112 Ga0068867_100069507 3300005459 Bacteria 2630
113 Ga0070685_10085529 3300005466 Bacteria 1899
114 Ga0070679_100042920 3300005530 Bacteria 4504
115 Ga0070679_100311888 3300005530 Bacteria 1523
116 Ga0070684_100945085 3300005535 Bacteria 808
117 Ga0070697_100516950 3300005536 Bacteria 1045
118 Ga0068853_100105469 3300005539 Bacteria 2497
119 Ga0068853_100142621 3300005539 Bacteria 2151
120 Ga0068853_100222372 3300005539 Bacteria 1725
121 Ga0068853_100287688 3300005539 Bacteria 1516
122 Ga0068853_100433382 3300005539 Bacteria 1234
123 Ga0070672_100000234 3300005543 Bacteria 31015
124 Ga0070672_100001634 3300005543 Bacteria 13950
125 Ga0070672_100005328 3300005543 Bacteria 8518
126 Ga0070672_100013444 3300005543 Bacteria 5782
127 Ga0070672_100189439 3300005543 Bacteria 1717
128 Ga0070672_100197400 3300005543 Bacteria 1682
129 Ga0070672_100226217 3300005543 Bacteria 1570
130 Ga0070686_100445908 3300005544 Bacteria 994
131 Ga0070695_100005741 3300005545 Bacteria 7313
132 Ga0070695_100043473 3300005545 Bacteria 2857
133 Ga0070696_100013215 3300005546 Bacteria 5541
134 Ga0070696_100038433 3300005546 Bacteria 3303
135 Ga0070696_100236783 3300005546 Bacteria 1375
136 Ga0070693_100102117 3300005547 Bacteria 1749
137 Ga0070693_100345345 3300005547 Unclassified 1017
138 Ga0070665_100003766 3300005548 Bacteria 16049
139 Ga0070665_100008343 3300005548 Bacteria 10479
140 Ga0070665_100014462 3300005548 Bacteria 7917
141 Ga0070665_100016958 3300005548 Bacteria 7303
142 Ga0070665_100079434 3300005548 Bacteria 3286
143 Ga0070704_100318741 3300005549 Bacteria 1302
144 Ga0068855_100085658 3300005563 Bacteria 3645
145 Ga0068855_100132760 3300005563 Bacteria 2842
146 Ga0068855_100259658 3300005563 Bacteria 1935
147 Ga0070664_100001061 3300005564 Bacteria 21619
148 Ga0070664_100002747 3300005564 Bacteria 14203
149 Ga0070664_100026560 3300005564 Bacteria 4804
150 Ga0070664_100029694 3300005564 Bacteria 4559
151 Ga0070664_100063660 3300005564 Bacteria 3144
152 Ga0070664_100064199 3300005564 Bacteria 3131
153 Ga0070664_100124294 3300005564 Bacteria 2262
154 Ga0070664_100163889 3300005564 Bacteria 1968
155 Ga0070664_100342456 3300005564 Bacteria 1358
156 Ga0070664_100438797 3300005564 Bacteria 1197
157 Ga0070664_100445934 3300005564 Bacteria 1188
158 Ga0070664_100493935 3300005564 Bacteria 1127
159 Ga0068857_100001548 3300005577 Bacteria 18416
160 Ga0068857_100004660 3300005577 Bacteria 11612
161 Ga0068857_100010238 3300005577 Bacteria 8150
162 Ga0068857_100100233 3300005577 Bacteria 2598
163 Ga0068857_100103289 3300005577 Bacteria 2559
164 Ga0068857_100261328 3300005577 Bacteria 1589
165 Ga0068854_100000061 3300005578 Bacteria 78663
166 Ga0068854_100028746 3300005578 Bacteria 3844
167 Ga0068854_100036265 3300005578 Bacteria 3456
168 Ga0068854_100052898 3300005578 Bacteria 2914
169 Ga0068854_100187387 3300005578 Bacteria 1620
170 Ga0068854_100211332 3300005578 Bacteria 1530
171 Ga0068854_100499249 3300005578 Bacteria 1024
172 Ga0068856_100011495 3300005614 Bacteria 8594
173 Ga0068856_100055423 3300005614 Bacteria 3912
174 Ga0068856_100327908 3300005614 Bacteria 1548
175 Ga0068856_100598998 3300005614 Bacteria 1123
176 Ga0068852_100000847 3300005616 Bacteria 20320
177 Ga0068852_100003251 3300005616 Bacteria 11342
178 Ga0068852_100008826 3300005616 Bacteria 7461
179 Ga0068852_100110614 3300005616 Bacteria 2497
180 Ga0068852_100156906 3300005616 Bacteria 2121
181 Ga0068852_100512518 3300005616 Bacteria 1196
182 Ga0068859_100002893 3300005617 Bacteria 17443
183 Ga0068859_100003001 3300005617 Bacteria 17114
184 Ga0068859_100025738 3300005617 Bacteria 5901
185 Ga0068859_100052657 3300005617 Bacteria 4093
186 Ga0068859_100092588 3300005617 Bacteria 3074
187 Ga0068859_100125788 3300005617 Bacteria 2632
188 Ga0068859_100129140 3300005617 Unclassified 2598
189 Ga0068859_100240682 3300005617 Bacteria 1899
190 Ga0068864_100000378 3300005618 Bacteria 38838
191 Ga0068864_100003680 3300005618 Bacteria 12658
192 Ga0068864_100004397 3300005618 Bacteria 11573
193 Ga0068864_100006396 3300005618 Bacteria 9652
194 Ga0068864_100640722 3300005618 Bacteria 1034
195 Ga0068864_100849027 3300005618 Bacteria 900
196 Ga0068861_100063893 3300005719 Bacteria 2830
197 Ga0068851_10021026 3300005834 Bacteria 3165
198 Ga0068851_10122342 3300005834 Bacteria 1399
199 Ga0068851_10276072 3300005834 Bacteria 960
200 Ga0068870_10059904 3300005840 Unclassified 2042
201 Ga0068863_100000523 3300005841 Bacteria 39154
202 Ga0068863_100002267 3300005841 Bacteria 19113
203 Ga0068863_100004263 3300005841 Bacteria 14107
204 Ga0068863_100017578 3300005841 Bacteria 6851
205 Ga0068863_100031916 3300005841 Bacteria 5024
206 Ga0068858_100006455 3300005842 Bacteria 11419
207 Ga0068858_100008057 3300005842 Bacteria 10148
208 Ga0068858_100008178 3300005842 Bacteria 10058
209 Ga0068858_100012709 3300005842 Bacteria 7933
210 Ga0068858_100037079 3300005842 Bacteria 4520
211 Ga0068858_100061160 3300005842 Bacteria 3481
212 Ga0068860_100007966 3300005843 Bacteria 10567
213 Ga0068860_100015799 3300005843 Bacteria 7371
214 Ga0068860_100029882 3300005843 Bacteria 5242
215 Ga0068860_100080551 3300005843 Bacteria 3096
216 Ga0068860_100234956 3300005843 Bacteria 1782
217 Ga0068860_100310534 3300005843 Bacteria 1546
218 Ga0068862_100023961 3300005844 Bacteria 5117
219 Ga0068862_100054057 3300005844 Bacteria 3438
220 Ga0097621_100008835 3300006237 Bacteria 7283
221 Ga0097621_100016377 3300006237 Bacteria 5604
222 Ga0097621_100050776 3300006237 Bacteria 3374
223 Ga0097621_100138414 3300006237 Bacteria 2079
224 Ga0097621_100229918 3300006237 Bacteria 1619
225 Ga0075370_10164925 3300006353 Unclassified 1301
226 Ga0068871_100009465 3300006358 Bacteria 7062
227 Ga0068871_100035112 3300006358 Bacteria 3983
228 Ga0068871_100260045 3300006358 Bacteria 1514
229 Ga0068871_100266538 3300006358 Bacteria 1495
230 Ga0075428_100413047 3300006844 Bacteria 1446
231 Ga0075434_100769166 3300006871 Bacteria 980
232 Ga0097620_100002893 3300006931 Bacteria 17443
233 Ga0097620_100003001 3300006931 Bacteria 17114
234 Ga0097620_100025738 3300006931 Bacteria 5901
235 Ga0097620_100052659 3300006931 Bacteria 4093
236 Ga0097620_100092600 3300006931 Bacteria 3074
237 Ga0097620_100125793 3300006931 Bacteria 2632
238 Ga0097620_100129141 3300006931 Unclassified 2598
239 Ga0097620_100240683 3300006931 Bacteria 1899
240 Ga0105240_10084680 3300009093 Bacteria 3887
241 Ga0111539_10034797 3300009094 Bacteria 6103
242 Ga0111539_10577862 3300009094 Unclassified 1309
243 Ga0105245_10169357 3300009098 Bacteria 2079
244 Ga0105243_10042713 3300009148 Bacteria 3550
245 Ga0105243_10081802 3300009148 Bacteria 2638
246 Ga0105243_10174740 3300009148 Bacteria 1863
247 Ga0105243_10534280 3300009148 Bacteria 1117
248 Ga0105241_10007436 3300009174 Bacteria 8065
249 Ga0105241_10089534 3300009174 Bacteria 2425
250 Ga0105242_11330236 3300009176 Bacteria 743
251 Ga0105248_10000159 3300009177 Bacteria 78504
252 Ga0105248_10002983 3300009177 Bacteria 18755
253 Ga0105248_10018834 3300009177 Bacteria 7635
254 Ga0105248_10073444 3300009177 Bacteria 3844
255 Ga0105248_10260348 3300009177 Bacteria 1953
256 Ga0105248_10441541 3300009177 Bacteria 1466
257 Ga0105248_10443111 3300009177 Bacteria 1463
258 Ga0105248_10802226 3300009177 Unclassified 1062
259 Ga0105248_11070046 3300009177 Bacteria 911
260 Ga0105237_10027241 3300009545 Bacteria 5836
261 Ga0105238_10523152 3300009551 Bacteria 1189
262 Ga0105249_10016026 3300009553 Bacteria 6643
263 Ga0105249_10052400 3300009553 Bacteria 3726
264 Ga0105249_10058327 3300009553 Bacteria 3538
265 Ga0105249_10119778 3300009553 Bacteria 2500
266 Ga0105239_10062296 3300010375 Bacteria 4094
267 Ga0105239_10118106 3300010375 Bacteria 2944
268 Ga0105246_10041133 3300011119 Bacteria 3122
269 Ga0105246_10278581 3300011119 Bacteria 1340
270 Ga0157327_1002691 3300012512 Bacteria 1249
271 Ga0157373_10001876 3300013100 Bacteria 15943
272 Ga0157373_10026124 3300013100 Bacteria 4220
273 Ga0157373_10096272 3300013100 Bacteria 2083
274 Ga0157373_10155045 3300013100 Bacteria 1611
275 Ga0157373_10211875 3300013100 Bacteria 1366
276 Ga0157373_10349672 3300013100 Bacteria 1054
277 Ga0157371_10022145 3300013102 Bacteria 4661
278 Ga0157371_10035109 3300013102 Bacteria 3594
279 Ga0157371_10150118 3300013102 Bacteria 1662
280 Ga0157371_10202052 3300013102 Bacteria 1425
281 Ga0157374_10087444 3300013296 Bacteria 2966
282 Ga0157374_10347850 3300013296 Bacteria 1472
283 Ga0157374_10473322 3300013296 Bacteria 1255
284 Ga0157378_10516197 3300013297 Bacteria 1196
285 Ga0163162_10001772 3300013306 Bacteria 20231
286 Ga0163162_10120906 3300013306 Bacteria 2723
287 Ga0163162_10323024 3300013306 Bacteria 1676
288 Ga0163162_10499657 3300013306 Bacteria 1347
289 Ga0157372_10077807 3300013307 Bacteria 3747
290 Ga0157372_10112759 3300013307 Bacteria 3116
291 Ga0157372_10223846 3300013307 Bacteria 2181
292 Ga0157372_11101546 3300013307 Bacteria 919
293 Ga0157375_10001232 3300013308 Bacteria 22092
294 Ga0157375_10019147 3300013308 Bacteria 6217
295 Ga0157375_10145025 3300013308 Bacteria 2504
296 Ga0157375_10170797 3300013308 Bacteria 2322
297 Ga0157375_10445107 3300013308 Bacteria 1461
298 Ga0163163_10038078 3300014325 Bacteria 4683
299 Ga0163163_10046704 3300014325 Bacteria 4254
300 Ga0163163_10251712 3300014325 Bacteria 1817
301 Ga0157377_10001413 3300014745 Bacteria 10352
302 Ga0157377_10319186 3300014745 Bacteria 1031
303 Ga0157379_10012038 3300014968 Bacteria 7557
304 Ga0157379_10187036 3300014968 Bacteria 1872
305 Ga0157379_10283699 3300014968 Bacteria 1507
306 Ga0157376_10024177 3300014969 Bacteria 4766
307 Ga0163161_10291396 3300017792 Bacteria 1283
308 Ga0207697_10002979 3300025315 Bacteria 8549
309 Ga0207697_10072297 3300025315 Bacteria 1446
310 Ga0207656_10138791 3300025321 Bacteria 1144
311 Ga0207656_10281529 3300025321 Bacteria 820
312 Ga0207682_10024020 3300025893 Bacteria 2411
313 Ga0207682_10074542 3300025893 Unclassified 1443
314 Ga0207642_10077570 3300025899 Bacteria 1603
315 Ga0207642_10129028 3300025899 Unclassified 1316
316 Ga0207688_10000018 3300025901 Bacteria 51641
317 Ga0207688_10017402 3300025901 Bacteria 3905
318 Ga0207680_10134405 3300025903 Bacteria 1633
319 Ga0207680_10162116 3300025903 Bacteria 1500
320 Ga0207647_10000232 3300025904 Bacteria 46114
321 Ga0207647_10000333 3300025904 Bacteria 38836
322 Ga0207647_10008050 3300025904 Bacteria 7578
323 Ga0207647_10156671 3300025904 Bacteria 1329
324 Ga0207645_10000418 3300025907 Bacteria 35293
325 Ga0207645_10004865 3300025907 Bacteria 9852
326 Ga0207645_10016307 3300025907 Bacteria 4920
327 Ga0207645_10387821 3300025907 Unclassified 938
328 Ga0207643_10196781 3300025908 Unclassified 1226
329 Ga0207705_10022762 3300025909 Bacteria 4469
330 Ga0207705_10028973 3300025909 Bacteria 3948
331 Ga0207705_10275278 3300025909 Bacteria 1288
332 Ga0207705_10491174 3300025909 Bacteria 953
333 Ga0207705_10645227 3300025909 Bacteria 823
334 Ga0207707_10248067 3300025912 Bacteria 1547
335 Ga0207707_10510595 3300025912 Bacteria 1024
336 Ga0207671_10462464 3300025914 Bacteria 1011
337 Ga0207662_10227724 3300025918 Bacteria 1216
338 Ga0207657_10003142 3300025919 Bacteria 17669
339 Ga0207657_10010774 3300025919 Bacteria 9101
340 Ga0207657_10027535 3300025919 Bacteria 5205
341 Ga0207657_10035116 3300025919 Bacteria 4500
342 Ga0207657_10063410 3300025919 Bacteria 3160
343 Ga0207657_10184001 3300025919 Bacteria 1688
344 Ga0207649_10029541 3300025920 Bacteria 3238
345 Ga0207649_10037901 3300025920 Bacteria 2916
346 Ga0207649_10127167 3300025920 Bacteria 1726
347 Ga0207649_10159689 3300025920 Bacteria 1561
348 Ga0207649_10456676 3300025920 Bacteria 965
349 Ga0207652_10278796 3300025921 Bacteria 1508
350 Ga0207652_10532053 3300025921 Bacteria 1057
351 Ga0207681_10001180 3300025923 Bacteria 16821
352 Ga0207681_10024027 3300025923 Bacteria 3906
353 Ga0207681_10758961 3300025923 Bacteria 809
354 Ga0207650_10004522 3300025925 Bacteria 9509
355 Ga0207650_10005251 3300025925 Bacteria 8833
356 Ga0207650_10021095 3300025925 Bacteria 4604
357 Ga0207650_10039199 3300025925 Bacteria 3462
358 Ga0207650_10053076 3300025925 Bacteria 3004
359 Ga0207650_10067035 3300025925 Bacteria 2693
360 Ga0207650_10079380 3300025925 Bacteria 2485
361 Ga0207650_10339738 3300025925 Bacteria 1233
362 Ga0207659_10020133 3300025926 Bacteria 4404
363 Ga0207659_10021759 3300025926 Bacteria 4263
364 Ga0207659_10179300 3300025926 Bacteria 1677
365 Ga0207659_10238711 3300025926 Bacteria 1469
366 Ga0207687_10044955 3300025927 Bacteria 3051
367 Ga0207687_10158829 3300025927 Bacteria 1733
368 Ga0207644_10000512 3300025931 Bacteria 25021
369 Ga0207644_10001487 3300025931 Bacteria 15074
370 Ga0207644_10013523 3300025931 Bacteria 5444
371 Ga0207644_10016648 3300025931 Bacteria 4949
372 Ga0207644_10021401 3300025931 Bacteria 4404
373 Ga0207644_10031406 3300025931 Bacteria 3700
374 Ga0207644_10052306 3300025931 Bacteria 2934
375 Ga0207644_10078101 3300025931 Bacteria 2439
376 Ga0207644_10089394 3300025931 Bacteria 2292
377 Ga0207690_10002907 3300025932 Bacteria 10321
378 Ga0207690_10073342 3300025932 Bacteria 2367
379 Ga0207690_10180957 3300025932 Bacteria 1587
380 Ga0207690_10262491 3300025932 Bacteria 1338
381 Ga0207690_10275174 3300025932 Bacteria 1309
382 Ga0207690_10449621 3300025932 Bacteria 1035
383 Ga0207706_10000171 3300025933 Bacteria 72122
384 Ga0207706_10001588 3300025933 Bacteria 22567
385 Ga0207706_10002226 3300025933 Bacteria 18934
386 Ga0207706_10006087 3300025933 Bacteria 11211
387 Ga0207706_10006168 3300025933 Bacteria 11130
388 Ga0207706_10046929 3300025933 Bacteria 3824
389 Ga0207706_10050041 3300025933 Bacteria 3693
390 Ga0207706_10153476 3300025933 Bacteria 2026
391 Ga0207706_10417134 3300025933 Bacteria 1163
392 Ga0207706_10421701 3300025933 Bacteria 1156
393 Ga0207686_10828754 3300025934 Bacteria 743
394 Ga0207709_10136942 3300025935 Bacteria 1677
395 Ga0207709_10191736 3300025935 Bacteria 1452
396 Ga0207670_10451827 3300025936 Bacteria 1036
397 Ga0207669_10006085 3300025937 Bacteria 5477
398 Ga0207669_10339826 3300025937 Bacteria 1156
399 Ga0207669_10434389 3300025937 Unclassified 1036
400 Ga0207704_10040013 3300025938 Unclassified 2736
401 Ga0207691_10000070 3300025940 Bacteria 84000
402 Ga0207691_10009222 3300025940 Bacteria 9470
403 Ga0207691_10018790 3300025940 Bacteria 6547
404 Ga0207691_10031175 3300025940 Bacteria 4978
405 Ga0207691_10049350 3300025940 Bacteria 3856
406 Ga0207691_10162991 3300025940 Bacteria 1955
407 Ga0207691_10188222 3300025940 Bacteria 1801
408 Ga0207711_10002610 3300025941 Bacteria 16002
409 Ga0207711_10003185 3300025941 Bacteria 14309
410 Ga0207711_10008150 3300025941 Bacteria 8768
411 Ga0207711_10026732 3300025941 Bacteria 4844
412 Ga0207711_10075402 3300025941 Bacteria 2935
413 Ga0207689_10000123 3300025942 Bacteria 64762
414 Ga0207689_10016637 3300025942 Bacteria 6225
415 Ga0207689_10036985 3300025942 Bacteria 4052
416 Ga0207689_10150167 3300025942 Bacteria 1921
417 Ga0207679_10004466 3300025945 Bacteria 8718
418 Ga0207679_10051338 3300025945 Bacteria 3018
419 Ga0207679_10080605 3300025945 Bacteria 2486
420 Ga0207679_10093092 3300025945 Bacteria 2336
421 Ga0207679_10152941 3300025945 Bacteria 1880
422 Ga0207667_10011731 3300025949 Bacteria 10164
423 Ga0207651_10000332 3300025960 Bacteria 20079
424 Ga0207651_10003373 3300025960 Bacteria 7841
425 Ga0207651_10034265 3300025960 Bacteria 3286
426 Ga0207651_10277486 3300025960 Bacteria 1383
427 Ga0207712_10000873 3300025961 Bacteria 21920
428 Ga0207712_10125124 3300025961 Bacteria 1951
429 Ga0207668_10000080 3300025972 Bacteria 72198
430 Ga0207668_10099164 3300025972 Bacteria 2160
431 Ga0207668_10337347 3300025972 Bacteria 1256
432 Ga0207640_10559783 3300025981 Bacteria 962
433 Ga0207658_10003885 3300025986 Bacteria 10519
434 Ga0207658_10011578 3300025986 Bacteria 6005
435 Ga0207658_10271249 3300025986 Bacteria 1450
436 Ga0207658_10286282 3300025986 Bacteria 1414
437 Ga0207658_10342607 3300025986 Bacteria 1299
438 Ga0207658_10373897 3300025986 Bacteria 1246
439 Ga0207677_10000970 3300026023 Bacteria 15880
440 Ga0207677_10101228 3300026023 Bacteria 2121
441 Ga0207677_10115221 3300026023 Bacteria 2010
442 Ga0207677_10306260 3300026023 Bacteria 1314
443 Ga0207703_10005654 3300026035 Bacteria 10038
444 Ga0207703_10013420 3300026035 Bacteria 6382
445 Ga0207703_10020778 3300026035 Bacteria 5136
446 Ga0207703_10025556 3300026035 Bacteria 4644
447 Ga0207703_10195054 3300026035 Bacteria 1796
448 Ga0207703_10221402 3300026035 Bacteria 1692
449 Ga0207639_10102461 3300026041 Bacteria 2317
450 Ga0207678_10005325 3300026067 Bacteria 11517
451 Ga0207678_10005348 3300026067 Bacteria 11496
452 Ga0207678_10009144 3300026067 Bacteria 8726
453 Ga0207678_10011949 3300026067 Bacteria 7624
454 Ga0207678_10041782 3300026067 Bacteria 3974
455 Ga0207678_10146708 3300026067 Bacteria 2014
456 Ga0207678_10164673 3300026067 Bacteria 1893
457 Ga0207678_10275372 3300026067 Bacteria 1444
458 Ga0207702_10007461 3300026078 Bacteria 9329
459 Ga0207641_10002327 3300026088 Bacteria 17629
460 Ga0207641_10011911 3300026088 Bacteria 7134
461 Ga0207641_10020297 3300026088 Bacteria 5458
462 Ga0207641_10020905 3300026088 Bacteria 5379
463 Ga0207641_10047463 3300026088 Bacteria 3621
464 Ga0207641_10185829 3300026088 Bacteria 1906
465 Ga0207641_10186927 3300026088 Bacteria 1901
466 Ga0207648_10000317 3300026089 Bacteria 52853
467 Ga0207648_10004979 3300026089 Bacteria 13505
468 Ga0207648_10008102 3300026089 Bacteria 10230
469 Ga0207648_10023495 3300026089 Bacteria 5522
470 Ga0207676_10001136 3300026095 Bacteria 20113
471 Ga0207676_10009568 3300026095 Bacteria 6901
472 Ga0207676_10012804 3300026095 Bacteria 6019
473 Ga0207676_10055347 3300026095 Bacteria 3114
474 Ga0207676_10550146 3300026095 Bacteria 1102
475 Ga0207676_10649968 3300026095 Bacteria 1018
476 Ga0207674_10000289 3300026116 Bacteria 63604
477 Ga0207674_10000937 3300026116 Bacteria 38029
478 Ga0207674_10015537 3300026116 Bacteria 8360
479 Ga0207674_10035753 3300026116 Bacteria 5183
480 Ga0207674_10052979 3300026116 Bacteria 4136
481 Ga0207674_10232549 3300026116 Bacteria 1791
482 Ga0207674_10300873 3300026116 Bacteria 1553
483 Ga0207674_10660124 3300026116 Bacteria 1010
484 Ga0207675_100486556 3300026118 Bacteria 1227
485 Ga0207683_10007467 3300026121 Bacteria 9377
486 Ga0207683_10011229 3300026121 Bacteria 7634
487 Ga0207683_10103529 3300026121 Bacteria 2543
488 Ga0207683_10234078 3300026121 Bacteria 1675
489 Ga0207698_10009884 3300026142 Bacteria 6101
490 Ga0207698_10090460 3300026142 Bacteria 2503
491 Ga0207698_10155890 3300026142 Bacteria 1989
492 Ga0207698_10473492 3300026142 Bacteria 1213
493 Ga0268266_10016106 3300028379 Bacteria 6392
494 Ga0268266_10061739 3300028379 Bacteria 3232
495 Ga0268266_10093387 3300028379 Bacteria 2640
496 Ga0268266_10187613 3300028379 Unclassified 1886
497 Ga0268265_10011650 3300028380 Bacteria 5946
498 Ga0268265_10016782 3300028380 Bacteria 5040
499 Ga0268265_10034768 3300028380 Bacteria 3676
500 Ga0268265_10035265 3300028380 Bacteria 3653
501 Ga0268265_10039427 3300028380 Bacteria 3482
502 Ga0268265_10139750 3300028380 Bacteria 2026
503 Ga0268264_10000567 3300028381 Bacteria 45270
504 Ga0268264_10002173 3300028381 Bacteria 17473
505 Ga0268264_10010817 3300028381 Bacteria 7538
506 Ga0268264_10045947 3300028381 Bacteria 3627
507 Ga0268264_10157613 3300028381 Unclassified 2042
508 Ga0268264_10302776 3300028381 Bacteria 1505
509 Ga0268264_10420824 3300028381 Bacteria 1288
510 Ga0307408_100019392 3300031548 Bacteria 4579
511 Ga0307408_100070213 3300031548 Bacteria 2585
512 Ga0307408_100077758 3300031548 Bacteria 2471
513 Ga0307408_100310574 3300031548 Bacteria 1324
514 Ga0307405_10002056 3300031731 Bacteria 8749
515 Ga0307405_10003593 3300031731 Bacteria 7161
516 Ga0307405_10048723 3300031731 Bacteria 2614
517 Ga0307405_10228335 3300031731 Bacteria 1370
518 Ga0307413_10000813 3300031824 Bacteria 10891
519 Ga0307413_10051691 3300031824 Bacteria 2477
520 Ga0307413_10103642 3300031824 Bacteria 1886
521 Ga0307413_10320677 3300031824 Bacteria 1183
522 Ga0307413_10374802 3300031824 Bacteria 1107
523 Ga0307413_10695228 3300031824 Unclassified 844
524 Ga0307410_10000618 3300031852 Bacteria 14640
525 Ga0307410_10031331 3300031852 Bacteria 3411
526 Ga0307410_10067607 3300031852 Bacteria 2465
527 Ga0307410_10095322 3300031852 Bacteria 2121
528 Ga0307410_10188884 3300031852 Bacteria 1565
529 Ga0307406_10000566 3300031901 Bacteria 21309
530 Ga0307406_10047231 3300031901 Bacteria 2712
531 Ga0307407_10180772 3300031903 Bacteria 1398
532 Ga0307412_10001240 3300031911 Bacteria 14426
533 Ga0307412_10039000 3300031911 Bacteria 3063
534 Ga0307412_10060452 3300031911 Bacteria 2543
535 Ga0307412_10155848 3300031911 Bacteria 1690
536 Ga0307412_10943555 3300031911 Bacteria 759
537 Ga0307409_100026831 3300031995 Bacteria 4070
538 Ga0307409_100063964 3300031995 Bacteria 2888
539 Ga0307409_100215944 3300031995 Bacteria 1727
540 Ga0307409_100538257 3300031995 Bacteria 1144
541 Ga0307409_100628901 3300031995 Bacteria 1064
542 Ga0307416_100001154 3300032002 Bacteria 14190
543 Ga0307416_100035484 3300032002 Bacteria 3809
544 Ga0307416_100051424 3300032002 Bacteria 3291
545 Ga0307416_100168011 3300032002 Bacteria 2037
546 Ga0307416_100187181 3300032002 Bacteria 1947
547 Ga0307416_100552924 3300032002 Bacteria 1224
548 Ga0307414_10000897 3300032004 Bacteria 15247
549 Ga0307414_10008740 3300032004 Bacteria 5772
550 Ga0307414_10181910 3300032004 Bacteria 1691
551 Ga0307414_10361975 3300032004 Bacteria 1248
552 Ga0307411_10000460 3300032005 Bacteria 14059
553 Ga0307411_10008634 3300032005 Bacteria 5295
554 Ga0307411_10102805 3300032005 Bacteria 2025
555 Ga0307411_10183854 3300032005 Bacteria 1589
556 Ga0307411_10586733 3300032005 Unclassified 956
557 Ga0307415_100000428 3300032126 Bacteria 18043
558 Ga0307415_100000970 3300032126 Bacteria 13173
559 Ga0307415_100012022 3300032126 Bacteria 4987
560 Ga0307415_100033713 3300032126 Bacteria 3325
561 Ga0307415_100047709 3300032126 Bacteria 2884
562 Ga0307415_100112828 3300032126 Bacteria 2020
563 Ga0395899_0011799 3300037312 Bacteria 6687
564 Ga0395899_0093418 3300037312 Bacteria 2177
565 Ga0395899_0110539 3300037312 Bacteria 1976
566 Ga0395900_0038488 3300037418 Bacteria 4929
567 Ga0395900_0177564 3300037418 Unclassified 2165
568 Ga0395900_0420905 3300037418 Bacteria 1296
569 Ga0395900_0629159 3300037418 Bacteria 1011
570 Ga0395898_0228053 3300037466 Bacteria 1776
571 Ga0395898_0349755 3300037466 Bacteria 1409
572 Ga0395898_0517997 3300037466 Bacteria 1134
573 Ga0395905_0009647 3300037471 Bacteria 9422
574 Ga0395905_0018908 3300037471 Bacteria 6534
575 Ga0395905_0062645 3300037471 Unclassified 3479
576 Ga0395905_0123109 3300037471 Bacteria 2438
577 Ga0395905_0132786 3300037471 Bacteria 2341
578 Ga0395905_0142809 3300037471 Bacteria 2252
579 Ga0395905_0215194 3300037471 Bacteria 1799
580 Ga0395905_0256676 3300037471 Bacteria 1632
581 Ga0395905_0308976 3300037471 Bacteria 1469
582 Ga0395905_0439030 3300037471 Unclassified 1202
583 Ga0395905_0465274 3300037471 Bacteria 1163
584 Ga0395905_0654574 3300037471 Bacteria 952
585 Ga0395905_0692336 3300037471 Bacteria 921
586 Ga0395901_0102256 3300038443 Bacteria 3007
587 Ga0395901_0133989 3300038443 Bacteria 2603
588 Ga0395901_0250611 3300038443 Bacteria 1845
589 Ga0395901_0366593 3300038443 Bacteria 1484
590 Ga0395901_0465242 3300038443 Bacteria 1291
591 Ga0395901_0509469 3300038443 Bacteria 1224
592 Ga0436363_0578168 3300039450 Bacteria 1222
593 Ga0439438_039494 3300041405 Bacteria 1229
594 Ga0439445_0097466 3300042004 Bacteria 832
595 Ga0439432_004034 3300042006 Bacteria 5386
596 Ga0450914_015013 3300042118 Unclassified 805
597 Ga0450890_003118 3300042127 Bacteria 2220
598 Ga0450889_000107 3300042144 Bacteria 8145
599 Ga0466972_0031341 3300044658 Bacteria 2616
600 Ga0466963_0188430 3300044694 Bacteria 1441
601 Ga0466963_0317340 3300044694 Bacteria 1096
602 Ga0466971_0058017 3300044719 Bacteria 1747
603 Ga0466968_0248921 3300044735 Bacteria 844
604 Ga0466957_0211444 3300044842 Bacteria 1277
605 Ga0466959_0160977 3300045049 Bacteria 1578
606 Ga0466967_0062933 3300045976 Bacteria 3295
607 Ga0466967_0177503 3300045976 Bacteria 2007
608 Ga0466967_0182550 3300045976 Bacteria 1980
609 Ga0495643_0259389 3300046522 Unclassified 808
610 Ga0495663_0142059 3300046525 Unclassified 815
611 Ga0495621_0028485 3300046539 Bacteria 1899
612 Ga0495669_0013194 3300046684 Bacteria 3519
613 Ga0495669_0061966 3300046684 Bacteria 1694
614 Ga0495677_0049402 3300047445 Bacteria 1546
615 Ga0496100_0037795 3300048903 Bacteria 3055
616 Ga0496101_0094909 3300048904 Bacteria 2224
617 Ga0496102_0034047 3300048905 Bacteria 4581
618 Ga0496102_0417023 3300048905 Bacteria 1261
619 Ga0496103_0030180 3300048906 Bacteria 3298
620 Ga0496104_0072966 3300048907 Bacteria 3265
621 Ga0496104_0101429 3300048907 Bacteria 2756
622 Ga0496106_0175313 3300048909 Bacteria 1701
623 Ga0496106_0446476 3300048909 Bacteria 1039
624 Ga0496107_0071694 3300048910 Bacteria 2518
625 Ga0496107_0278367 3300048910 Bacteria 1246
626 Ga0496107_0437126 3300048910 Bacteria 972
627 Ga0496107_0462298 3300048910 Bacteria 942
628 Ga0496108_0009534 3300048911 Bacteria 7866
629 Ga0496109_0029131 3300048912 Bacteria 4942
630 Ga0496109_0393485 3300048912 Bacteria 1309
631 Ga0496110_0014821 3300048913 Bacteria 6477
632 Ga0496110_0046972 3300048913 Bacteria 3779
633 Ga0496110_0070060 3300048913 Bacteria 3106
634 Ga0496110_0100283 3300048913 Bacteria 2595
635 Ga0496110_0232983 3300048913 Bacteria 1675
636 Ga0496111_0007079 3300048914 Bacteria 7328
637 Ga0496111_0007956 3300048914 Bacteria 6992
638 Ga0496111_0038711 3300048914 Bacteria 3417
639 Ga0496111_0277241 3300048914 Bacteria 1244
640 Ga0496112_0019551 3300048915 Bacteria 6395
641 Ga0496112_0023108 3300048915 Bacteria 5935
642 Ga0496112_0066629 3300048915 Bacteria 3553
643 Ga0496112_0087238 3300048915 Bacteria 3087
644 Ga0496112_0184560 3300048915 Bacteria 2049
645 Ga0496112_0218915 3300048915 Bacteria 1860
646 Ga0496113_0008839 3300048916 Bacteria 6583
647 Ga0496113_0025643 3300048916 Bacteria 4205
648 Ga0496113_0055780 3300048916 Bacteria 2963
649 Ga0496113_0336552 3300048916 Bacteria 1210
650 Ga0501306_020502 3300049127 Bacteria 920
651 Ga0501306_021910 3300049127 Unclassified 898
652 Ga0501308_030018 3300049128 Bacteria 725
653 Ga0501310_029181 3300049130 Bacteria 726
654 Ga0501305_046804 3300049161 Unclassified 717
655 Ga0501307_032961 3300049162 Bacteria 726
656 Ga0501292_010004 3300049515 Bacteria 1414
657 Ga0501312_053056 3300049528 Unclassified 688
658 Ga0501315_041813 3300049531 Bacteria 696
659 Ga0501316_030180 3300049532 Bacteria 722
660 Ga0501317_025020 3300049533 Bacteria 834
661 Ga0501331_05598 3300049547 Unclassified 720
662 Ga0501067_0018744 3300049583 Bacteria 3831
663 Ga0501069_0116854 3300049585 Bacteria 1522
664 Ga0501209_025633 3300049656 Bacteria 1448
665 Ga0501224_021268 3300049664 Bacteria 967
666 Ga0501236_045452 3300049670 Bacteria 739
667 Ga0501229_016131 3300049706 Unclassified 971
668 Ga0501268_049321 3300049765 Bacteria 811
669 Ga0501272_009127 3300049769 Bacteria 1094
670 nmdc:mga07m45_243082_c1 3300050496 Bacteria 1047
671 nmdc:mga08y16_115453_c1 3300050511 Bacteria 2795
672 nmdc:mga0n895_986443_c1 3300050512 Bacteria 824
673 nmdc:mga0rr50_777251_c1 3300050513 Bacteria 817
674 nmdc:mga0a205_3262_c1 3300050515 Bacteria 14434
675 Ga0587090_010738 3300059510 Bacteria 1275

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100277982 Ga0070670_1002779821 205
2 3300005336 Ga0070680_100273109 Ga0070680_1002731092 205
3 3300005337 Ga0070682_100085989 Ga0070682_1000859892 205
4 3300005366 Ga0070659_100577291 Ga0070659_1005772911 205
5 3300005457 Ga0070662_100370192 Ga0070662_1003701922 205
6 3300005539 Ga0068853_100287688 Ga0068853_1002876881 205
7 3300005328 Ga0070676_10054260 Ga0070676_100542602 206
8 3300005331 Ga0070670_100009847 Ga0070670_1000098475 206
9 3300005335 Ga0070666_10000253 Ga0070666_100002532 206
10 3300005339 Ga0070660_100117017 Ga0070660_1001170172 206
11 3300005339 Ga0070660_100209420 Ga0070660_1002094202 206
12 3300005366 Ga0070659_100046857 Ga0070659_1000468573 206
13 3300005456 Ga0070678_100001158 Ga0070678_1000011583 206
14 3300005457 Ga0070662_100003550 Ga0070662_1000035502 206
15 3300005530 Ga0070679_100042920 Ga0070679_1000429205 206
16 3300005539 Ga0068853_100142621 Ga0068853_1001426213 206
17 3300005543 Ga0070672_100001634 Ga0070672_10000163414 206
18 3300005548 Ga0070665_100014462 Ga0070665_1000144623 206
19 3300005564 Ga0070664_100124294 Ga0070664_1001242942 206
20 3300005614 Ga0068856_100327908 Ga0068856_1003279082 206
21 3300005617 Ga0068859_100129140 Ga0068859_1001291402 206
22 3300005618 Ga0068864_100004397 Ga0068864_1000043973 206
23 3300005618 Ga0068864_100006396 Ga0068864_1000063968 206
24 3300005841 Ga0068863_100002267 Ga0068863_10000226713 206
25 3300005842 Ga0068858_100008057 Ga0068858_1000080579 206
26 3300005843 Ga0068860_100234956 Ga0068860_1002349562 206
27 3300006237 Ga0097621_100050776 Ga0097621_1000507762 206
28 3300006358 Ga0068871_100035112 Ga0068871_1000351124 206
29 3300006931 Ga0097620_100129141 Ga0097620_1001291412 206
30 3300009093 Ga0105240_10084680 Ga0105240_100846803 206
31 3300009094 Ga0111539_10577862 Ga0111539_105778622 206
32 3300009148 Ga0105243_10081802 Ga0105243_100818023 206
33 3300009176 Ga0105242_11330236 Ga0105242_113302361 206
34 3300009177 Ga0105248_10018834 Ga0105248_100188343 206
35 3300009177 Ga0105248_11070046 Ga0105248_110700462 206
36 3300009545 Ga0105237_10027241 Ga0105237_100272413 206
37 3300009553 Ga0105249_10016026 Ga0105249_100160263 206
38 3300009553 Ga0105249_10058327 Ga0105249_100583272 206
39 3300010375 Ga0105239_10062296 Ga0105239_100622963 206
40 3300011119 Ga0105246_10041133 Ga0105246_100411332 206
41 3300013100 Ga0157373_10155045 Ga0157373_101550452 206
42 3300013100 Ga0157373_10349672 Ga0157373_103496722 206
43 3300013102 Ga0157371_10035109 Ga0157371_100351092 206
44 3300013102 Ga0157371_10202052 Ga0157371_102020522 206
45 3300013296 Ga0157374_10087444 Ga0157374_100874443 206
46 3300013296 Ga0157374_10347850 Ga0157374_103478502 206
47 3300013306 Ga0163162_10001772 Ga0163162_1000177213 206
48 3300013306 Ga0163162_10323024 Ga0163162_103230241 206
49 3300013307 Ga0157372_10223846 Ga0157372_102238463 206
50 3300013308 Ga0157375_10001232 Ga0157375_100012326 206
51 3300013308 Ga0157375_10019147 Ga0157375_100191474 206
52 3300013308 Ga0157375_10445107 Ga0157375_104451072 206
53 3300014325 Ga0163163_10038078 Ga0163163_100380782 206
54 3300014325 Ga0163163_10046704 Ga0163163_100467042 206
55 3300014745 Ga0157377_10001413 Ga0157377_100014136 206
56 3300014968 Ga0157379_10012038 Ga0157379_100120383 206
57 3300014968 Ga0157379_10187036 Ga0157379_101870362 206
58 3300025904 Ga0207647_10156671 Ga0207647_101566712 206
59 3300025914 Ga0207671_10462464 Ga0207671_104624642 206
60 3300025925 Ga0207650_10004522 Ga0207650_100045227 206
61 3300025926 Ga0207659_10020133 Ga0207659_100201332 206
62 3300025931 Ga0207644_10013523 Ga0207644_100135235 206
63 3300025931 Ga0207644_10031406 Ga0207644_100314062 206
64 3300025933 Ga0207706_10001588 Ga0207706_1000158815 206
65 3300025940 Ga0207691_10009222 Ga0207691_100092222 206
66 3300025941 Ga0207711_10026732 Ga0207711_100267322 206
67 3300025945 Ga0207679_10051338 Ga0207679_100513382 206
68 3300025960 Ga0207651_10003373 Ga0207651_100033735 206
69 3300026035 Ga0207703_10020778 Ga0207703_100207783 206
70 3300026088 Ga0207641_10047463 Ga0207641_100474632 206
71 3300026088 Ga0207641_10185829 Ga0207641_101858292 206
72 3300026095 Ga0207676_10012804 Ga0207676_100128043 206
73 3300026121 Ga0207683_10011229 Ga0207683_100112293 206
74 3300028381 Ga0268264_10157613 Ga0268264_101576132 206
75 3300031852 Ga0307410_10188884 Ga0307410_101888842 206
76 3300031911 Ga0307412_10943555 Ga0307412_109435551 206
77 3300037312 Ga0395899_0011799 Ga0395899_0011799_2525_3154 206
78 3300037418 Ga0395900_0038488 Ga0395900_0038488_2685_3314 206
79 3300037466 Ga0395898_0349755 Ga0395898_0349755_41_661 206
80 3300037466 Ga0395898_0517997 Ga0395898_0517997_120_749 206
81 3300037471 Ga0395905_0009647 Ga0395905_0009647_1276_1899 206
82 3300037471 Ga0395905_0123109 Ga0395905_0123109_1616_2245 206
83 3300037471 Ga0395905_0215194 Ga0395905_0215194_738_1364 206
84 3300037471 Ga0395905_0308976 Ga0395905_0308976_165_788 206
85 3300037471 Ga0395905_0439030 Ga0395905_0439030_42_662 206
86 3300037471 Ga0395905_0654574 Ga0395905_0654574_297_917 206
87 3300037471 Ga0395905_0692336 Ga0395905_0692336_243_866 206
88 3300038443 Ga0395901_0102256 Ga0395901_0102256_1933_2559 206
89 3300038443 Ga0395901_0250611 Ga0395901_0250611_254_877 206
90 3300038443 Ga0395901_0366593 Ga0395901_0366593_209_838 206
91 3300044694 Ga0466963_0188430 Ga0466963_0188430_323_943 206
92 3300045976 Ga0466967_0177503 Ga0466967_0177503_164_784 206
93 3300047445 Ga0495677_0049402 Ga0495677_0049402_746_1375 206
94 3300048904 Ga0496101_0094909 Ga0496101_0094909_71_691 206
95 3300048905 Ga0496102_0417023 Ga0496102_0417023_603_1226 206
96 3300048910 Ga0496107_0278367 Ga0496107_0278367_587_1222 206
97 3300048910 Ga0496107_0462298 Ga0496107_0462298_160_783 206
98 3300048912 Ga0496109_0393485 Ga0496109_0393485_488_1108 206
99 3300048913 Ga0496110_0014821 Ga0496110_0014821_2170_2793 206
100 3300048913 Ga0496110_0232983 Ga0496110_0232983_495_1115 206
101 3300048914 Ga0496111_0007956 Ga0496111_0007956_5271_5894 206
102 3300048915 Ga0496112_0023108 Ga0496112_0023108_684_1307 206
103 3300048916 Ga0496113_0025643 Ga0496113_0025643_3246_3869 206
104 3300049127 Ga0501306_020502 Ga0501306_020502_12_635 206
105 3300049127 Ga0501306_021910 Ga0501306_021910_201_830 206
106 3300049128 Ga0501308_030018 Ga0501308_030018_61_690 206
107 3300049130 Ga0501310_029181 Ga0501310_029181_61_690 206
108 3300049161 Ga0501305_046804 Ga0501305_046804_29_658 206
109 3300049162 Ga0501307_032961 Ga0501307_032961_61_690 206
110 3300049528 Ga0501312_053056 Ga0501312_053056_48_677 206
111 3300049531 Ga0501315_041813 Ga0501315_041813_39_668 206
112 3300049532 Ga0501316_030180 Ga0501316_030180_64_693 206
113 3300049533 Ga0501317_025020 Ga0501317_025020_37_666 206
114 3300049547 Ga0501331_05598 Ga0501331_05598_38_667 206
115 3300049706 Ga0501229_016131 Ga0501229_016131_59_688 206
116 3300050512 nmdc:mga0n895_986443_c1 nmdc:mga0n895_986443_c1_29_649 206
117 3300050513 nmdc:mga0rr50_777251_c1 nmdc:mga0rr50_777251_c1_58_678 206
118 3300050515 nmdc:mga0a205_3262_c1 nmdc:mga0a205_3262_c1_1397_2017 206
119 3300025933 Ga0207706_10421701 Ga0207706_104217012 207
120 3300031731 Ga0307405_10002056 Ga0307405_100020566 208
121 3300031824 Ga0307413_10000813 Ga0307413_100008139 208
122 3300031901 Ga0307406_10000566 Ga0307406_1000056625 208
123 3300031911 Ga0307412_10001240 Ga0307412_100012403 208
124 3300031995 Ga0307409_100215944 Ga0307409_1002159441 208
125 3300032002 Ga0307416_100001154 Ga0307416_1000011546 208
126 3300032004 Ga0307414_10000897 Ga0307414_1000089711 208
127 3300032005 Ga0307411_10000460 Ga0307411_1000046010 208
128 3300032126 Ga0307415_100000970 Ga0307415_10000097012 208
129 3300005331 Ga0070670_100007621 Ga0070670_1000076219 212
130 3300005334 Ga0068869_100056398 Ga0068869_1000563982 212
131 3300005335 Ga0070666_10075538 Ga0070666_100755382 212
132 3300005338 Ga0068868_100003858 Ga0068868_1000038582 212
133 3300005339 Ga0070660_100000767 Ga0070660_1000007679 212
134 3300005353 Ga0070669_100000699 Ga0070669_1000006998 212
135 3300005355 Ga0070671_100010935 Ga0070671_1000109356 212
136 3300005356 Ga0070674_100014760 Ga0070674_1000147603 212
137 3300005364 Ga0070673_100003743 Ga0070673_1000037433 212
138 3300005366 Ga0070659_100000753 Ga0070659_10000075311 212
139 3300005367 Ga0070667_100001558 Ga0070667_10000155813 212
140 3300005455 Ga0070663_100167850 Ga0070663_1001678502 212
141 3300005457 Ga0070662_100002248 Ga0070662_1000022489 212
142 3300005543 Ga0070672_100000234 Ga0070672_1000002343 212
143 3300005563 Ga0068855_100085658 Ga0068855_1000856583 212
144 3300005564 Ga0070664_100063660 Ga0070664_1000636603 212
145 3300005577 Ga0068857_100004660 Ga0068857_1000046602 212
146 3300005616 Ga0068852_100000847 Ga0068852_10000084710 212
147 3300005617 Ga0068859_100002893 Ga0068859_10000289314 212
148 3300005618 Ga0068864_100000378 Ga0068864_1000003786 212
149 3300005840 Ga0068870_10059904 Ga0068870_100599042 212
150 3300005841 Ga0068863_100000523 Ga0068863_1000005238 212
151 3300005842 Ga0068858_100012709 Ga0068858_1000127093 212
152 3300005843 Ga0068860_100007966 Ga0068860_1000079667 212
153 3300005844 Ga0068862_100054057 Ga0068862_1000540572 212
154 3300006931 Ga0097620_100002893 Ga0097620_10000289314 212
155 3300009148 Ga0105243_10042713 Ga0105243_100427133 212
156 3300009174 Ga0105241_10007436 Ga0105241_100074367 212
157 3300009177 Ga0105248_10000159 Ga0105248_1000015910 212
158 3300010375 Ga0105239_10118106 Ga0105239_101181063 212
159 3300013100 Ga0157373_10001876 Ga0157373_1000187611 212
160 3300013308 Ga0157375_10145025 Ga0157375_101450252 212
161 3300025315 Ga0207697_10002979 Ga0207697_100029795 212
162 3300025893 Ga0207682_10074542 Ga0207682_100745422 212
163 3300025899 Ga0207642_10129028 Ga0207642_101290282 212
164 3300025901 Ga0207688_10000018 Ga0207688_1000001824 212
165 3300025903 Ga0207680_10162116 Ga0207680_101621162 212
166 3300025904 Ga0207647_10000333 Ga0207647_1000033312 212
167 3300025908 Ga0207643_10196781 Ga0207643_101967812 212
168 3300025919 Ga0207657_10010774 Ga0207657_100107743 212
169 3300025920 Ga0207649_10037901 Ga0207649_100379012 212
170 3300025923 Ga0207681_10001180 Ga0207681_1000118014 212
171 3300025925 Ga0207650_10005251 Ga0207650_100052516 212
172 3300025927 Ga0207687_10044955 Ga0207687_100449552 212
173 3300025931 Ga0207644_10089394 Ga0207644_100893944 212
174 3300025933 Ga0207706_10000171 Ga0207706_1000017114 212
175 3300025938 Ga0207704_10040013 Ga0207704_100400132 212
176 3300025940 Ga0207691_10000070 Ga0207691_1000007028 212
177 3300025941 Ga0207711_10002610 Ga0207711_100026103 212
178 3300025942 Ga0207689_10000123 Ga0207689_1000012310 212
179 3300025945 Ga0207679_10080605 Ga0207679_100806053 212
180 3300025960 Ga0207651_10000332 Ga0207651_100003323 212
181 3300025986 Ga0207658_10011578 Ga0207658_100115784 212
182 3300026023 Ga0207677_10000970 Ga0207677_100009708 212
183 3300026035 Ga0207703_10221402 Ga0207703_102214022 212
184 3300026067 Ga0207678_10146708 Ga0207678_101467082 212
185 3300026088 Ga0207641_10002327 Ga0207641_1000232714 212
186 3300026089 Ga0207648_10000317 Ga0207648_1000031743 212
187 3300026095 Ga0207676_10001136 Ga0207676_100011367 212
188 3300026116 Ga0207674_10000937 Ga0207674_1000093726 212
189 3300028380 Ga0268265_10016782 Ga0268265_100167824 212
190 3300028381 Ga0268264_10002173 Ga0268264_1000217314 212
191 3300031548 Ga0307408_100019392 Ga0307408_1000193924 212
192 3300031731 Ga0307405_10003593 Ga0307405_100035932 212
193 3300031824 Ga0307413_10051691 Ga0307413_100516912 212
194 3300031852 Ga0307410_10095322 Ga0307410_100953222 212
195 3300031911 Ga0307412_10039000 Ga0307412_100390005 212
196 3300031995 Ga0307409_100026831 Ga0307409_1000268315 212
197 3300032002 Ga0307416_100168011 Ga0307416_1001680111 212
198 3300032004 Ga0307414_10008740 Ga0307414_100087403 212
199 3300032126 Ga0307415_100033713 Ga0307415_1000337133 212
200 3300005331 Ga0070670_100052974 Ga0070670_1000529742 216
201 3300005618 Ga0068864_100640722 Ga0068864_1006407222 216
202 3300025925 Ga0207650_10039199 Ga0207650_100391992 216
203 3300031548 Ga0307408_100310574 Ga0307408_1003105742 217
204 3300031731 Ga0307405_10228335 Ga0307405_102283351 217
205 3300031824 Ga0307413_10320677 Ga0307413_103206771 217
206 3300031852 Ga0307410_10031331 Ga0307410_100313313 217
207 3300031903 Ga0307407_10180772 Ga0307407_101807722 217
208 3300031911 Ga0307412_10060452 Ga0307412_100604522 217
209 3300031995 Ga0307409_100063964 Ga0307409_1000639643 217
210 3300032002 Ga0307416_100051424 Ga0307416_1000514244 217
211 3300032004 Ga0307414_10361975 Ga0307414_103619751 217
212 3300032005 Ga0307411_10008634 Ga0307411_100086341 217
213 3300032005 Ga0307411_10183854 Ga0307411_101838543 217
214 3300032126 Ga0307415_100000428 Ga0307415_10000042812 217
215 3300049583 Ga0501067_0018744 Ga0501067_0018744_1921_2589 220
216 3300005331 Ga0070670_100005108 Ga0070670_1000051083 221
217 3300005333 Ga0070677_10017560 Ga0070677_100175601 221
218 3300005333 Ga0070677_10024853 Ga0070677_100248531 221
219 3300005344 Ga0070661_100011576 Ga0070661_1000115762 221
220 3300005344 Ga0070661_100379720 Ga0070661_1003797202 221
221 3300005354 Ga0070675_100254350 Ga0070675_1002543502 221
222 3300005355 Ga0070671_100218805 Ga0070671_1002188051 221
223 3300005356 Ga0070674_100032534 Ga0070674_1000325342 221
224 3300005356 Ga0070674_100250893 Ga0070674_1002508932 221
225 3300005356 Ga0070674_100512662 Ga0070674_1005126621 221
226 3300005366 Ga0070659_100031636 Ga0070659_1000316362 221
227 3300005456 Ga0070678_100006078 Ga0070678_1000060784 221
228 3300005456 Ga0070678_100084622 Ga0070678_1000846221 221
229 3300005457 Ga0070662_100028839 Ga0070662_1000288392 221
230 3300005457 Ga0070662_100038370 Ga0070662_1000383702 221
231 3300005543 Ga0070672_100013444 Ga0070672_1000134442 221
232 3300005543 Ga0070672_100197400 Ga0070672_1001974002 221
233 3300005564 Ga0070664_100002747 Ga0070664_10000274712 221
234 3300005564 Ga0070664_100342456 Ga0070664_1003424562 221
235 3300005577 Ga0068857_100103289 Ga0068857_1001032892 221
236 3300005578 Ga0068854_100187387 Ga0068854_1001873872 221
237 3300005618 Ga0068864_100003680 Ga0068864_1000036803 221
238 3300005618 Ga0068864_100849027 Ga0068864_1008490272 221
239 3300009177 Ga0105248_10441541 Ga0105248_104415412 221
240 3300009551 Ga0105238_10523152 Ga0105238_105231521 221
241 3300013306 Ga0163162_10499657 Ga0163162_104996572 221
242 3300025893 Ga0207682_10024020 Ga0207682_100240202 221
243 3300025901 Ga0207688_10017402 Ga0207688_100174022 221
244 3300025907 Ga0207645_10387821 Ga0207645_103878212 221
245 3300025920 Ga0207649_10029541 Ga0207649_100295412 221
246 3300025925 Ga0207650_10053076 Ga0207650_100530762 221
247 3300025931 Ga0207644_10000512 Ga0207644_1000051224 221
248 3300025932 Ga0207690_10275174 Ga0207690_102751742 221
249 3300025932 Ga0207690_10449621 Ga0207690_104496212 221
250 3300025933 Ga0207706_10046929 Ga0207706_100469292 221
251 3300025933 Ga0207706_10153476 Ga0207706_101534762 221
252 3300025937 Ga0207669_10434389 Ga0207669_104343892 221
253 3300025940 Ga0207691_10049350 Ga0207691_100493502 221
254 3300025940 Ga0207691_10188222 Ga0207691_101882222 221
255 3300025945 Ga0207679_10093092 Ga0207679_100930922 221
256 3300026023 Ga0207677_10101228 Ga0207677_101012282 221
257 3300026067 Ga0207678_10011949 Ga0207678_100119494 221
258 3300026095 Ga0207676_10055347 Ga0207676_100553472 221
259 3300026116 Ga0207674_10300873 Ga0207674_103008732 221
260 3300026118 Ga0207675_100486556 Ga0207675_1004865561 221
261 3300026121 Ga0207683_10007467 Ga0207683_100074673 221
262 3300026121 Ga0207683_10103529 Ga0207683_101035292 221
263 3300031852 Ga0307410_10000618 Ga0307410_1000061811 221
264 3300032002 Ga0307416_100035484 Ga0307416_1000354843 221
265 3300032126 Ga0307415_100047709 Ga0307415_1000477092 221
266 3300039450 Ga0436363_0578168 Ga0436363_0578168_480_1145 221
267 3300048915 Ga0496112_0019551 Ga0496112_0019551_2802_3467 221
268 3300005564 Ga0070664_100001061 Ga0070664_10000106115 222
269 3300006237 Ga0097621_100138414 Ga0097621_1001384142 222
270 3300025925 Ga0207650_10021095 Ga0207650_100210952 222
271 3300025945 Ga0207679_10004466 Ga0207679_100044665 222
272 3300005366 Ga0070659_100018048 Ga0070659_1000180486 223
273 3300005367 Ga0070667_100009679 Ga0070667_1000096793 223
274 3300005444 Ga0070694_100065073 Ga0070694_1000650732 223
275 3300005458 Ga0070681_10330554 Ga0070681_103305542 223
276 3300005539 Ga0068853_100222372 Ga0068853_1002223721 223
277 3300005545 Ga0070695_100005741 Ga0070695_1000057414 223
278 3300005546 Ga0070696_100236783 Ga0070696_1002367831 223
279 3300005547 Ga0070693_100102117 Ga0070693_1001021172 223
280 3300005617 Ga0068859_100052657 Ga0068859_1000526573 223
281 3300005834 Ga0068851_10122342 Ga0068851_101223422 223
282 3300005843 Ga0068860_100310534 Ga0068860_1003105342 223
283 3300006237 Ga0097621_100229918 Ga0097621_1002299181 223
284 3300006358 Ga0068871_100009465 Ga0068871_10000946510 223
285 3300006931 Ga0097620_100052659 Ga0097620_1000526592 223
286 3300009094 Ga0111539_10034797 Ga0111539_100347973 223
287 3300009177 Ga0105248_10260348 Ga0105248_102603482 223
288 3300013100 Ga0157373_10211875 Ga0157373_102118752 223
289 3300014969 Ga0157376_10024177 Ga0157376_100241776 223
290 3300025907 Ga0207645_10016307 Ga0207645_100163074 223
291 3300025919 Ga0207657_10184001 Ga0207657_101840012 223
292 3300025933 Ga0207706_10006087 Ga0207706_100060877 223
293 3300026088 Ga0207641_10020297 Ga0207641_100202974 223
294 3300028381 Ga0268264_10420824 Ga0268264_104208242 223
295 3300031824 Ga0307413_10695228 Ga0307413_106952281 223
296 3300032005 Ga0307411_10586733 Ga0307411_105867331 223
297 3300032126 Ga0307415_100012022 Ga0307415_1000120226 223
298 3300037418 Ga0395900_0177564 Ga0395900_0177564_653_1324 223
299 3300037471 Ga0395905_0018908 Ga0395905_0018908_1938_2612 223
300 3300037471 Ga0395905_0062645 Ga0395905_0062645_573_1244 223
301 3300041405 Ga0439438_039494 Ga0439438_039494_349_1020 223
302 3300042118 Ga0450914_015013 Ga0450914_015013_84_755 223
303 3300042127 Ga0450890_003118 Ga0450890_003118_1174_1845 223
304 3300042144 Ga0450889_000107 Ga0450889_000107_1318_1989 223
305 3300044735 Ga0466968_0248921 Ga0466968_0248921_142_813 223
306 3300045976 Ga0466967_0062933 Ga0466967_0062933_1514_2185 223
307 3300048905 Ga0496102_0034047 Ga0496102_0034047_1038_1709 223
308 3300048906 Ga0496103_0030180 Ga0496103_0030180_107_778 223
309 3300048907 Ga0496104_0072966 Ga0496104_0072966_184_855 223
310 3300048910 Ga0496107_0437126 Ga0496107_0437126_289_960 223
311 3300048913 Ga0496110_0100283 Ga0496110_0100283_914_1585 223
312 3300048914 Ga0496111_0007079 Ga0496111_0007079_1039_1710 223
313 3300048915 Ga0496112_0184560 Ga0496112_0184560_705_1376 223
314 3300048916 Ga0496113_0055780 Ga0496113_0055780_1563_2234 223
315 3300049664 Ga0501224_021268 Ga0501224_021268_205_876 223
316 3300050511 nmdc:mga08y16_115453_c1 nmdc:mga08y16_115453_c1_1889_2560 223
317 3300001979 JGI24740J21852_10004638 JGI24740J21852_100046383 224
318 3300001990 JGI24737J22298_10010811 JGI24737J22298_100108112 224
319 3300005293 Ga0065715_10019182 Ga0065715_100191822 224
320 3300005327 Ga0070658_10014288 Ga0070658_100142882 224
321 3300005327 Ga0070658_10224706 Ga0070658_102247062 224
322 3300005327 Ga0070658_10363362 Ga0070658_103633622 224
323 3300005327 Ga0070658_10527239 Ga0070658_105272392 224
324 3300005328 Ga0070676_10068663 Ga0070676_100686632 224
325 3300005328 Ga0070676_10207448 Ga0070676_102074482 224
326 3300005328 Ga0070676_10245460 Ga0070676_102454602 224
327 3300005329 Ga0070683_100039994 Ga0070683_1000399943 224
328 3300005331 Ga0070670_100056692 Ga0070670_1000566923 224
329 3300005331 Ga0070670_100215658 Ga0070670_1002156582 224
330 3300005331 Ga0070670_100489322 Ga0070670_1004893221 224
331 3300005331 Ga0070670_100509356 Ga0070670_1005093562 224
332 3300005333 Ga0070677_10036872 Ga0070677_100368722 224
333 3300005334 Ga0068869_100304533 Ga0068869_1003045332 224
334 3300005335 Ga0070666_10363896 Ga0070666_103638962 224
335 3300005337 Ga0070682_100523148 Ga0070682_1005231481 224
336 3300005338 Ga0068868_100063804 Ga0068868_1000638042 224
337 3300005338 Ga0068868_100641079 Ga0068868_1006410792 224
338 3300005339 Ga0070660_100015886 Ga0070660_1000158862 224
339 3300005339 Ga0070660_100022463 Ga0070660_1000224633 224
340 3300005340 Ga0070689_100743806 Ga0070689_1007438061 224
341 3300005344 Ga0070661_100034120 Ga0070661_1000341201 224
342 3300005344 Ga0070661_100075203 Ga0070661_1000752033 224
343 3300005344 Ga0070661_100090922 Ga0070661_1000909222 224
344 3300005344 Ga0070661_100092352 Ga0070661_1000923522 224
345 3300005344 Ga0070661_100095835 Ga0070661_1000958352 224
346 3300005344 Ga0070661_100281348 Ga0070661_1002813482 224
347 3300005345 Ga0070692_10073701 Ga0070692_100737012 224
348 3300005347 Ga0070668_100017368 Ga0070668_1000173683 224
349 3300005347 Ga0070668_100256291 Ga0070668_1002562912 224
350 3300005353 Ga0070669_100114359 Ga0070669_1001143592 224
351 3300005353 Ga0070669_100280725 Ga0070669_1002807252 224
352 3300005354 Ga0070675_100063336 Ga0070675_1000633362 224
353 3300005354 Ga0070675_100073038 Ga0070675_1000730382 224
354 3300005355 Ga0070671_100021869 Ga0070671_1000218693 224
355 3300005355 Ga0070671_100024219 Ga0070671_1000242193 224
356 3300005355 Ga0070671_100255644 Ga0070671_1002556442 224
357 3300005356 Ga0070674_100008703 Ga0070674_1000087033 224
358 3300005356 Ga0070674_100095518 Ga0070674_1000955183 224
359 3300005364 Ga0070673_100000937 Ga0070673_10000093715 224
360 3300005364 Ga0070673_100052436 Ga0070673_1000524363 224
361 3300005364 Ga0070673_100129135 Ga0070673_1001291352 224
362 3300005366 Ga0070659_100015914 Ga0070659_1000159143 224
363 3300005366 Ga0070659_100101042 Ga0070659_1001010423 224
364 3300005367 Ga0070667_100008033 Ga0070667_1000080338 224
365 3300005367 Ga0070667_100020506 Ga0070667_1000205063 224
366 3300005367 Ga0070667_100032398 Ga0070667_1000323982 224
367 3300005367 Ga0070667_100035505 Ga0070667_1000355055 224
368 3300005367 Ga0070667_100159917 Ga0070667_1001599172 224
369 3300005367 Ga0070667_100538478 Ga0070667_1005384782 224
370 3300005367 Ga0070667_100543098 Ga0070667_1005430982 224
371 3300005440 Ga0070705_100273864 Ga0070705_1002738642 224
372 3300005444 Ga0070694_100028795 Ga0070694_1000287952 224
373 3300005455 Ga0070663_100008713 Ga0070663_1000087133 224
374 3300005455 Ga0070663_100333367 Ga0070663_1003333671 224
375 3300005455 Ga0070663_100438451 Ga0070663_1004384512 224
376 3300005456 Ga0070678_100251745 Ga0070678_1002517452 224
377 3300005457 Ga0070662_100008161 Ga0070662_1000081612 224
378 3300005457 Ga0070662_100101431 Ga0070662_1001014311 224
379 3300005457 Ga0070662_100306067 Ga0070662_1003060672 224
380 3300005457 Ga0070662_100827085 Ga0070662_1008270851 224
381 3300005459 Ga0068867_100001924 Ga0068867_1000019247 224
382 3300005459 Ga0068867_100069507 Ga0068867_1000695072 224
383 3300005466 Ga0070685_10085529 Ga0070685_100855292 224
384 3300005530 Ga0070679_100311888 Ga0070679_1003118882 224
385 3300005535 Ga0070684_100945085 Ga0070684_1009450851 224
386 3300005536 Ga0070697_100516950 Ga0070697_1005169502 224
387 3300005539 Ga0068853_100105469 Ga0068853_1001054692 224
388 3300005539 Ga0068853_100433382 Ga0068853_1004333821 224
389 3300005543 Ga0070672_100005328 Ga0070672_1000053288 224
390 3300005543 Ga0070672_100189439 Ga0070672_1001894392 224
391 3300005543 Ga0070672_100226217 Ga0070672_1002262172 224
392 3300005544 Ga0070686_100445908 Ga0070686_1004459082 224
393 3300005545 Ga0070695_100043473 Ga0070695_1000434732 224
394 3300005546 Ga0070696_100013215 Ga0070696_1000132155 224
395 3300005546 Ga0070696_100038433 Ga0070696_1000384333 224
396 3300005547 Ga0070693_100345345 Ga0070693_1003453451 224
397 3300005548 Ga0070665_100003766 Ga0070665_1000037665 224
398 3300005548 Ga0070665_100008343 Ga0070665_1000083435 224
399 3300005548 Ga0070665_100016958 Ga0070665_1000169586 224
400 3300005548 Ga0070665_100079434 Ga0070665_1000794343 224
401 3300005549 Ga0070704_100318741 Ga0070704_1003187412 224
402 3300005563 Ga0068855_100132760 Ga0068855_1001327603 224
403 3300005563 Ga0068855_100259658 Ga0068855_1002596582 224
404 3300005564 Ga0070664_100026560 Ga0070664_1000265602 224
405 3300005564 Ga0070664_100029694 Ga0070664_1000296942 224
406 3300005564 Ga0070664_100064199 Ga0070664_1000641992 224
407 3300005564 Ga0070664_100163889 Ga0070664_1001638892 224
408 3300005564 Ga0070664_100438797 Ga0070664_1004387972 224
409 3300005564 Ga0070664_100445934 Ga0070664_1004459342 224
410 3300005564 Ga0070664_100493935 Ga0070664_1004939352 224
411 3300005577 Ga0068857_100001548 Ga0068857_1000015487 224
412 3300005577 Ga0068857_100010238 Ga0068857_1000102383 224
413 3300005577 Ga0068857_100100233 Ga0068857_1001002332 224
414 3300005577 Ga0068857_100261328 Ga0068857_1002613282 224
415 3300005578 Ga0068854_100000061 Ga0068854_10000006133 224
416 3300005578 Ga0068854_100028746 Ga0068854_1000287463 224
417 3300005578 Ga0068854_100036265 Ga0068854_1000362651 224
418 3300005578 Ga0068854_100052898 Ga0068854_1000528982 224
419 3300005578 Ga0068854_100211332 Ga0068854_1002113322 224
420 3300005578 Ga0068854_100499249 Ga0068854_1004992491 224
421 3300005614 Ga0068856_100011495 Ga0068856_1000114955 224
422 3300005614 Ga0068856_100055423 Ga0068856_1000554232 224
423 3300005614 Ga0068856_100598998 Ga0068856_1005989982 224
424 3300005616 Ga0068852_100003251 Ga0068852_1000032513 224
425 3300005616 Ga0068852_100008826 Ga0068852_1000088265 224
426 3300005616 Ga0068852_100110614 Ga0068852_1001106142 224
427 3300005616 Ga0068852_100156906 Ga0068852_1001569062 224
428 3300005616 Ga0068852_100512518 Ga0068852_1005125182 224
429 3300005617 Ga0068859_100003001 Ga0068859_10000300112 224
430 3300005617 Ga0068859_100025738 Ga0068859_1000257386 224
431 3300005617 Ga0068859_100092588 Ga0068859_1000925882 224
432 3300005617 Ga0068859_100125788 Ga0068859_1001257882 224
433 3300005617 Ga0068859_100240682 Ga0068859_1002406823 224
434 3300005719 Ga0068861_100063893 Ga0068861_1000638932 224
435 3300005834 Ga0068851_10021026 Ga0068851_100210262 224
436 3300005834 Ga0068851_10276072 Ga0068851_102760721 224
437 3300005841 Ga0068863_100004263 Ga0068863_1000042635 224
438 3300005841 Ga0068863_100017578 Ga0068863_1000175783 224
439 3300005841 Ga0068863_100031916 Ga0068863_1000319162 224
440 3300005842 Ga0068858_100006455 Ga0068858_1000064556 224
441 3300005842 Ga0068858_100008178 Ga0068858_1000081785 224
442 3300005842 Ga0068858_100037079 Ga0068858_1000370793 224
443 3300005842 Ga0068858_100061160 Ga0068858_1000611603 224
444 3300005843 Ga0068860_100015799 Ga0068860_1000157996 224
445 3300005843 Ga0068860_100029882 Ga0068860_1000298822 224
446 3300005843 Ga0068860_100080551 Ga0068860_1000805512 224
447 3300005844 Ga0068862_100023961 Ga0068862_1000239612 224
448 3300006237 Ga0097621_100008835 Ga0097621_1000088356 224
449 3300006237 Ga0097621_100016377 Ga0097621_1000163772 224
450 3300006353 Ga0075370_10164925 Ga0075370_101649252 224
451 3300006358 Ga0068871_100260045 Ga0068871_1002600452 224
452 3300006358 Ga0068871_100266538 Ga0068871_1002665382 224
453 3300006844 Ga0075428_100413047 Ga0075428_1004130472 224
454 3300006871 Ga0075434_100769166 Ga0075434_1007691662 224
455 3300006931 Ga0097620_100003001 Ga0097620_1000030013 224
456 3300006931 Ga0097620_100025738 Ga0097620_1000257386 224
457 3300006931 Ga0097620_100092600 Ga0097620_1000926002 224
458 3300006931 Ga0097620_100125793 Ga0097620_1001257932 224
459 3300006931 Ga0097620_100240683 Ga0097620_1002406833 224
460 3300009098 Ga0105245_10169357 Ga0105245_101693573 224
461 3300009148 Ga0105243_10174740 Ga0105243_101747402 224
462 3300009148 Ga0105243_10534280 Ga0105243_105342802 224
463 3300009174 Ga0105241_10089534 Ga0105241_100895342 224
464 3300009177 Ga0105248_10002983 Ga0105248_100029839 224
465 3300009177 Ga0105248_10073444 Ga0105248_100734444 224
466 3300009177 Ga0105248_10443111 Ga0105248_104431112 224
467 3300009177 Ga0105248_10802226 Ga0105248_108022262 224
468 3300009553 Ga0105249_10052400 Ga0105249_100524002 224
469 3300009553 Ga0105249_10119778 Ga0105249_101197782 224
470 3300011119 Ga0105246_10278581 Ga0105246_102785811 224
471 3300012512 Ga0157327_1002691 Ga0157327_10026911 224
472 3300013100 Ga0157373_10026124 Ga0157373_100261244 224
473 3300013100 Ga0157373_10096272 Ga0157373_100962722 224
474 3300013102 Ga0157371_10022145 Ga0157371_100221453 224
475 3300013102 Ga0157371_10150118 Ga0157371_101501182 224
476 3300013296 Ga0157374_10473322 Ga0157374_104733222 224
477 3300013297 Ga0157378_10516197 Ga0157378_105161971 224
478 3300013306 Ga0163162_10120906 Ga0163162_101209062 224
479 3300013307 Ga0157372_10077807 Ga0157372_100778072 224
480 3300013307 Ga0157372_10112759 Ga0157372_101127593 224
481 3300013307 Ga0157372_11101546 Ga0157372_111015461 224
482 3300013308 Ga0157375_10170797 Ga0157375_101707972 224
483 3300014325 Ga0163163_10251712 Ga0163163_102517122 224
484 3300014745 Ga0157377_10319186 Ga0157377_103191862 224
485 3300014968 Ga0157379_10283699 Ga0157379_102836992 224
486 3300017792 Ga0163161_10291396 Ga0163161_102913961 224
487 3300025315 Ga0207697_10072297 Ga0207697_100722972 224
488 3300025321 Ga0207656_10138791 Ga0207656_101387912 224
489 3300025321 Ga0207656_10281529 Ga0207656_102815291 224
490 3300025899 Ga0207642_10077570 Ga0207642_100775702 224
491 3300025903 Ga0207680_10134405 Ga0207680_101344052 224
492 3300025904 Ga0207647_10000232 Ga0207647_1000023225 224
493 3300025904 Ga0207647_10008050 Ga0207647_100080506 224
494 3300025907 Ga0207645_10000418 Ga0207645_100004184 224
495 3300025907 Ga0207645_10004865 Ga0207645_100048655 224
496 3300025909 Ga0207705_10022762 Ga0207705_100227622 224
497 3300025909 Ga0207705_10028973 Ga0207705_100289733 224
498 3300025909 Ga0207705_10275278 Ga0207705_102752782 224
499 3300025909 Ga0207705_10491174 Ga0207705_104911741 224
500 3300025909 Ga0207705_10645227 Ga0207705_106452271 224
501 3300025912 Ga0207707_10248067 Ga0207707_102480672 224
502 3300025912 Ga0207707_10510595 Ga0207707_105105951 224
503 3300025918 Ga0207662_10227724 Ga0207662_102277242 224
504 3300025919 Ga0207657_10003142 Ga0207657_100031426 224
505 3300025919 Ga0207657_10027535 Ga0207657_100275353 224
506 3300025919 Ga0207657_10035116 Ga0207657_100351164 224
507 3300025919 Ga0207657_10063410 Ga0207657_100634102 224
508 3300025920 Ga0207649_10127167 Ga0207649_101271672 224
509 3300025920 Ga0207649_10159689 Ga0207649_101596892 224
510 3300025920 Ga0207649_10456676 Ga0207649_104566761 224
511 3300025921 Ga0207652_10278796 Ga0207652_102787962 224
512 3300025921 Ga0207652_10532053 Ga0207652_105320532 224
513 3300025923 Ga0207681_10024027 Ga0207681_100240272 224
514 3300025923 Ga0207681_10758961 Ga0207681_107589612 224
515 3300025925 Ga0207650_10067035 Ga0207650_100670352 224
516 3300025925 Ga0207650_10079380 Ga0207650_100793802 224
517 3300025925 Ga0207650_10339738 Ga0207650_103397382 224
518 3300025926 Ga0207659_10021759 Ga0207659_100217594 224
519 3300025926 Ga0207659_10179300 Ga0207659_101793002 224
520 3300025926 Ga0207659_10238711 Ga0207659_102387112 224
521 3300025927 Ga0207687_10158829 Ga0207687_101588292 224
522 3300025931 Ga0207644_10001487 Ga0207644_1000148717 224
523 3300025931 Ga0207644_10016648 Ga0207644_100166484 224
524 3300025931 Ga0207644_10021401 Ga0207644_100214012 224
525 3300025931 Ga0207644_10052306 Ga0207644_100523062 224
526 3300025931 Ga0207644_10078101 Ga0207644_100781013 224
527 3300025932 Ga0207690_10002907 Ga0207690_100029079 224
528 3300025932 Ga0207690_10073342 Ga0207690_100733422 224
529 3300025932 Ga0207690_10180957 Ga0207690_101809572 224
530 3300025932 Ga0207690_10262491 Ga0207690_102624912 224
531 3300025933 Ga0207706_10002226 Ga0207706_1000222617 224
532 3300025933 Ga0207706_10006168 Ga0207706_100061684 224
533 3300025933 Ga0207706_10050041 Ga0207706_100500412 224
534 3300025933 Ga0207706_10417134 Ga0207706_104171342 224
535 3300025934 Ga0207686_10828754 Ga0207686_108287541 224
536 3300025935 Ga0207709_10136942 Ga0207709_101369422 224
537 3300025935 Ga0207709_10191736 Ga0207709_101917362 224
538 3300025936 Ga0207670_10451827 Ga0207670_104518272 224
539 3300025937 Ga0207669_10006085 Ga0207669_100060852 224
540 3300025937 Ga0207669_10339826 Ga0207669_103398262 224
541 3300025940 Ga0207691_10018790 Ga0207691_100187903 224
542 3300025940 Ga0207691_10031175 Ga0207691_100311752 224
543 3300025940 Ga0207691_10162991 Ga0207691_101629914 224
544 3300025941 Ga0207711_10003185 Ga0207711_100031853 224
545 3300025941 Ga0207711_10008150 Ga0207711_100081502 224
546 3300025941 Ga0207711_10075402 Ga0207711_100754022 224
547 3300025942 Ga0207689_10016637 Ga0207689_100166373 224
548 3300025942 Ga0207689_10036985 Ga0207689_100369852 224
549 3300025942 Ga0207689_10150167 Ga0207689_101501672 224
550 3300025945 Ga0207679_10152941 Ga0207679_101529412 224
551 3300025949 Ga0207667_10011731 Ga0207667_100117312 224
552 3300025960 Ga0207651_10034265 Ga0207651_100342652 224
553 3300025960 Ga0207651_10277486 Ga0207651_102774861 224
554 3300025961 Ga0207712_10000873 Ga0207712_1000087310 224
555 3300025961 Ga0207712_10125124 Ga0207712_101251242 224
556 3300025972 Ga0207668_10000080 Ga0207668_1000008074 224
557 3300025972 Ga0207668_10099164 Ga0207668_100991641 224
558 3300025972 Ga0207668_10337347 Ga0207668_103373472 224
559 3300025981 Ga0207640_10559783 Ga0207640_105597832 224
560 3300025986 Ga0207658_10003885 Ga0207658_100038859 224
561 3300025986 Ga0207658_10271249 Ga0207658_102712492 224
562 3300025986 Ga0207658_10286282 Ga0207658_102862822 224
563 3300025986 Ga0207658_10342607 Ga0207658_103426072 224
564 3300025986 Ga0207658_10373897 Ga0207658_103738972 224
565 3300026023 Ga0207677_10115221 Ga0207677_101152213 224
566 3300026023 Ga0207677_10306260 Ga0207677_103062602 224
567 3300026035 Ga0207703_10005654 Ga0207703_1000565410 224
568 3300026035 Ga0207703_10013420 Ga0207703_100134202 224
569 3300026035 Ga0207703_10025556 Ga0207703_100255562 224
570 3300026035 Ga0207703_10195054 Ga0207703_101950542 224
571 3300026041 Ga0207639_10102461 Ga0207639_101024612 224
572 3300026067 Ga0207678_10005325 Ga0207678_100053254 224
573 3300026067 Ga0207678_10005348 Ga0207678_100053483 224
574 3300026067 Ga0207678_10009144 Ga0207678_100091445 224
575 3300026067 Ga0207678_10041782 Ga0207678_100417824 224
576 3300026067 Ga0207678_10164673 Ga0207678_101646732 224
577 3300026067 Ga0207678_10275372 Ga0207678_102753722 224
578 3300026078 Ga0207702_10007461 Ga0207702_100074616 224
579 3300026088 Ga0207641_10011911 Ga0207641_100119113 224
580 3300026088 Ga0207641_10020905 Ga0207641_100209052 224
581 3300026088 Ga0207641_10186927 Ga0207641_101869272 224
582 3300026089 Ga0207648_10004979 Ga0207648_100049797 224
583 3300026089 Ga0207648_10008102 Ga0207648_100081027 224
584 3300026089 Ga0207648_10023495 Ga0207648_100234951 224
585 3300026095 Ga0207676_10009568 Ga0207676_100095683 224
586 3300026095 Ga0207676_10550146 Ga0207676_105501462 224
587 3300026095 Ga0207676_10649968 Ga0207676_106499682 224
588 3300026116 Ga0207674_10000289 Ga0207674_1000028959 224
589 3300026116 Ga0207674_10015537 Ga0207674_100155375 224
590 3300026116 Ga0207674_10035753 Ga0207674_100357534 224
591 3300026116 Ga0207674_10052979 Ga0207674_100529792 224
592 3300026116 Ga0207674_10232549 Ga0207674_102325492 224
593 3300026116 Ga0207674_10660124 Ga0207674_106601242 224
594 3300026121 Ga0207683_10234078 Ga0207683_102340782 224
595 3300026142 Ga0207698_10009884 Ga0207698_100098843 224
596 3300026142 Ga0207698_10090460 Ga0207698_100904602 224
597 3300026142 Ga0207698_10155890 Ga0207698_101558902 224
598 3300026142 Ga0207698_10473492 Ga0207698_104734922 224
599 3300028379 Ga0268266_10016106 Ga0268266_100161061 224
600 3300028379 Ga0268266_10061739 Ga0268266_100617392 224
601 3300028379 Ga0268266_10093387 Ga0268266_100933873 224
602 3300028379 Ga0268266_10187613 Ga0268266_101876132 224
603 3300028380 Ga0268265_10011650 Ga0268265_100116504 224
604 3300028380 Ga0268265_10034768 Ga0268265_100347683 224
605 3300028380 Ga0268265_10035265 Ga0268265_100352652 224
606 3300028380 Ga0268265_10039427 Ga0268265_100394272 224
607 3300028380 Ga0268265_10139750 Ga0268265_101397502 224
608 3300028381 Ga0268264_10000567 Ga0268264_1000056716 224
609 3300028381 Ga0268264_10010817 Ga0268264_100108175 224
610 3300028381 Ga0268264_10045947 Ga0268264_100459472 224
611 3300028381 Ga0268264_10302776 Ga0268264_103027762 224
612 3300031548 Ga0307408_100070213 Ga0307408_1000702132 224
613 3300031548 Ga0307408_100077758 Ga0307408_1000777581 224
614 3300031731 Ga0307405_10048723 Ga0307405_100487232 224
615 3300031824 Ga0307413_10103642 Ga0307413_101036422 224
616 3300031824 Ga0307413_10374802 Ga0307413_103748021 224
617 3300031852 Ga0307410_10067607 Ga0307410_100676072 224
618 3300031901 Ga0307406_10047231 Ga0307406_100472312 224
619 3300031911 Ga0307412_10155848 Ga0307412_101558482 224
620 3300031995 Ga0307409_100538257 Ga0307409_1005382572 224
621 3300031995 Ga0307409_100628901 Ga0307409_1006289012 224
622 3300032002 Ga0307416_100187181 Ga0307416_1001871812 224
623 3300032002 Ga0307416_100552924 Ga0307416_1005529241 224
624 3300032004 Ga0307414_10181910 Ga0307414_101819102 224
625 3300032005 Ga0307411_10102805 Ga0307411_101028052 224
626 3300032126 Ga0307415_100112828 Ga0307415_1001128282 224
627 3300037312 Ga0395899_0093418 Ga0395899_0093418_899_1573 224
628 3300037312 Ga0395899_0110539 Ga0395899_0110539_605_1279 224
629 3300037418 Ga0395900_0420905 Ga0395900_0420905_18_692 224
630 3300037418 Ga0395900_0629159 Ga0395900_0629159_18_692 224
631 3300037466 Ga0395898_0228053 Ga0395898_0228053_354_1028 224
632 3300037471 Ga0395905_0132786 Ga0395905_0132786_160_834 224
633 3300037471 Ga0395905_0142809 Ga0395905_0142809_309_986 224
634 3300037471 Ga0395905_0256676 Ga0395905_0256676_605_1279 224
635 3300037471 Ga0395905_0465274 Ga0395905_0465274_115_810 224
636 3300038443 Ga0395901_0133989 Ga0395901_0133989_1325_1999 224
637 3300038443 Ga0395901_0465242 Ga0395901_0465242_198_872 224
638 3300038443 Ga0395901_0509469 Ga0395901_0509469_10_684 224
639 3300042004 Ga0439445_0097466 Ga0439445_0097466_45_728 224
640 3300042006 Ga0439432_004034 Ga0439432_004034_2889_3572 224
641 3300044658 Ga0466972_0031341 Ga0466972_0031341_1874_2548 224
642 3300044694 Ga0466963_0317340 Ga0466963_0317340_357_1031 224
643 3300044719 Ga0466971_0058017 Ga0466971_0058017_993_1667 224
644 3300044842 Ga0466957_0211444 Ga0466957_0211444_450_1124 224
645 3300045049 Ga0466959_0160977 Ga0466959_0160977_133_807 224
646 3300045976 Ga0466967_0182550 Ga0466967_0182550_103_777 224
647 3300046522 Ga0495643_0259389 Ga0495643_0259389_56_730 224
648 3300046525 Ga0495663_0142059 Ga0495663_0142059_42_716 224
649 3300046539 Ga0495621_0028485 Ga0495621_0028485_144_818 224
650 3300046684 Ga0495669_0013194 Ga0495669_0013194_2317_2991 224
651 3300046684 Ga0495669_0061966 Ga0495669_0061966_884_1558 224
652 3300048903 Ga0496100_0037795 Ga0496100_0037795_2370_3044 224
653 3300048907 Ga0496104_0101429 Ga0496104_0101429_1345_2022 224
654 3300048909 Ga0496106_0175313 Ga0496106_0175313_616_1308 224
655 3300048909 Ga0496106_0446476 Ga0496106_0446476_53_727 224
656 3300048910 Ga0496107_0071694 Ga0496107_0071694_21_695 224
657 3300048911 Ga0496108_0009534 Ga0496108_0009534_307_1002 224
658 3300048912 Ga0496109_0029131 Ga0496109_0029131_27_704 224
659 3300048913 Ga0496110_0046972 Ga0496110_0046972_2783_3457 224
660 3300048913 Ga0496110_0070060 Ga0496110_0070060_2205_2903 224
661 3300048914 Ga0496111_0038711 Ga0496111_0038711_483_1178 224
662 3300048914 Ga0496111_0277241 Ga0496111_0277241_264_953 224
663 3300048915 Ga0496112_0066629 Ga0496112_0066629_1990_2664 224
664 3300048915 Ga0496112_0087238 Ga0496112_0087238_2376_3053 224
665 3300048915 Ga0496112_0218915 Ga0496112_0218915_160_834 224
666 3300048916 Ga0496113_0008839 Ga0496113_0008839_237_914 224
667 3300048916 Ga0496113_0336552 Ga0496113_0336552_187_861 224
668 3300049515 Ga0501292_010004 Ga0501292_010004_96_770 224
669 3300049585 Ga0501069_0116854 Ga0501069_0116854_698_1372 224
670 3300049656 Ga0501209_025633 Ga0501209_025633_202_876 224
671 3300049670 Ga0501236_045452 Ga0501236_045452_47_721 224
672 3300049765 Ga0501268_049321 Ga0501268_049321_58_732 224
673 3300049769 Ga0501272_009127 Ga0501272_009127_149_823 224
674 3300050496 nmdc:mga07m45_243082_c1 nmdc:mga07m45_243082_c1_98_772 224
675 3300059510 Ga0587090_010738 Ga0587090_010738_312_1007 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

39

95

0.92

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

39

131

0.9

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

39

149

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i0z-assembly1.cif.gz_A crystal structure of a fad binding protein from bacillus cereus, a putative nad(fad)-utilizing dehydrogenases 0.9687 9 39
6bzi-assembly3.cif.gz_C crystal structure of halogenase pltm in complex with ethyl mercury and mercury 0.9626 9 38
6j0z-assembly1.cif.gz_C-2 crystal structure of alpk 0.9595 9 39
7kmy-assembly4.cif.gz_M structure of mtb lpd bound to 010705 0.9522 8 35
6c12-assembly2.cif.gz_A sdha-sdhe complex 0.9436 8 38
ID Description Score Start End Superfamily
af_A0A1D6FXS3_113_271_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9708 8 35 3.50.50.60
6j0zC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9595 9 39 3.50.50.60
af_Q9C1W3_1_361_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9307 9 41 3.50.50.60
af_Q59T35_15_498_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9284 8 35 3.50.50.60
af_Q8LLD4_13_381_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9155 8 40 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7I8DFB4-F1-model_v4 Pyrroline-5-carboxylate reductase catalytic N-terminal domain-containing protein 0.9169 9 72
AF-A0A2H0G002-F1-model_v4 Pyrroline-5-carboxylate reductase catalytic N-terminal domain-containing protein 0.9 11 205 GO:0005886
GO:0008823
GO:0015677
GO:0052851
AF-A0A345V9F5-F1-model_v4 NADP oxidoreductase 0.8963 9 197
AF-A0A3B9W5F6-F1-model_v4 NADP oxidoreductase 0.8959 115 197
AF-A0A6N6VXE6-F1-model_v4 F420-dependent NADP oxidoreductase 0.8908 10 197

Feature Viewer

pLDDT pTM Quality
81.78 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map