F474133

General Info

Members Datasets Scaffolds Average Seq Length
671 321 671 173

Family's Representative Sequence

Representative Sequence 3300004800|Ga0058861_12003411|Ga0058861_120034113
Length 213
Sequence MVVGADLRVGPGIHMRTRERIDASQLDIKDNVVSINRVTKVVKGGKNLSFSALVVVGDGHGVVGFGVGKAKEVPSAIKKGIEAAKKNLIRVPLAGNTIPHRIVGVFGAGSVLLKPAPDGTGIIARRGARGDHEHPHQVARIGQPAQRRACDDHRARLAEGSRDDRAAARQRAERRHVRHGLTRPTNEQRGSVRFGRTREIWLIRERIRRAPAR

Samples

Sample ID Description Type Environment
1 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
178 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
179 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
180 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
181 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
182 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
183 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
184 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
185 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
186 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
187 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
188 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
189 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
192 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
193 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
194 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
197 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
202 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
203 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
212 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
213 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
214 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
215 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
216 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
244 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
245 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
276 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
289 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
290 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
297 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
298 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
299 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
307 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
308 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
309 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
310 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
311 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
312 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
313 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
314 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
315 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
316 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
317 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
318 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
319 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
320 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.38
Nodule 0
Rhizoplane 5.96
Rhizosphere 91.51
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058861_12003411 3300004800 Bacteria 1805
2 Ga0065712_10033738 3300005290 Bacteria 1066
3 Ga0065715_10238277 3300005293 Bacteria 1206
4 Ga0065707_10089023 3300005295 Bacteria 4482
5 Ga0065707_10519979 3300005295 Bacteria 743
6 Ga0070658_10302065 3300005327 Bacteria 1365
7 Ga0070676_10007044 3300005328 Bacteria 6019
8 Ga0070676_10100742 3300005328 Bacteria 1784
9 Ga0070676_10285363 3300005328 Bacteria 1114
10 Ga0070683_100763243 3300005329 Bacteria 926
11 Ga0070670_100050949 3300005331 Bacteria 3557
12 Ga0070670_100280626 3300005331 Bacteria 1454
13 Ga0070670_100362036 3300005331 Bacteria 1275
14 Ga0070670_100596116 3300005331 Bacteria 988
15 Ga0070677_10104469 3300005333 Bacteria 1255
16 Ga0070666_10051882 3300005335 Bacteria 2763
17 Ga0070666_10123865 3300005335 Bacteria 1793
18 Ga0070666_10212816 3300005335 Bacteria 1362
19 Ga0070666_10310169 3300005335 Bacteria 1124
20 Ga0070682_100444190 3300005337 Bacteria 992
21 Ga0068868_100055137 3300005338 Bacteria 3135
22 Ga0068868_100553795 3300005338 Bacteria 1014
23 Ga0068868_100887592 3300005338 Bacteria 809
24 Ga0070660_100520246 3300005339 Bacteria 991
25 Ga0070689_100460205 3300005340 Unclassified 1084
26 Ga0070691_10004188 3300005341 Bacteria 6554
27 Ga0070687_100080522 3300005343 Bacteria 1776
28 Ga0070668_100489968 3300005347 Bacteria 1062
29 Ga0070669_100110504 3300005353 Bacteria 2085
30 Ga0070675_100000056 3300005354 Bacteria 66985
31 Ga0070675_100029203 3300005354 Bacteria 4445
32 Ga0070675_100546245 3300005354 Bacteria 1047
33 Ga0070675_100735796 3300005354 Bacteria 899
34 Ga0070674_100007417 3300005356 Bacteria 6470
35 Ga0070674_100046049 3300005356 Bacteria 2982
36 Ga0070674_100078891 3300005356 Bacteria 2347
37 Ga0070674_100192253 3300005356 Bacteria 1571
38 Ga0070674_100202289 3300005356 Bacteria 1534
39 Ga0070674_100278160 3300005356 Bacteria 1325
40 Ga0070674_100554456 3300005356 Bacteria 965
41 Ga0070673_100003427 3300005364 Bacteria 9877
42 Ga0070673_100043981 3300005364 Bacteria 3455
43 Ga0070673_100460085 3300005364 Bacteria 1145
44 Ga0070667_100165408 3300005367 Bacteria 1951
45 Ga0070667_100168474 3300005367 Bacteria 1932
46 Ga0070667_100643276 3300005367 Bacteria 979
47 Ga0070667_101228191 3300005367 Bacteria 702
48 Ga0070714_100050502 3300005435 Bacteria 3543
49 Ga0070701_10010126 3300005438 Bacteria 4157
50 Ga0070701_10205854 3300005438 Bacteria 1166
51 Ga0070711_100592938 3300005439 Bacteria 924
52 Ga0070705_100044955 3300005440 Bacteria 2538
53 Ga0070705_100573723 3300005440 Bacteria 869
54 Ga0070705_100971410 3300005440 Bacteria 688
55 Ga0070700_100432017 3300005441 Bacteria 997
56 Ga0070694_100016422 3300005444 Bacteria 4660
57 Ga0070708_100055234 3300005445 Bacteria 3531
58 Ga0070663_100654247 3300005455 Bacteria 889
59 Ga0070678_100092251 3300005456 Bacteria 2326
60 Ga0070662_100496398 3300005457 Bacteria 1018
61 Ga0070681_10042357 3300005458 Bacteria 4563
62 Ga0070681_10348644 3300005458 Bacteria 1391
63 Ga0068867_100035655 3300005459 Bacteria 3609
64 Ga0068867_100041777 3300005459 Bacteria 3351
65 Ga0068867_100073877 3300005459 Bacteria 2554
66 Ga0068867_100513996 3300005459 Bacteria 1031
67 Ga0068867_100588601 3300005459 Bacteria 969
68 Ga0068867_100816926 3300005459 Bacteria 833
69 Ga0070706_100556565 3300005467 Bacteria 1067
70 Ga0070707_100125461 3300005468 Bacteria 2494
71 Ga0070707_100175008 3300005468 Bacteria 2092
72 Ga0070698_100034124 3300005471 Bacteria 5270
73 Ga0070698_100183947 3300005471 Bacteria 2028
74 Ga0070698_100367829 3300005471 Bacteria 1370
75 Ga0070698_100995188 3300005471 Bacteria 786
76 Ga0070699_100119032 3300005518 Bacteria 2322
77 Ga0070699_100741988 3300005518 Bacteria 898
78 Ga0070679_100044653 3300005530 Bacteria 4415
79 Ga0070684_100744697 3300005535 Bacteria 915
80 Ga0070697_100193729 3300005536 Bacteria 1726
81 Ga0070672_100417490 3300005543 Bacteria 1152
82 Ga0070672_100454407 3300005543 Bacteria 1104
83 Ga0070686_100002243 3300005544 Bacteria 10661
84 Ga0070686_100024325 3300005544 Bacteria 3629
85 Ga0070695_100063603 3300005545 Bacteria 2398
86 Ga0070695_100169060 3300005545 Bacteria 1541
87 Ga0070696_100012605 3300005546 Bacteria 5675
88 Ga0070696_100133503 3300005546 Bacteria 1809
89 Ga0070696_100145121 3300005546 Bacteria 1738
90 Ga0070696_100184966 3300005546 Bacteria 1547
91 Ga0070696_100694764 3300005546 Bacteria 829
92 Ga0070693_100512486 3300005547 Bacteria 853
93 Ga0070665_100004733 3300005548 Bacteria 14164
94 Ga0070665_100005447 3300005548 Bacteria 13122
95 Ga0070665_100010437 3300005548 Bacteria 9398
96 Ga0070704_100096664 3300005549 Bacteria 2215
97 Ga0070704_100355660 3300005549 Bacteria 1238
98 Ga0070704_100462367 3300005549 Bacteria 1095
99 Ga0068855_100286434 3300005563 Bacteria 1827
100 Ga0070664_100563231 3300005564 Bacteria 1054
101 Ga0068857_101000445 3300005577 Bacteria 805
102 Ga0068854_100177554 3300005578 Bacteria 1661
103 Ga0068854_100637221 3300005578 Bacteria 914
104 Ga0068856_100018557 3300005614 Bacteria 6740
105 Ga0070702_100002883 3300005615 Bacteria 7557
106 Ga0070702_100036054 3300005615 Bacteria 2737
107 Ga0070702_100096432 3300005615 Bacteria 1805
108 Ga0068859_100020008 3300005617 Bacteria 6721
109 Ga0068859_100168307 3300005617 Bacteria 2272
110 Ga0068859_100700495 3300005617 Bacteria 1103
111 Ga0068864_100075695 3300005618 Bacteria 2940
112 Ga0068866_10332190 3300005718 Bacteria 960
113 Ga0068861_100024888 3300005719 Bacteria 4334
114 Ga0068861_100463764 3300005719 Bacteria 1138
115 Ga0068861_101645756 3300005719 Bacteria 633
116 Ga0068870_10321948 3300005840 Bacteria 983
117 Ga0068863_100116322 3300005841 Bacteria 2548
118 Ga0068863_100116801 3300005841 Bacteria 2542
119 Ga0068858_100001254 3300005842 Bacteria 26256
120 Ga0068858_100008638 3300005842 Bacteria 9781
121 Ga0068858_100189424 3300005842 Bacteria 1944
122 Ga0068858_100524546 3300005842 Bacteria 1146
123 Ga0068858_100793695 3300005842 Bacteria 924
124 Ga0068858_101016433 3300005842 Bacteria 813
125 Ga0068858_101641368 3300005842 Bacteria 635
126 Ga0068860_100123715 3300005843 Bacteria 2479
127 Ga0068860_100129065 3300005843 Bacteria 2424
128 Ga0068860_100304196 3300005843 Bacteria 1563
129 Ga0068860_100304719 3300005843 Bacteria 1561
130 Ga0068860_100328276 3300005843 Bacteria 1502
131 Ga0068860_100344425 3300005843 Bacteria 1466
132 Ga0068860_100534033 3300005843 Bacteria 1174
133 Ga0068862_100109135 3300005844 Bacteria 2427
134 Ga0068862_100110658 3300005844 Bacteria 2410
135 Ga0068862_100157630 3300005844 Bacteria 2025
136 Ga0081455_10174261 3300005937 Bacteria 1635
137 Ga0081455_10345681 3300005937 Bacteria 1051
138 Ga0081540_1096511 3300005983 Bacteria 1286
139 Ga0081539_10100098 3300005985 Bacteria 1479
140 Ga0081539_10197007 3300005985 Bacteria 933
141 Ga0075368_10004958 3300006042 Bacteria 4544
142 Ga0075432_10185114 3300006058 Bacteria 817
143 Ga0070716_100341366 3300006173 Bacteria 1057
144 Ga0075367_10010203 3300006178 Bacteria 4925
145 Ga0075367_10028961 3300006178 Bacteria 3163
146 Ga0075367_10258480 3300006178 Bacteria 1093
147 Ga0097621_100006061 3300006237 Bacteria 8549
148 Ga0097621_100118810 3300006237 Bacteria 2241
149 Ga0097621_100228720 3300006237 Bacteria 1623
150 Ga0097621_100238936 3300006237 Bacteria 1588
151 Ga0068871_100006055 3300006358 Bacteria 8509
152 Ga0068871_100075510 3300006358 Bacteria 2782
153 Ga0075428_100000009 3300006844 Bacteria 266370
154 Ga0075428_100312003 3300006844 Bacteria 1690
155 Ga0075428_100319068 3300006844 Bacteria 1670
156 Ga0075428_100348183 3300006844 Bacteria 1590
157 Ga0075430_100105326 3300006846 Bacteria 2354
158 Ga0075431_100261523 3300006847 Bacteria 1756
159 Ga0075431_100598368 3300006847 Bacteria 1087
160 Ga0075433_10100150 3300006852 Bacteria 2565
161 Ga0075433_10128181 3300006852 Bacteria 2254
162 Ga0075433_10422349 3300006852 Bacteria 1176
163 Ga0075433_10530184 3300006852 Bacteria 1036
164 Ga0075433_10616820 3300006852 Bacteria 952
165 Ga0075433_11134277 3300006852 Bacteria 679
166 Ga0075434_100069571 3300006871 Bacteria 3509
167 Ga0075434_100109389 3300006871 Bacteria 2774
168 Ga0075434_100110530 3300006871 Bacteria 2759
169 Ga0075434_100135753 3300006871 Bacteria 2479
170 Ga0075434_100385465 3300006871 Bacteria 1422
171 Ga0075434_101223515 3300006871 Bacteria 763
172 Ga0075429_100522210 3300006880 Bacteria 1040
173 Ga0068865_100006729 3300006881 Bacteria 7032
174 Ga0068865_100055357 3300006881 Bacteria 2759
175 Ga0075436_100018272 3300006914 Bacteria 4802
176 Ga0075436_100038116 3300006914 Bacteria 3318
177 Ga0075436_100110506 3300006914 Bacteria 1918
178 Ga0097620_100020008 3300006931 Bacteria 6721
179 Ga0097620_100168317 3300006931 Bacteria 2272
180 Ga0097620_100700471 3300006931 Bacteria 1103
181 Ga0075435_100001542 3300007076 Bacteria 14846
182 Ga0075435_100001694 3300007076 Bacteria 14328
183 Ga0075435_100028991 3300007076 Bacteria 4343
184 Ga0075435_100038141 3300007076 Bacteria 3830
185 Ga0105240_10045226 3300009093 Bacteria 5587
186 Ga0105240_10177867 3300009093 Bacteria 2514
187 Ga0105240_11200222 3300009093 Bacteria 803
188 Ga0111539_10000010 3300009094 Bacteria 366246
189 Ga0111539_10000566 3300009094 Bacteria 47366
190 Ga0111539_10293747 3300009094 Bacteria 1891
191 Ga0111539_11332686 3300009094 Bacteria 833
192 Ga0105245_10035527 3300009098 Bacteria 4423
193 Ga0105245_10062980 3300009098 Bacteria 3348
194 Ga0105245_10473430 3300009098 Bacteria 1265
195 Ga0105247_10004209 3300009101 Bacteria 9230
196 Ga0105247_10511839 3300009101 Bacteria 876
197 Ga0114129_10017270 3300009147 Bacteria 10276
198 Ga0114129_10117140 3300009147 Bacteria 3671
199 Ga0114129_10118442 3300009147 Bacteria 3648
200 Ga0114129_10148538 3300009147 Bacteria 3209
201 Ga0114129_10216991 3300009147 Bacteria 2583
202 Ga0114129_11634253 3300009147 Bacteria 788
203 Ga0105243_10054004 3300009148 Bacteria 3188
204 Ga0105243_10105863 3300009148 Bacteria 2343
205 Ga0105243_11686437 3300009148 Bacteria 662
206 Ga0105241_10100846 3300009174 Bacteria 2295
207 Ga0105242_10013585 3300009176 Bacteria 6299
208 Ga0105242_10035616 3300009176 Bacteria 3991
209 Ga0105242_10125367 3300009176 Bacteria 2210
210 Ga0105242_10177665 3300009176 Bacteria 1876
211 Ga0105248_10026461 3300009177 Bacteria 6454
212 Ga0105248_10261960 3300009177 Bacteria 1946
213 Ga0105248_10387276 3300009177 Bacteria 1574
214 Ga0105248_10404784 3300009177 Bacteria 1536
215 Ga0105248_10452960 3300009177 Bacteria 1446
216 Ga0105248_10819264 3300009177 Bacteria 1051
217 Ga0105238_10125557 3300009551 Bacteria 2545
218 Ga0105238_11387555 3300009551 Bacteria 730
219 Ga0105249_10455911 3300009553 Bacteria 1318
220 Ga0099796_10030103 3300010159 Bacteria 1758
221 Ga0105239_11680584 3300010375 Bacteria 735
222 Ga0157313_1011512 3300012503 Bacteria 770
223 Ga0157374_10119547 3300013296 Bacteria 2541
224 Ga0157374_10311603 3300013296 Bacteria 1558
225 Ga0157374_10433731 3300013296 Bacteria 1314
226 Ga0157374_10899348 3300013296 Bacteria 903
227 Ga0157374_11120636 3300013296 Bacteria 808
228 Ga0157378_10067386 3300013297 Bacteria 3207
229 Ga0163162_10364795 3300013306 Bacteria 1577
230 Ga0163162_10519827 3300013306 Bacteria 1320
231 Ga0157375_10053326 3300013308 Bacteria 3978
232 Ga0157375_10277484 3300013308 Bacteria 1839
233 Ga0163163_10087285 3300014325 Bacteria 3130
234 Ga0163163_10125545 3300014325 Bacteria 2604
235 Ga0163163_10548400 3300014325 Bacteria 1219
236 Ga0163163_10641362 3300014325 Bacteria 1126
237 Ga0157380_10007827 3300014326 Bacteria 7605
238 Ga0157380_10190699 3300014326 Bacteria 1809
239 Ga0157380_10194070 3300014326 Bacteria 1795
240 Ga0157380_10489694 3300014326 Bacteria 1191
241 Ga0157380_10547053 3300014326 Bacteria 1135
242 Ga0157377_10019122 3300014745 Bacteria 3575
243 Ga0157379_10018550 3300014968 Bacteria 6136
244 Ga0157379_10063370 3300014968 Bacteria 3306
245 Ga0157379_10138355 3300014968 Bacteria 2195
246 Ga0157379_10146389 3300014968 Bacteria 2130
247 Ga0157379_10802200 3300014968 Bacteria 889
248 Ga0157379_11038565 3300014968 Bacteria 783
249 Ga0157376_10057273 3300014969 Bacteria 3259
250 Ga0157376_10145796 3300014969 Bacteria 2129
251 Ga0157376_11266519 3300014969 Bacteria 767
252 Ga0213873_10124294 3300021358 Bacteria 760
253 Ga0207697_10089053 3300025315 Bacteria 1307
254 Ga0207697_10157139 3300025315 Bacteria 991
255 Ga0207682_10094553 3300025893 Bacteria 1300
256 Ga0207682_10146518 3300025893 Bacteria 1062
257 Ga0207682_10342783 3300025893 Bacteria 703
258 Ga0207642_10054168 3300025899 Bacteria 1828
259 Ga0207642_10258962 3300025899 Bacteria 991
260 Ga0207642_10948925 3300025899 Bacteria 552
261 Ga0207688_10190402 3300025901 Bacteria 1227
262 Ga0207688_10337075 3300025901 Bacteria 927
263 Ga0207680_10142428 3300025903 Bacteria 1590
264 Ga0207680_10349441 3300025903 Bacteria 1038
265 Ga0207680_10364852 3300025903 Bacteria 1016
266 Ga0207647_10156595 3300025904 Bacteria 1330
267 Ga0207645_10096400 3300025907 Bacteria 1905
268 Ga0207645_10155591 3300025907 Bacteria 1493
269 Ga0207645_10307973 3300025907 Bacteria 1055
270 Ga0207643_10090349 3300025908 Bacteria 1785
271 Ga0207705_10423658 3300025909 Bacteria 1031
272 Ga0207705_10546213 3300025909 Bacteria 901
273 Ga0207654_10223831 3300025911 Bacteria 1249
274 Ga0207707_10312425 3300025912 Bacteria 1358
275 Ga0207695_10084625 3300025913 Bacteria 3202
276 Ga0207695_10131709 3300025913 Bacteria 2458
277 Ga0207695_10642497 3300025913 Bacteria 942
278 Ga0207693_10257754 3300025915 Bacteria 1368
279 Ga0207663_10236530 3300025916 Bacteria 1337
280 Ga0207660_10323655 3300025917 Bacteria 1232
281 Ga0207662_10178874 3300025918 Bacteria 1364
282 Ga0207657_10013143 3300025919 Bacteria 8130
283 Ga0207649_10659408 3300025920 Bacteria 809
284 Ga0207649_10693416 3300025920 Bacteria 789
285 Ga0207646_10097073 3300025922 Bacteria 2640
286 Ga0207646_10731602 3300025922 Bacteria 884
287 Ga0207694_10261502 3300025924 Bacteria 1418
288 Ga0207694_10758091 3300025924 Bacteria 819
289 Ga0207694_10758852 3300025924 Bacteria 819
290 Ga0207650_10877977 3300025925 Bacteria 761
291 Ga0207659_10126623 3300025926 Bacteria 1965
292 Ga0207687_10015584 3300025927 Bacteria 4986
293 Ga0207687_10063053 3300025927 Bacteria 2623
294 Ga0207687_10098805 3300025927 Bacteria 2143
295 Ga0207664_10050545 3300025929 Bacteria 3278
296 Ga0207644_10120436 3300025931 Bacteria 1997
297 Ga0207644_11023801 3300025931 Bacteria 693
298 Ga0207690_10232957 3300025932 Bacteria 1415
299 Ga0207706_10450722 3300025933 Bacteria 1113
300 Ga0207686_10013361 3300025934 Bacteria 4541
301 Ga0207686_10016494 3300025934 Bacteria 4146
302 Ga0207686_10147455 3300025934 Bacteria 1634
303 Ga0207686_10160445 3300025934 Bacteria 1575
304 Ga0207709_10007222 3300025935 Bacteria 6197
305 Ga0207669_10039737 3300025937 Bacteria 2722
306 Ga0207669_10127353 3300025937 Bacteria 1742
307 Ga0207669_10297868 3300025937 Bacteria 1224
308 Ga0207669_10337513 3300025937 Bacteria 1159
309 Ga0207669_10392616 3300025937 Bacteria 1084
310 Ga0207669_10553177 3300025937 Bacteria 929
311 Ga0207669_11301839 3300025937 Bacteria 617
312 Ga0207704_10005828 3300025938 Bacteria 5701
313 Ga0207704_10169986 3300025938 Bacteria 1562
314 Ga0207704_10211258 3300025938 Bacteria 1428
315 Ga0207704_10464569 3300025938 Bacteria 1013
316 Ga0207704_10707716 3300025938 Unclassified 834
317 Ga0207665_10048683 3300025939 Bacteria 2846
318 Ga0207665_10565550 3300025939 Bacteria 885
319 Ga0207665_10847167 3300025939 Bacteria 724
320 Ga0207691_10339779 3300025940 Bacteria 1285
321 Ga0207691_10419050 3300025940 Bacteria 1141
322 Ga0207691_10555542 3300025940 Bacteria 973
323 Ga0207711_10026433 3300025941 Bacteria 4870
324 Ga0207711_10058386 3300025941 Bacteria 3320
325 Ga0207711_10137892 3300025941 Bacteria 2192
326 Ga0207711_10169022 3300025941 Bacteria 1983
327 Ga0207711_10212107 3300025941 Bacteria 1769
328 Ga0207711_10393563 3300025941 Bacteria 1287
329 Ga0207689_10034411 3300025942 Bacteria 4209
330 Ga0207661_10337766 3300025944 Bacteria 1357
331 Ga0207667_10168529 3300025949 Bacteria 2251
332 Ga0207651_10041000 3300025960 Bacteria 3069
333 Ga0207651_10110459 3300025960 Bacteria 2062
334 Ga0207651_10149189 3300025960 Bacteria 1818
335 Ga0207651_10156204 3300025960 Bacteria 1782
336 Ga0207712_10726235 3300025961 Bacteria 869
337 Ga0207712_11612361 3300025961 Bacteria 582
338 Ga0207668_10076681 3300025972 Bacteria 2408
339 Ga0207668_10092168 3300025972 Bacteria 2229
340 Ga0207668_10098613 3300025972 Bacteria 2165
341 Ga0207640_10114374 3300025981 Bacteria 1920
342 Ga0207658_10276346 3300025986 Bacteria 1438
343 Ga0207658_11054258 3300025986 Bacteria 742
344 Ga0207677_10497170 3300026023 Bacteria 1054
345 Ga0207677_11060195 3300026023 Bacteria 737
346 Ga0207703_10215416 3300026035 Bacteria 1714
347 Ga0207703_10280457 3300026035 Bacteria 1513
348 Ga0207703_10361518 3300026035 Bacteria 1339
349 Ga0207703_11452727 3300026035 Bacteria 660
350 Ga0207639_10543413 3300026041 Bacteria 1066
351 Ga0207708_10105615 3300026075 Bacteria 2183
352 Ga0207708_10328664 3300026075 Bacteria 1249
353 Ga0207702_10262266 3300026078 Bacteria 1627
354 Ga0207641_10752171 3300026088 Bacteria 962
355 Ga0207648_10016724 3300026089 Bacteria 6693
356 Ga0207648_10037722 3300026089 Bacteria 4256
357 Ga0207648_10082760 3300026089 Bacteria 2799
358 Ga0207648_10319166 3300026089 Bacteria 1396
359 Ga0207676_10028142 3300026095 Bacteria 4195
360 Ga0207676_10069079 3300026095 Bacteria 2828
361 Ga0207676_10164224 3300026095 Bacteria 1927
362 Ga0207676_10416489 3300026095 Bacteria 1259
363 Ga0207676_10694427 3300026095 Bacteria 985
364 Ga0207674_10203527 3300026116 Bacteria 1929
365 Ga0207675_100014045 3300026118 Bacteria 7468
366 Ga0207675_100038967 3300026118 Bacteria 4435
367 Ga0207675_100412832 3300026118 Bacteria 1332
368 Ga0207675_100818367 3300026118 Bacteria 945
369 Ga0207683_11447570 3300026121 Bacteria 635
370 Ga0207698_11764993 3300026142 Bacteria 634
371 Ga0209967_1039820 3300027364 Bacteria 713
372 Ga0209970_1014250 3300027614 Bacteria 1320
373 Ga0209813_10100043 3300027866 Bacteria 985
374 Ga0207428_10000034 3300027907 Bacteria 231306
375 Ga0207428_10072788 3300027907 Bacteria 2697
376 Ga0207428_10073024 3300027907 Bacteria 2692
377 Ga0207428_10107542 3300027907 Bacteria 2149
378 Ga0207428_10120374 3300027907 Bacteria 2013
379 Ga0268266_10005896 3300028379 Bacteria 11335
380 Ga0268266_10029767 3300028379 Bacteria 4639
381 Ga0268266_10219488 3300028379 Bacteria 1747
382 Ga0268265_10005520 3300028380 Bacteria 8630
383 Ga0268265_10025303 3300028380 Bacteria 4210
384 Ga0268265_10113738 3300028380 Bacteria 2215
385 Ga0268265_10733702 3300028380 Bacteria 957
386 Ga0268264_10042810 3300028381 Bacteria 3749
387 Ga0268264_10050141 3300028381 Bacteria 3475
388 Ga0268264_10317611 3300028381 Bacteria 1472
389 Ga0268264_11287382 3300028381 Bacteria 741
390 Ga0265338_10656703 3300028800 Bacteria 726
391 Ga0265332_10048353 3300031238 Bacteria 1830
392 Ga0265316_10261546 3300031344 Bacteria 1269
393 Ga0265314_10007579 3300031711 Bacteria 9400
394 Ga0265314_10013729 3300031711 Bacteria 6530
395 Ga0265342_10192479 3300031712 Bacteria 1112
396 Ga0307413_10091526 3300031824 Bacteria 1982
397 Ga0307413_10220584 3300031824 Bacteria 1385
398 Ga0307413_10391449 3300031824 Bacteria 1086
399 Ga0307412_10843067 3300031911 Bacteria 799
400 Ga0307416_100160347 3300032002 Bacteria 2078
401 Ga0307416_100512333 3300032002 Bacteria 1266
402 Ga0307416_100922927 3300032002 Bacteria 974
403 Ga0307411_10170887 3300032005 Bacteria 1639
404 Ga0307411_10594306 3300032005 Bacteria 951
405 Ga0373930_0002995 3300034816 Bacteria 2656
406 Ga0373948_0001483 3300034817 Bacteria 3266
407 Ga0373958_0000045 3300034819 Bacteria 12165
408 Ga0373959_0001151 3300034820 Bacteria 4278
409 Ga0373938_0000418 3300034957 Bacteria 6847
410 Ga0373928_0001212 3300035084 Bacteria 5090
411 Ga0373929_0000116 3300035085 Bacteria 13311
412 Ga0373940_0000084 3300035088 Bacteria 11367
413 Ga0373944_0043759 3300035089 Bacteria 1392
414 Ga0373944_0073733 3300035089 Bacteria 1116
415 Ga0373944_0224850 3300035089 Bacteria 686
416 Ga0373949_0000597 3300035090 Bacteria 11806
417 Ga0373949_0033224 3300035090 Bacteria 1239
418 Ga0373951_0001673 3300035091 Bacteria 5805
419 Ga0373952_0001387 3300035092 Bacteria 4428
420 Ga0373932_0006095 3300035112 Bacteria 2845
421 Ga0373936_0092396 3300035113 Bacteria 1270
422 Ga0373936_0346338 3300035113 Bacteria 676
423 Ga0373939_0001888 3300035114 Bacteria 5012
424 Ga0373939_0031755 3300035114 Bacteria 1529
425 Ga0373939_0107081 3300035114 Bacteria 968
426 Ga0373941_0000161 3300035115 Bacteria 12224
427 Ga0373945_0056786 3300035116 Bacteria 1453
428 Ga0373953_0044678 3300035117 Bacteria 1772
429 Ga0373953_0132653 3300035117 Bacteria 1063
430 Ga0373956_0208787 3300035119 Bacteria 926
431 Ga0373957_0061355 3300035120 Bacteria 1457
432 Ga0373960_0001448 3300035121 Bacteria 5252
433 Ga0373943_0571512 3300035170 Bacteria 664
434 Ga0373946_0369495 3300035171 Bacteria 720
435 Ga0373955_0047351 3300035172 Bacteria 2328
436 Ga0373955_0059904 3300035172 Bacteria 2098
437 Ga0373955_0171915 3300035172 Bacteria 1283
438 Ga0373955_0273145 3300035172 Bacteria 1016
439 Ga0373942_0001757 3300035207 Bacteria 5486
440 Ga0373961_0001591 3300035241 Bacteria 6457
441 Ga0373961_0111475 3300035241 Bacteria 897
442 Ga0373962_0000245 3300035242 Bacteria 11519
443 Ga0373924_0173653 3300035410 Bacteria 947
444 Ga0373931_0009494 3300035691 Bacteria 4653
445 Ga0373931_0169020 3300035691 Bacteria 1287
446 Ga0373935_0087624 3300035692 Bacteria 2033
447 Ga0373935_1067504 3300035692 Bacteria 601
448 Ga0373927_0199653 3300035695 Bacteria 1313
449 Ga0373947_0085310 3300035725 Bacteria 1961
450 Ga0373937_0055553 3300036401 Bacteria 3635
451 Ga0373937_0139222 3300036401 Bacteria 2270
452 Ga0373937_0170677 3300036401 Bacteria 2041
453 Ga0373937_0356987 3300036401 Bacteria 1385
454 Ga0373925_0160073 3300037068 Bacteria 1773
455 Ga0373925_0251097 3300037068 Bacteria 1419
456 Ga0373925_0281546 3300037068 Bacteria 1339
457 Ga0373925_0545741 3300037068 Bacteria 953
458 Ga0436362_0941488 3300039453 Bacteria 849
459 Ga0451839_1310317 3300041496 Bacteria 642
460 Ga0450920_048426 3300042122 Bacteria 851
461 Ga0450920_056922 3300042122 Bacteria 788
462 Ga0439446_0031821 3300042156 Bacteria 1528
463 Ga0439446_0172916 3300042156 Bacteria 719
464 Ga0439460_0019860 3300042461 Bacteria 1823
465 Ga0450916_000502 3300042530 Bacteria 3425
466 Ga0466963_0109939 3300044694 Bacteria 1891
467 Ga0453684_0121001 3300044712 Bacteria 3161
468 Ga0451576_0071334 3300045051 Bacteria 3615
469 Ga0451576_0277902 3300045051 Bacteria 1751
470 Ga0451576_1037898 3300045051 Bacteria 859
471 Ga0451576_1823096 3300045051 Bacteria 629
472 Ga0495592_0087298 3300046454 Bacteria 2244
473 Ga0495603_0056649 3300046455 Bacteria 2320
474 Ga0495603_0297709 3300046455 Bacteria 926
475 Ga0495603_0566865 3300046455 Bacteria 650
476 Ga0495629_0108936 3300046459 Bacteria 1932
477 Ga0495641_0068787 3300046461 Bacteria 1592
478 Ga0495651_0599107 3300046462 Bacteria 695
479 Ga0495653_0159656 3300046463 Bacteria 1566
480 Ga0495653_0252550 3300046463 Bacteria 1170
481 Ga0495582_0041828 3300046473 Bacteria 2525
482 Ga0495582_0422807 3300046473 Bacteria 769
483 Ga0495582_0606613 3300046473 Bacteria 633
484 Ga0495639_0206318 3300046475 Bacteria 963
485 Ga0495639_0395149 3300046475 Bacteria 698
486 Ga0495607_0238917 3300046501 Bacteria 880
487 Ga0495608_0039741 3300046511 Bacteria 3152
488 Ga0495608_0213098 3300046511 Bacteria 1214
489 Ga0495610_0116527 3300046512 Bacteria 1177
490 Ga0495628_0154047 3300046516 Bacteria 1749
491 Ga0495628_0162934 3300046516 Bacteria 1694
492 Ga0495628_0203404 3300046516 Bacteria 1491
493 Ga0495630_0010900 3300046517 Bacteria 6565
494 Ga0495630_0318966 3300046517 Bacteria 1188
495 Ga0495630_0406660 3300046517 Bacteria 1043
496 Ga0495666_0192761 3300046526 Bacteria 939
497 Ga0495652_0401588 3300046529 Bacteria 970
498 Ga0495640_0332366 3300046533 Bacteria 940
499 Ga0495640_0593247 3300046533 Bacteria 669
500 Ga0495587_0053831 3300046536 Bacteria 2372
501 Ga0495587_0368436 3300046536 Bacteria 800
502 Ga0495598_0209738 3300046537 Bacteria 707
503 Ga0495645_0004427 3300046543 Bacteria 9593
504 Ga0495656_0119836 3300046615 Bacteria 1241
505 Ga0495656_0287918 3300046615 Bacteria 839
506 Ga0495634_0280130 3300046642 Bacteria 1013
507 Ga0495611_0179280 3300046648 Bacteria 990
508 Ga0495635_0471561 3300046663 Bacteria 828
509 Ga0495657_0047275 3300046675 Bacteria 2910
510 Ga0495599_0110128 3300046678 Bacteria 1716
511 Ga0495599_0240460 3300046678 Bacteria 1104
512 Ga0495647_0024667 3300046681 Bacteria 2191
513 Ga0495647_0029173 3300046681 Bacteria 2039
514 Ga0495647_0031489 3300046681 Bacteria 1973
515 Ga0495647_0187512 3300046681 Bacteria 902
516 Ga0495658_0046802 3300046683 Bacteria 2433
517 Ga0495658_0063955 3300046683 Bacteria 2118
518 Ga0495669_0134426 3300046684 Bacteria 1165
519 Ga0495613_0013985 3300046689 Bacteria 5957
520 Ga0495613_0199781 3300046689 Bacteria 1410
521 Ga0495613_0202812 3300046689 Bacteria 1398
522 Ga0495624_0143899 3300046690 Bacteria 1460
523 Ga0495670_0317137 3300046691 Bacteria 837
524 Ga0495670_0481795 3300046691 Bacteria 673
525 Ga0495600_0293614 3300046809 Bacteria 1027
526 Ga0495600_0488459 3300046809 Bacteria 758
527 Ga0495600_0494407 3300046809 Bacteria 752
528 Ga0495581_0450625 3300047315 Bacteria 749
529 Ga0495604_0039449 3300047317 Bacteria 3711
530 Ga0495604_0115887 3300047317 Bacteria 1946
531 Ga0495674_0044746 3300047319 Bacteria 3934
532 Ga0495674_0130151 3300047319 Bacteria 2120
533 Ga0495680_0155995 3300047322 Bacteria 1660
534 Ga0495680_0180664 3300047322 Bacteria 1523
535 Ga0495680_0290614 3300047322 Bacteria 1150
536 Ga0495675_0369920 3300047444 Bacteria 840
537 Ga0495684_0001687 3300047471 Bacteria 17745
538 Ga0495684_0073724 3300047471 Bacteria 2593
539 Ga0495602_0306123 3300048088 Bacteria 1161
540 Ga0496100_0004796 3300048903 Bacteria 7222
541 Ga0496100_0149902 3300048903 Bacteria 1662
542 Ga0496101_0000396 3300048904 Bacteria 28444
543 Ga0496102_0213093 3300048905 Bacteria 1821
544 Ga0496102_0267652 3300048905 Bacteria 1611
545 Ga0496102_0404817 3300048905 Bacteria 1283
546 Ga0496102_0457266 3300048905 Bacteria 1197
547 Ga0496103_0584234 3300048906 Bacteria 712
548 Ga0496104_0017385 3300048907 Bacteria 6549
549 Ga0496104_0021813 3300048907 Bacteria 5883
550 Ga0496104_0083357 3300048907 Bacteria 3049
551 Ga0496104_0354243 3300048907 Bacteria 1380
552 Ga0496104_0368628 3300048907 Bacteria 1349
553 Ga0496105_0090691 3300048908 Bacteria 2524
554 Ga0496105_0124564 3300048908 Bacteria 2124
555 Ga0496106_0311109 3300048909 Bacteria 1264
556 Ga0496107_0031098 3300048910 Bacteria 3807
557 Ga0496107_0104604 3300048910 Bacteria 2078
558 Ga0496108_0011060 3300048911 Bacteria 7328
559 Ga0496108_0310386 3300048911 Bacteria 1374
560 Ga0496109_0151382 3300048912 Bacteria 2172
561 Ga0496109_0191312 3300048912 Bacteria 1923
562 Ga0496110_0157481 3300048913 Bacteria 2058
563 Ga0496110_0399484 3300048913 Bacteria 1253
564 Ga0496110_1004039 3300048913 Bacteria 742
565 Ga0496111_0549294 3300048914 Bacteria 848
566 Ga0496112_0016237 3300048915 Bacteria 6967
567 Ga0496112_0055326 3300048915 Bacteria 3901
568 Ga0496112_0199485 3300048915 Bacteria 1961
569 Ga0496112_0394138 3300048915 Bacteria 1325
570 Ga0496112_0745016 3300048915 Bacteria 906
571 Ga0496113_0032056 3300048916 Bacteria 3817
572 Ga0496114_0000246 3300048917 Bacteria 39480
573 Ga0496114_0013645 3300048917 Bacteria 6514
574 Ga0496114_0172098 3300048917 Bacteria 1888
575 Ga0496114_0259315 3300048917 Bacteria 1530
576 Ga0496114_0333337 3300048917 Bacteria 1341
577 Ga0496114_0489114 3300048917 Bacteria 1088
578 Ga0496115_0383448 3300048918 Bacteria 1143
579 Ga0496115_0513647 3300048918 Bacteria 961
580 Ga0495682_0101315 3300049460 Bacteria 1033
581 Ga0501318_058812 3300049534 Bacteria 586
582 Ga0501034_0077055 3300049571 Bacteria 3340
583 Ga0501034_0108508 3300049571 Bacteria 2767
584 Ga0501036_0997737 3300049572 Bacteria 685
585 Ga0501038_0525123 3300049574 Bacteria 903
586 Ga0501039_0924243 3300049575 Bacteria 679
587 Ga0501041_0273442 3300049577 Bacteria 1063
588 Ga0501042_1188518 3300049578 Bacteria 556
589 Ga0501043_0067123 3300049579 Bacteria 2817
590 Ga0501047_0015370 3300049581 Bacteria 7290
591 Ga0501047_0399559 3300049581 Bacteria 1207
592 Ga0501048_0193859 3300049582 Bacteria 1440
593 Ga0501068_0172060 3300049584 Bacteria 1367
594 Ga0501070_0443810 3300049586 Bacteria 1047
595 Ga0501072_0531812 3300049588 Bacteria 929
596 Ga0501073_0177565 3300049589 Bacteria 1474
597 Ga0501076_0161703 3300049592 Bacteria 1824
598 Ga0501080_0958755 3300049742 Bacteria 743
599 Ga0501081_0126226 3300049743 Bacteria 1825
600 Ga0501083_0137210 3300049744 Bacteria 1602
601 Ga0501044_0003452 3300049823 Bacteria 17800
602 Ga0501045_0482481 3300049824 Bacteria 921
603 nmdc:mga00v17_169418_c1 3300050491 Bacteria 1408
604 nmdc:mga0k408_227432_c1 3300050493 Bacteria 1114
605 nmdc:mga06z11_310287_c1 3300050494 Bacteria 939
606 nmdc:mga06z11_54011_c1 3300050494 Bacteria 2069
607 nmdc:mga04h51_118064_c1 3300050495 Bacteria 985
608 nmdc:mga05p37_119480_c1 3300050507 Bacteria 3238
609 nmdc:mga05p37_260703_c1 3300050507 Bacteria 2075
610 nmdc:mga05p37_361676_c1 3300050507 Bacteria 1706
611 nmdc:mga05p37_403716_c1 3300050507 Bacteria 1595
612 nmdc:mga05p37_411029_c1 3300050507 Bacteria 1577
613 nmdc:mga05p37_416605_c1 3300050507 Bacteria 1564
614 nmdc:mga05p37_6561_c1 3300050507 Bacteria 13712
615 nmdc:mga09592_112102_c1 3300050508 Bacteria 2340
616 nmdc:mga0qj67_297758_c1 3300050509 Bacteria 1307
617 nmdc:mga0qj67_786687_c1 3300050509 Bacteria 754
618 nmdc:mga06r32_45742_c1 3300050510 Bacteria 4173
619 nmdc:mga06r32_490383_c1 3300050510 Bacteria 1206
620 nmdc:mga08y16_1091636_c1 3300050511 Bacteria 773
621 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
622 nmdc:mga08y16_1463818_c1 3300050511 Bacteria 644
623 nmdc:mga08y16_16207_c1 3300050511 Bacteria 7835
624 nmdc:mga08y16_20665_c1 3300050511 Bacteria 6949
625 nmdc:mga08y16_95418_c1 3300050511 Bacteria 3098
626 nmdc:mga0n895_12982_c1 3300050512 Bacteria 4790
627 nmdc:mga0n895_17757_c1 3300050512 Bacteria 6566
628 nmdc:mga0n895_24421_c1 3300050512 Bacteria 5697
629 nmdc:mga0n895_27160_c1 3300050512 Bacteria 5435
630 nmdc:mga0n895_449050_c1 3300050512 Bacteria 1302
631 nmdc:mga0n895_490768_c1 3300050512 Bacteria 1238
632 nmdc:mga0n895_7101_c1 3300050512 Bacteria 9574
633 nmdc:mga0n895_957514_c1 3300050512 Bacteria 839
634 nmdc:mga0rr50_140171_c1 3300050513 Bacteria 1945
635 nmdc:mga0rr50_1773_c1 3300050513 Bacteria 11923
636 nmdc:mga0rr50_2205_c1 3300050513 Bacteria 10927
637 nmdc:mga0rr50_373_c1 3300050513 Bacteria 24506
638 nmdc:mga0rr50_40661_c1 3300050513 Bacteria 3382
639 nmdc:mga0rr50_435801_c1 3300050513 Bacteria 1110
640 nmdc:mga08x19_10007_c1 3300050514 Bacteria 5684
641 nmdc:mga08x19_189510_c1 3300050514 Bacteria 1407
642 nmdc:mga08x19_441276_c1 3300050514 Bacteria 916
643 nmdc:mga08x19_79203_c1 3300050514 Bacteria 2155
644 nmdc:mga0a205_10346_c1 3300050515 Bacteria 8575
645 nmdc:mga0a205_14317_c1 3300050515 Bacteria 7396
646 nmdc:mga0a205_162299_c1 3300050515 Bacteria 2131
647 nmdc:mga0a205_193005_c1 3300050515 Bacteria 1928
648 nmdc:mga0a205_255698_c1 3300050515 Bacteria 1630
649 nmdc:mga0a205_616154_c1 3300050515 Bacteria 938
650 nmdc:mga0a205_6655_c1 3300050515 Bacteria 10458
651 Ga0495601_0040645 3300053077 Bacteria 2913
652 Ga0495601_0073947 3300053077 Bacteria 2180
653 Ga0495601_0179517 3300053077 Bacteria 1384
654 Ga0495612_0184035 3300053078 Bacteria 918
655 Ga0495612_0206914 3300053078 Bacteria 867
656 Ga0495595_0015689 3300053084 Bacteria 3233
657 Ga0495595_0015791 3300053084 Bacteria 3224
658 Ga0495595_0099791 3300053084 Bacteria 1400
659 Ga0495595_0246585 3300053084 Bacteria 894
660 Ga0495595_0247835 3300053084 Bacteria 892
661 Ga0495619_0076292 3300053085 Bacteria 2250
662 Ga0495619_0163154 3300053085 Bacteria 1539
663 Ga0500555_000474 3300053103 Bacteria 16656
664 Ga0500556_0001889 3300053104 Bacteria 7496
665 Ga0500658_0026256 3300053134 Bacteria 2243
666 Ga0500568_0002524 3300053139 Bacteria 10698
667 Ga0500616_0000173 3300053153 Bacteria 107646
668 Ga0500627_0271257 3300053158 Bacteria 747
669 Ga0590071_010704 3300059421 Bacteria 2145
670 Ga0590075_059940 3300059424 Bacteria 980
671 Ga0501082_0139167 3300060353 Bacteria 2107

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005441 Ga0070700_100432017 Ga0070700_1004320172 147
2 3300005457 Ga0070662_100496398 Ga0070662_1004963982 147
3 3300005471 Ga0070698_100183947 Ga0070698_1001839472 147
4 3300005546 Ga0070696_100133503 Ga0070696_1001335031 147
5 3300005546 Ga0070696_100184966 Ga0070696_1001849662 147
6 3300005617 Ga0068859_100700495 Ga0068859_1007004952 147
7 3300005719 Ga0068861_101645756 Ga0068861_1016457562 147
8 3300005842 Ga0068858_100524546 Ga0068858_1005245462 147
9 3300006931 Ga0097620_100700471 Ga0097620_1007004712 147
10 3300009148 Ga0105243_10054004 Ga0105243_100540046 147
11 3300009553 Ga0105249_10455911 Ga0105249_104559112 147
12 3300025899 Ga0207642_10054168 Ga0207642_100541684 147
13 3300025931 Ga0207644_11023801 Ga0207644_110238012 147
14 3300025933 Ga0207706_10450722 Ga0207706_104507223 147
15 3300025934 Ga0207686_10160445 Ga0207686_101604453 147
16 3300025938 Ga0207704_10464569 Ga0207704_104645692 147
17 3300025961 Ga0207712_10726235 Ga0207712_107262352 147
18 3300025972 Ga0207668_10076681 Ga0207668_100766814 147
19 3300026035 Ga0207703_10361518 Ga0207703_103615182 147
20 3300026118 Ga0207675_100014045 Ga0207675_10001404514 147
21 3300028380 Ga0268265_10025303 Ga0268265_100253035 147
22 3300048909 Ga0496106_0311109 Ga0496106_0311109_719_1237 147
23 3300025899 Ga0207642_10948925 Ga0207642_109489251 148
24 3300005347 Ga0070668_100489968 Ga0070668_1004899683 150
25 3300005438 Ga0070701_10205854 Ga0070701_102058543 150
26 3300005719 Ga0068861_100463764 Ga0068861_1004637643 150
27 3300005842 Ga0068858_100189424 Ga0068858_1001894243 150
28 3300005842 Ga0068858_101641368 Ga0068858_1016413681 150
29 3300005844 Ga0068862_100109135 Ga0068862_1001091355 150
30 3300006058 Ga0075432_10185114 Ga0075432_101851141 150
31 3300006844 Ga0075428_100319068 Ga0075428_1003190683 150
32 3300006847 Ga0075431_100598368 Ga0075431_1005983682 150
33 3300009101 Ga0105247_10511839 Ga0105247_105118391 150
34 3300009147 Ga0114129_10017270 Ga0114129_100172705 150
35 3300009147 Ga0114129_10118442 Ga0114129_101184426 150
36 3300009177 Ga0105248_10404784 Ga0105248_104047841 150
37 3300014326 Ga0157380_10190699 Ga0157380_101906993 150
38 3300014968 Ga0157379_11038565 Ga0157379_110385652 150
39 3300027364 Ga0209967_1039820 Ga0209967_10398202 150
40 3300005290 Ga0065712_10033738 Ga0065712_100337382 151
41 3300005293 Ga0065715_10238277 Ga0065715_102382772 151
42 3300005295 Ga0065707_10519979 Ga0065707_105199791 151
43 3300005327 Ga0070658_10302065 Ga0070658_103020653 151
44 3300005328 Ga0070676_10100742 Ga0070676_101007423 151
45 3300005328 Ga0070676_10285363 Ga0070676_102853632 151
46 3300005329 Ga0070683_100763243 Ga0070683_1007632432 151
47 3300005331 Ga0070670_100280626 Ga0070670_1002806263 151
48 3300005331 Ga0070670_100596116 Ga0070670_1005961162 151
49 3300005333 Ga0070677_10104469 Ga0070677_101044693 151
50 3300005335 Ga0070666_10051882 Ga0070666_100518824 151
51 3300005335 Ga0070666_10212816 Ga0070666_102128163 151
52 3300005338 Ga0068868_100055137 Ga0068868_1000551374 151
53 3300005338 Ga0068868_100553795 Ga0068868_1005537952 151
54 3300005338 Ga0068868_100887592 Ga0068868_1008875921 151
55 3300005339 Ga0070660_100520246 Ga0070660_1005202462 151
56 3300005340 Ga0070689_100460205 Ga0070689_1004602052 151
57 3300005354 Ga0070675_100000056 Ga0070675_10000005628 151
58 3300005354 Ga0070675_100029203 Ga0070675_1000292036 151
59 3300005354 Ga0070675_100546245 Ga0070675_1005462452 151
60 3300005354 Ga0070675_100735796 Ga0070675_1007357962 151
61 3300005356 Ga0070674_100007417 Ga0070674_1000074174 151
62 3300005356 Ga0070674_100046049 Ga0070674_1000460496 151
63 3300005356 Ga0070674_100078891 Ga0070674_1000788912 151
64 3300005356 Ga0070674_100192253 Ga0070674_1001922534 151
65 3300005364 Ga0070673_100003427 Ga0070673_1000034278 151
66 3300005364 Ga0070673_100043981 Ga0070673_1000439814 151
67 3300005367 Ga0070667_100165408 Ga0070667_1001654083 151
68 3300005367 Ga0070667_100168474 Ga0070667_1001684744 151
69 3300005367 Ga0070667_100643276 Ga0070667_1006432762 151
70 3300005435 Ga0070714_100050502 Ga0070714_1000505024 151
71 3300005439 Ga0070711_100592938 Ga0070711_1005929382 151
72 3300005440 Ga0070705_100573723 Ga0070705_1005737232 151
73 3300005444 Ga0070694_100016422 Ga0070694_1000164223 151
74 3300005445 Ga0070708_100055234 Ga0070708_1000552343 151
75 3300005455 Ga0070663_100654247 Ga0070663_1006542472 151
76 3300005456 Ga0070678_100092251 Ga0070678_1000922515 151
77 3300005458 Ga0070681_10042357 Ga0070681_100423572 151
78 3300005458 Ga0070681_10348644 Ga0070681_103486442 151
79 3300005459 Ga0068867_100041777 Ga0068867_1000417773 151
80 3300005459 Ga0068867_100073877 Ga0068867_1000738774 151
81 3300005459 Ga0068867_100513996 Ga0068867_1005139962 151
82 3300005459 Ga0068867_100588601 Ga0068867_1005886012 151
83 3300005459 Ga0068867_100816926 Ga0068867_1008169262 151
84 3300005467 Ga0070706_100556565 Ga0070706_1005565652 151
85 3300005468 Ga0070707_100125461 Ga0070707_1001254616 151
86 3300005468 Ga0070707_100175008 Ga0070707_1001750084 151
87 3300005471 Ga0070698_100034124 Ga0070698_1000341243 151
88 3300005518 Ga0070699_100119032 Ga0070699_1001190323 151
89 3300005535 Ga0070684_100744697 Ga0070684_1007446972 151
90 3300005536 Ga0070697_100193729 Ga0070697_1001937293 151
91 3300005543 Ga0070672_100417490 Ga0070672_1004174903 151
92 3300005544 Ga0070686_100024325 Ga0070686_1000243253 151
93 3300005545 Ga0070695_100063603 Ga0070695_1000636033 151
94 3300005545 Ga0070695_100169060 Ga0070695_1001690602 151
95 3300005546 Ga0070696_100145121 Ga0070696_1001451213 151
96 3300005546 Ga0070696_100694764 Ga0070696_1006947642 151
97 3300005547 Ga0070693_100512486 Ga0070693_1005124862 151
98 3300005548 Ga0070665_100004733 Ga0070665_10000473311 151
99 3300005548 Ga0070665_100005447 Ga0070665_1000054473 151
100 3300005548 Ga0070665_100010437 Ga0070665_1000104375 151
101 3300005549 Ga0070704_100096664 Ga0070704_1000966643 151
102 3300005549 Ga0070704_100355660 Ga0070704_1003556601 151
103 3300005549 Ga0070704_100462367 Ga0070704_1004623672 151
104 3300005564 Ga0070664_100563231 Ga0070664_1005632312 151
105 3300005578 Ga0068854_100177554 Ga0068854_1001775543 151
106 3300005617 Ga0068859_100168307 Ga0068859_1001683073 151
107 3300005618 Ga0068864_100075695 Ga0068864_1000756957 151
108 3300005718 Ga0068866_10332190 Ga0068866_103321902 151
109 3300005841 Ga0068863_100116801 Ga0068863_1001168015 151
110 3300005842 Ga0068858_100001254 Ga0068858_10000125427 151
111 3300005842 Ga0068858_100008638 Ga0068858_10000863814 151
112 3300005842 Ga0068858_101016433 Ga0068858_1010164331 151
113 3300005843 Ga0068860_100123715 Ga0068860_1001237153 151
114 3300005843 Ga0068860_100304196 Ga0068860_1003041962 151
115 3300005843 Ga0068860_100304719 Ga0068860_1003047193 151
116 3300005843 Ga0068860_100534033 Ga0068860_1005340333 151
117 3300005844 Ga0068862_100110658 Ga0068862_1001106583 151
118 3300005937 Ga0081455_10174261 Ga0081455_101742613 151
119 3300005937 Ga0081455_10345681 Ga0081455_103456813 151
120 3300005983 Ga0081540_1096511 Ga0081540_10965112 151
121 3300005985 Ga0081539_10100098 Ga0081539_101000983 151
122 3300005985 Ga0081539_10197007 Ga0081539_101970072 151
123 3300006042 Ga0075368_10004958 Ga0075368_100049583 151
124 3300006173 Ga0070716_100341366 Ga0070716_1003413662 151
125 3300006178 Ga0075367_10028961 Ga0075367_100289614 151
126 3300006178 Ga0075367_10258480 Ga0075367_102584803 151
127 3300006237 Ga0097621_100006061 Ga0097621_10000606114 151
128 3300006237 Ga0097621_100118810 Ga0097621_1001188102 151
129 3300006358 Ga0068871_100006055 Ga0068871_1000060559 151
130 3300006358 Ga0068871_100075510 Ga0068871_1000755104 151
131 3300006844 Ga0075428_100000009 Ga0075428_100000009203 151
132 3300006844 Ga0075428_100312003 Ga0075428_1003120034 151
133 3300006846 Ga0075430_100105326 Ga0075430_1001053262 151
134 3300006847 Ga0075431_100261523 Ga0075431_1002615232 151
135 3300006852 Ga0075433_10100150 Ga0075433_101001506 151
136 3300006852 Ga0075433_10128181 Ga0075433_101281814 151
137 3300006852 Ga0075433_10616820 Ga0075433_106168202 151
138 3300006871 Ga0075434_100069571 Ga0075434_1000695712 151
139 3300006871 Ga0075434_100109389 Ga0075434_1001093895 151
140 3300006871 Ga0075434_100110530 Ga0075434_1001105304 151
141 3300006871 Ga0075434_101223515 Ga0075434_1012235152 151
142 3300006880 Ga0075429_100522210 Ga0075429_1005222102 151
143 3300006881 Ga0068865_100006729 Ga0068865_10000672915 151
144 3300006881 Ga0068865_100055357 Ga0068865_1000553572 151
145 3300006914 Ga0075436_100018272 Ga0075436_1000182721 151
146 3300006914 Ga0075436_100038116 Ga0075436_1000381161 151
147 3300006914 Ga0075436_100110506 Ga0075436_1001105064 151
148 3300006931 Ga0097620_100168317 Ga0097620_1001683173 151
149 3300007076 Ga0075435_100001694 Ga0075435_10000169419 151
150 3300007076 Ga0075435_100028991 Ga0075435_1000289918 151
151 3300007076 Ga0075435_100038141 Ga0075435_1000381418 151
152 3300009093 Ga0105240_10045226 Ga0105240_100452269 151
153 3300009094 Ga0111539_10000010 Ga0111539_1000001035 151
154 3300009094 Ga0111539_10000566 Ga0111539_1000056612 151
155 3300009094 Ga0111539_11332686 Ga0111539_113326862 151
156 3300009098 Ga0105245_10035527 Ga0105245_1003552711 151
157 3300009098 Ga0105245_10473430 Ga0105245_104734302 151
158 3300009101 Ga0105247_10004209 Ga0105247_100042096 151
159 3300009147 Ga0114129_10216991 Ga0114129_102169913 151
160 3300009147 Ga0114129_11634253 Ga0114129_116342532 151
161 3300009148 Ga0105243_10105863 Ga0105243_101058631 151
162 3300009174 Ga0105241_10100846 Ga0105241_101008463 151
163 3300009176 Ga0105242_10013585 Ga0105242_1001358513 151
164 3300009176 Ga0105242_10035616 Ga0105242_100356168 151
165 3300009176 Ga0105242_10125367 Ga0105242_101253674 151
166 3300009176 Ga0105242_10177665 Ga0105242_101776654 151
167 3300009177 Ga0105248_10026461 Ga0105248_100264614 151
168 3300009177 Ga0105248_10387276 Ga0105248_103872762 151
169 3300009177 Ga0105248_10452960 Ga0105248_104529602 151
170 3300009177 Ga0105248_10819264 Ga0105248_108192642 151
171 3300009551 Ga0105238_11387555 Ga0105238_113875552 151
172 3300010159 Ga0099796_10030103 Ga0099796_100301033 151
173 3300010375 Ga0105239_11680584 Ga0105239_116805841 151
174 3300013296 Ga0157374_10119547 Ga0157374_101195471 151
175 3300013296 Ga0157374_10433731 Ga0157374_104337313 151
176 3300013296 Ga0157374_11120636 Ga0157374_111206361 151
177 3300013306 Ga0163162_10364795 Ga0163162_103647953 151
178 3300013306 Ga0163162_10519827 Ga0163162_105198272 151
179 3300013308 Ga0157375_10053326 Ga0157375_100533266 151
180 3300013308 Ga0157375_10277484 Ga0157375_102774843 151
181 3300014325 Ga0163163_10087285 Ga0163163_100872853 151
182 3300014325 Ga0163163_10125545 Ga0163163_101255456 151
183 3300014325 Ga0163163_10548400 Ga0163163_105484003 151
184 3300014325 Ga0163163_10641362 Ga0163163_106413623 151
185 3300014326 Ga0157380_10194070 Ga0157380_101940703 151
186 3300014326 Ga0157380_10489694 Ga0157380_104896942 151
187 3300014745 Ga0157377_10019122 Ga0157377_100191224 151
188 3300014968 Ga0157379_10018550 Ga0157379_100185506 151
189 3300014968 Ga0157379_10063370 Ga0157379_100633703 151
190 3300014968 Ga0157379_10146389 Ga0157379_101463893 151
191 3300014968 Ga0157379_10802200 Ga0157379_108022002 151
192 3300014969 Ga0157376_10057273 Ga0157376_100572735 151
193 3300014969 Ga0157376_10145796 Ga0157376_101457961 151
194 3300014969 Ga0157376_11266519 Ga0157376_112665192 151
195 3300021358 Ga0213873_10124294 Ga0213873_101242942 151
196 3300025315 Ga0207697_10089053 Ga0207697_100890532 151
197 3300025315 Ga0207697_10157139 Ga0207697_101571392 151
198 3300025893 Ga0207682_10094553 Ga0207682_100945532 151
199 3300025893 Ga0207682_10146518 Ga0207682_101465182 151
200 3300025893 Ga0207682_10342783 Ga0207682_103427832 151
201 3300025899 Ga0207642_10258962 Ga0207642_102589622 151
202 3300025901 Ga0207688_10190402 Ga0207688_101904023 151
203 3300025901 Ga0207688_10337075 Ga0207688_103370752 151
204 3300025903 Ga0207680_10349441 Ga0207680_103494413 151
205 3300025903 Ga0207680_10364852 Ga0207680_103648523 151
206 3300025907 Ga0207645_10096400 Ga0207645_100964002 151
207 3300025907 Ga0207645_10155591 Ga0207645_101555913 151
208 3300025907 Ga0207645_10307973 Ga0207645_103079731 151
209 3300025908 Ga0207643_10090349 Ga0207643_100903494 151
210 3300025909 Ga0207705_10423658 Ga0207705_104236582 151
211 3300025909 Ga0207705_10546213 Ga0207705_105462133 151
212 3300025912 Ga0207707_10312425 Ga0207707_103124252 151
213 3300025913 Ga0207695_10084625 Ga0207695_100846252 151
214 3300025913 Ga0207695_10642497 Ga0207695_106424971 151
215 3300025915 Ga0207693_10257754 Ga0207693_102577542 151
216 3300025916 Ga0207663_10236530 Ga0207663_102365303 151
217 3300025920 Ga0207649_10659408 Ga0207649_106594082 151
218 3300025920 Ga0207649_10693416 Ga0207649_106934162 151
219 3300025922 Ga0207646_10097073 Ga0207646_100970731 151
220 3300025922 Ga0207646_10731602 Ga0207646_107316021 151
221 3300025924 Ga0207694_10261502 Ga0207694_102615023 151
222 3300025924 Ga0207694_10758091 Ga0207694_107580911 151
223 3300025924 Ga0207694_10758852 Ga0207694_107588522 151
224 3300025925 Ga0207650_10877977 Ga0207650_108779772 151
225 3300025926 Ga0207659_10126623 Ga0207659_101266233 151
226 3300025927 Ga0207687_10015584 Ga0207687_100155843 151
227 3300025927 Ga0207687_10098805 Ga0207687_100988052 151
228 3300025929 Ga0207664_10050545 Ga0207664_100505454 151
229 3300025931 Ga0207644_10120436 Ga0207644_101204364 151
230 3300025932 Ga0207690_10232957 Ga0207690_102329572 151
231 3300025934 Ga0207686_10013361 Ga0207686_100133612 151
232 3300025934 Ga0207686_10016494 Ga0207686_100164944 151
233 3300025934 Ga0207686_10147455 Ga0207686_101474552 151
234 3300025937 Ga0207669_10039737 Ga0207669_100397372 151
235 3300025937 Ga0207669_10127353 Ga0207669_101273533 151
236 3300025937 Ga0207669_10392616 Ga0207669_103926162 151
237 3300025937 Ga0207669_10553177 Ga0207669_105531772 151
238 3300025937 Ga0207669_11301839 Ga0207669_113018391 151
239 3300025938 Ga0207704_10005828 Ga0207704_100058284 151
240 3300025938 Ga0207704_10169986 Ga0207704_101699863 151
241 3300025938 Ga0207704_10211258 Ga0207704_102112583 151
242 3300025939 Ga0207665_10048683 Ga0207665_100486832 151
243 3300025939 Ga0207665_10565550 Ga0207665_105655502 151
244 3300025939 Ga0207665_10847167 Ga0207665_108471672 151
245 3300025940 Ga0207691_10339779 Ga0207691_103397792 151
246 3300025940 Ga0207691_10419050 Ga0207691_104190502 151
247 3300025940 Ga0207691_10555542 Ga0207691_105555422 151
248 3300025941 Ga0207711_10026433 Ga0207711_100264337 151
249 3300025941 Ga0207711_10058386 Ga0207711_100583864 151
250 3300025941 Ga0207711_10169022 Ga0207711_101690222 151
251 3300025941 Ga0207711_10393563 Ga0207711_103935632 151
252 3300025942 Ga0207689_10034411 Ga0207689_100344113 151
253 3300025949 Ga0207667_10168529 Ga0207667_101685294 151
254 3300025960 Ga0207651_10041000 Ga0207651_100410003 151
255 3300025960 Ga0207651_10110459 Ga0207651_101104593 151
256 3300025960 Ga0207651_10149189 Ga0207651_101491893 151
257 3300025960 Ga0207651_10156204 Ga0207651_101562044 151
258 3300025961 Ga0207712_11612361 Ga0207712_116123611 151
259 3300025972 Ga0207668_10092168 Ga0207668_100921682 151
260 3300025972 Ga0207668_10098613 Ga0207668_100986134 151
261 3300025981 Ga0207640_10114374 Ga0207640_101143743 151
262 3300025986 Ga0207658_10276346 Ga0207658_102763463 151
263 3300026023 Ga0207677_10497170 Ga0207677_104971703 151
264 3300026023 Ga0207677_11060195 Ga0207677_110601952 151
265 3300026035 Ga0207703_10215416 Ga0207703_102154163 151
266 3300026035 Ga0207703_10280457 Ga0207703_102804572 151
267 3300026035 Ga0207703_11452727 Ga0207703_114527271 151
268 3300026041 Ga0207639_10543413 Ga0207639_105434132 151
269 3300026075 Ga0207708_10328664 Ga0207708_103286641 151
270 3300026088 Ga0207641_10752171 Ga0207641_107521713 151
271 3300026089 Ga0207648_10037722 Ga0207648_100377225 151
272 3300026089 Ga0207648_10082760 Ga0207648_100827605 151
273 3300026089 Ga0207648_10319166 Ga0207648_103191663 151
274 3300026095 Ga0207676_10028142 Ga0207676_100281422 151
275 3300026095 Ga0207676_10069079 Ga0207676_100690793 151
276 3300026095 Ga0207676_10164224 Ga0207676_101642242 151
277 3300026095 Ga0207676_10416489 Ga0207676_104164893 151
278 3300026116 Ga0207674_10203527 Ga0207674_102035273 151
279 3300026118 Ga0207675_100038967 Ga0207675_1000389674 151
280 3300026118 Ga0207675_100412832 Ga0207675_1004128322 151
281 3300026121 Ga0207683_11447570 Ga0207683_114475701 151
282 3300027907 Ga0207428_10000034 Ga0207428_10000034185 151
283 3300027907 Ga0207428_10107542 Ga0207428_101075423 151
284 3300027907 Ga0207428_10120374 Ga0207428_101203744 151
285 3300028379 Ga0268266_10005896 Ga0268266_1000589610 151
286 3300028379 Ga0268266_10029767 Ga0268266_100297673 151
287 3300028380 Ga0268265_10113738 Ga0268265_101137384 151
288 3300028380 Ga0268265_10733702 Ga0268265_107337021 151
289 3300028381 Ga0268264_10042810 Ga0268264_100428104 151
290 3300028381 Ga0268264_10050141 Ga0268264_100501416 151
291 3300028381 Ga0268264_10317611 Ga0268264_103176113 151
292 3300028381 Ga0268264_11287382 Ga0268264_112873821 151
293 3300031238 Ga0265332_10048353 Ga0265332_100483532 151
294 3300031344 Ga0265316_10261546 Ga0265316_102615463 151
295 3300031711 Ga0265314_10007579 Ga0265314_100075795 151
296 3300031824 Ga0307413_10220584 Ga0307413_102205843 151
297 3300031824 Ga0307413_10391449 Ga0307413_103914493 151
298 3300031911 Ga0307412_10843067 Ga0307412_108430672 151
299 3300032002 Ga0307416_100160347 Ga0307416_1001603473 151
300 3300032002 Ga0307416_100512333 Ga0307416_1005123332 151
301 3300032005 Ga0307411_10170887 Ga0307411_101708872 151
302 3300032005 Ga0307411_10594306 Ga0307411_105943062 151
303 3300034816 Ga0373930_0002995 Ga0373930_0002995_2039_2557 151
304 3300034817 Ga0373948_0001483 Ga0373948_0001483_1258_1776 151
305 3300034819 Ga0373958_0000045 Ga0373958_0000045_1633_2151 151
306 3300034820 Ga0373959_0001151 Ga0373959_0001151_31_549 151
307 3300034957 Ga0373938_0000418 Ga0373938_0000418_968_1486 151
308 3300035084 Ga0373928_0001212 Ga0373928_0001212_1812_2330 151
309 3300035085 Ga0373929_0000116 Ga0373929_0000116_8975_9493 151
310 3300035088 Ga0373940_0000084 Ga0373940_0000084_5809_6327 151
311 3300035089 Ga0373944_0043759 Ga0373944_0043759_476_994 151
312 3300035089 Ga0373944_0073733 Ga0373944_0073733_546_1064 151
313 3300035089 Ga0373944_0224850 Ga0373944_0224850_69_587 151
314 3300035090 Ga0373949_0000597 Ga0373949_0000597_8771_9289 151
315 3300035090 Ga0373949_0033224 Ga0373949_0033224_498_1016 151
316 3300035091 Ga0373951_0001673 Ga0373951_0001673_3207_3725 151
317 3300035092 Ga0373952_0001387 Ga0373952_0001387_1054_1572 151
318 3300035112 Ga0373932_0006095 Ga0373932_0006095_2303_2821 151
319 3300035113 Ga0373936_0092396 Ga0373936_0092396_492_1010 151
320 3300035113 Ga0373936_0346338 Ga0373936_0346338_38_556 151
321 3300035114 Ga0373939_0001888 Ga0373939_0001888_2441_2959 151
322 3300035114 Ga0373939_0031755 Ga0373939_0031755_389_907 151
323 3300035114 Ga0373939_0107081 Ga0373939_0107081_78_596 151
324 3300035115 Ga0373941_0000161 Ga0373941_0000161_6988_7506 151
325 3300035116 Ga0373945_0056786 Ga0373945_0056786_525_1043 151
326 3300035117 Ga0373953_0044678 Ga0373953_0044678_537_1055 151
327 3300035117 Ga0373953_0132653 Ga0373953_0132653_116_634 151
328 3300035119 Ga0373956_0208787 Ga0373956_0208787_88_606 151
329 3300035120 Ga0373957_0061355 Ga0373957_0061355_312_830 151
330 3300035121 Ga0373960_0001448 Ga0373960_0001448_4615_5133 151
331 3300035172 Ga0373955_0047351 Ga0373955_0047351_1049_1567 151
332 3300035172 Ga0373955_0059904 Ga0373955_0059904_396_914 151
333 3300035172 Ga0373955_0171915 Ga0373955_0171915_30_548 151
334 3300035207 Ga0373942_0001757 Ga0373942_0001757_3794_4312 151
335 3300035241 Ga0373961_0001591 Ga0373961_0001591_4151_4669 151
336 3300035241 Ga0373961_0111475 Ga0373961_0111475_331_849 151
337 3300035242 Ga0373962_0000245 Ga0373962_0000245_3795_4313 151
338 3300035410 Ga0373924_0173653 Ga0373924_0173653_273_791 151
339 3300035691 Ga0373931_0009494 Ga0373931_0009494_2961_3479 151
340 3300035691 Ga0373931_0169020 Ga0373931_0169020_348_866 151
341 3300035692 Ga0373935_0087624 Ga0373935_0087624_444_962 151
342 3300035692 Ga0373935_1067504 Ga0373935_1067504_25_543 151
343 3300035695 Ga0373927_0199653 Ga0373927_0199653_92_610 151
344 3300035725 Ga0373947_0085310 Ga0373947_0085310_1397_1915 151
345 3300036401 Ga0373937_0055553 Ga0373937_0055553_1054_1572 151
346 3300036401 Ga0373937_0139222 Ga0373937_0139222_116_634 151
347 3300036401 Ga0373937_0170677 Ga0373937_0170677_1390_1908 151
348 3300036401 Ga0373937_0356987 Ga0373937_0356987_182_700 151
349 3300037068 Ga0373925_0160073 Ga0373925_0160073_312_830 151
350 3300037068 Ga0373925_0251097 Ga0373925_0251097_300_818 151
351 3300037068 Ga0373925_0281546 Ga0373925_0281546_246_764 151
352 3300039453 Ga0436362_0941488 Ga0436362_0941488_22_540 151
353 3300041496 Ga0451839_1310317 Ga0451839_1310317_29_547 151
354 3300042122 Ga0450920_048426 Ga0450920_048426_182_700 151
355 3300042122 Ga0450920_056922 Ga0450920_056922_208_726 151
356 3300042156 Ga0439446_0031821 Ga0439446_0031821_930_1448 151
357 3300042530 Ga0450916_000502 Ga0450916_000502_2610_3128 151
358 3300045051 Ga0451576_0071334 Ga0451576_0071334_1841_2359 151
359 3300045051 Ga0451576_0277902 Ga0451576_0277902_398_916 151
360 3300045051 Ga0451576_1037898 Ga0451576_1037898_47_565 151
361 3300045051 Ga0451576_1823096 Ga0451576_1823096_39_557 151
362 3300046455 Ga0495603_0056649 Ga0495603_0056649_1587_2105 151
363 3300046455 Ga0495603_0297709 Ga0495603_0297709_312_830 151
364 3300046459 Ga0495629_0108936 Ga0495629_0108936_529_1047 151
365 3300046461 Ga0495641_0068787 Ga0495641_0068787_362_880 151
366 3300046462 Ga0495651_0599107 Ga0495651_0599107_123_641 151
367 3300046463 Ga0495653_0159656 Ga0495653_0159656_559_1077 151
368 3300046463 Ga0495653_0252550 Ga0495653_0252550_295_813 151
369 3300046473 Ga0495582_0422807 Ga0495582_0422807_32_550 151
370 3300046475 Ga0495639_0395149 Ga0495639_0395149_14_532 151
371 3300046511 Ga0495608_0213098 Ga0495608_0213098_38_556 151
372 3300046512 Ga0495610_0116527 Ga0495610_0116527_253_771 151
373 3300046516 Ga0495628_0162934 Ga0495628_0162934_458_976 151
374 3300046516 Ga0495628_0203404 Ga0495628_0203404_798_1316 151
375 3300046517 Ga0495630_0318966 Ga0495630_0318966_510_1028 151
376 3300046517 Ga0495630_0406660 Ga0495630_0406660_185_703 151
377 3300046526 Ga0495666_0192761 Ga0495666_0192761_59_577 151
378 3300046533 Ga0495640_0332366 Ga0495640_0332366_182_700 151
379 3300046533 Ga0495640_0593247 Ga0495640_0593247_84_602 151
380 3300046536 Ga0495587_0368436 Ga0495587_0368436_211_729 151
381 3300046537 Ga0495598_0209738 Ga0495598_0209738_176_694 151
382 3300046543 Ga0495645_0004427 Ga0495645_0004427_3505_4023 151
383 3300046615 Ga0495656_0287918 Ga0495656_0287918_107_625 151
384 3300046642 Ga0495634_0280130 Ga0495634_0280130_102_620 151
385 3300046648 Ga0495611_0179280 Ga0495611_0179280_195_713 151
386 3300046663 Ga0495635_0471561 Ga0495635_0471561_265_783 151
387 3300046678 Ga0495599_0240460 Ga0495599_0240460_502_1020 151
388 3300046681 Ga0495647_0024667 Ga0495647_0024667_339_857 151
389 3300046681 Ga0495647_0031489 Ga0495647_0031489_1380_1898 151
390 3300046681 Ga0495647_0187512 Ga0495647_0187512_232_750 151
391 3300046683 Ga0495658_0046802 Ga0495658_0046802_162_680 151
392 3300046683 Ga0495658_0063955 Ga0495658_0063955_1513_2031 151
393 3300046684 Ga0495669_0134426 Ga0495669_0134426_116_634 151
394 3300046689 Ga0495613_0199781 Ga0495613_0199781_73_591 151
395 3300046689 Ga0495613_0202812 Ga0495613_0202812_317_835 151
396 3300046690 Ga0495624_0143899 Ga0495624_0143899_713_1231 151
397 3300046691 Ga0495670_0317137 Ga0495670_0317137_267_785 151
398 3300046809 Ga0495600_0293614 Ga0495600_0293614_131_649 151
399 3300046809 Ga0495600_0494407 Ga0495600_0494407_104_622 151
400 3300047315 Ga0495581_0450625 Ga0495581_0450625_28_546 151
401 3300047317 Ga0495604_0115887 Ga0495604_0115887_1124_1642 151
402 3300047319 Ga0495674_0130151 Ga0495674_0130151_447_965 151
403 3300047322 Ga0495680_0180664 Ga0495680_0180664_799_1317 151
404 3300047322 Ga0495680_0290614 Ga0495680_0290614_161_679 151
405 3300047444 Ga0495675_0369920 Ga0495675_0369920_101_619 151
406 3300047471 Ga0495684_0073724 Ga0495684_0073724_23_541 151
407 3300048088 Ga0495602_0306123 Ga0495602_0306123_201_719 151
408 3300048903 Ga0496100_0004796 Ga0496100_0004796_3103_3621 151
409 3300048903 Ga0496100_0149902 Ga0496100_0149902_647_1165 151
410 3300048904 Ga0496101_0000396 Ga0496101_0000396_24756_25274 151
411 3300048905 Ga0496102_0213093 Ga0496102_0213093_1160_1678 151
412 3300048905 Ga0496102_0267652 Ga0496102_0267652_726_1244 151
413 3300048905 Ga0496102_0404817 Ga0496102_0404817_168_686 151
414 3300048906 Ga0496103_0584234 Ga0496103_0584234_93_611 151
415 3300048907 Ga0496104_0017385 Ga0496104_0017385_5023_5541 151
416 3300048907 Ga0496104_0021813 Ga0496104_0021813_2036_2554 151
417 3300048907 Ga0496104_0083357 Ga0496104_0083357_43_561 151
418 3300048907 Ga0496104_0354243 Ga0496104_0354243_280_798 151
419 3300048907 Ga0496104_0368628 Ga0496104_0368628_618_1136 151
420 3300048908 Ga0496105_0090691 Ga0496105_0090691_729_1247 151
421 3300048908 Ga0496105_0124564 Ga0496105_0124564_904_1422 151
422 3300048910 Ga0496107_0031098 Ga0496107_0031098_3201_3719 151
423 3300048910 Ga0496107_0104604 Ga0496107_0104604_704_1222 151
424 3300048911 Ga0496108_0011060 Ga0496108_0011060_2207_2725 151
425 3300048911 Ga0496108_0310386 Ga0496108_0310386_104_622 151
426 3300048912 Ga0496109_0151382 Ga0496109_0151382_719_1237 151
427 3300048912 Ga0496109_0191312 Ga0496109_0191312_452_970 151
428 3300048913 Ga0496110_0157481 Ga0496110_0157481_1392_1910 151
429 3300048913 Ga0496110_1004039 Ga0496110_1004039_115_633 151
430 3300048914 Ga0496111_0549294 Ga0496111_0549294_204_722 151
431 3300048915 Ga0496112_0016237 Ga0496112_0016237_6298_6816 151
432 3300048915 Ga0496112_0055326 Ga0496112_0055326_821_1339 151
433 3300048915 Ga0496112_0199485 Ga0496112_0199485_527_1045 151
434 3300048916 Ga0496113_0032056 Ga0496113_0032056_197_715 151
435 3300048917 Ga0496114_0000246 Ga0496114_0000246_11812_12330 151
436 3300048917 Ga0496114_0013645 Ga0496114_0013645_1711_2229 151
437 3300048917 Ga0496114_0259315 Ga0496114_0259315_363_881 151
438 3300048917 Ga0496114_0333337 Ga0496114_0333337_624_1142 151
439 3300048917 Ga0496114_0489114 Ga0496114_0489114_369_887 151
440 3300048918 Ga0496115_0383448 Ga0496115_0383448_565_1083 151
441 3300048918 Ga0496115_0513647 Ga0496115_0513647_241_759 151
442 3300049460 Ga0495682_0101315 Ga0495682_0101315_113_631 151
443 3300049571 Ga0501034_0108508 Ga0501034_0108508_753_1271 151
444 3300049574 Ga0501038_0525123 Ga0501038_0525123_280_798 151
445 3300049578 Ga0501042_1188518 Ga0501042_1188518_24_542 151
446 3300049581 Ga0501047_0399559 Ga0501047_0399559_273_791 151
447 3300049582 Ga0501048_0193859 Ga0501048_0193859_148_666 151
448 3300049589 Ga0501073_0177565 Ga0501073_0177565_57_575 151
449 3300049742 Ga0501080_0958755 Ga0501080_0958755_211_729 151
450 3300049743 Ga0501081_0126226 Ga0501081_0126226_383_901 151
451 3300049744 Ga0501083_0137210 Ga0501083_0137210_871_1389 151
452 3300049824 Ga0501045_0482481 Ga0501045_0482481_36_554 151
453 3300050494 nmdc:mga06z11_310287_c1 nmdc:mga06z11_310287_c1_350_868 151
454 3300050507 nmdc:mga05p37_119480_c1 nmdc:mga05p37_119480_c1_789_1307 151
455 3300050507 nmdc:mga05p37_260703_c1 nmdc:mga05p37_260703_c1_1155_1673 151
456 3300050507 nmdc:mga05p37_416605_c1 nmdc:mga05p37_416605_c1_158_676 151
457 3300050508 nmdc:mga09592_112102_c1 nmdc:mga09592_112102_c1_1563_2081 151
458 3300050509 nmdc:mga0qj67_786687_c1 nmdc:mga0qj67_786687_c1_107_625 151
459 3300050510 nmdc:mga06r32_45742_c1 nmdc:mga06r32_45742_c1_3524_4042 151
460 3300050511 nmdc:mga08y16_1091636_c1 nmdc:mga08y16_1091636_c1_41_559 151
461 3300050511 nmdc:mga08y16_10_c1 nmdc:mga08y16_10_c1_435452_435970 151
462 3300050511 nmdc:mga08y16_20665_c1 nmdc:mga08y16_20665_c1_4403_4921 151
463 3300050511 nmdc:mga08y16_95418_c1 nmdc:mga08y16_95418_c1_2464_2982 151
464 3300050512 nmdc:mga0n895_17757_c1 nmdc:mga0n895_17757_c1_3056_3574 151
465 3300050512 nmdc:mga0n895_24421_c1 nmdc:mga0n895_24421_c1_940_1458 151
466 3300050512 nmdc:mga0n895_449050_c1 nmdc:mga0n895_449050_c1_757_1275 151
467 3300050512 nmdc:mga0n895_490768_c1 nmdc:mga0n895_490768_c1_50_568 151
468 3300050512 nmdc:mga0n895_7101_c1 nmdc:mga0n895_7101_c1_2891_3409 151
469 3300050512 nmdc:mga0n895_957514_c1 nmdc:mga0n895_957514_c1_260_778 151
470 3300050513 nmdc:mga0rr50_140171_c1 nmdc:mga0rr50_140171_c1_1012_1530 151
471 3300050513 nmdc:mga0rr50_1773_c1 nmdc:mga0rr50_1773_c1_10425_10943 151
472 3300050513 nmdc:mga0rr50_373_c1 nmdc:mga0rr50_373_c1_18722_19240 151
473 3300050513 nmdc:mga0rr50_40661_c1 nmdc:mga0rr50_40661_c1_1154_1672 151
474 3300050513 nmdc:mga0rr50_435801_c1 nmdc:mga0rr50_435801_c1_527_1045 151
475 3300050514 nmdc:mga08x19_10007_c1 nmdc:mga08x19_10007_c1_824_1342 151
476 3300050514 nmdc:mga08x19_189510_c1 nmdc:mga08x19_189510_c1_559_1077 151
477 3300050514 nmdc:mga08x19_441276_c1 nmdc:mga08x19_441276_c1_111_629 151
478 3300050514 nmdc:mga08x19_79203_c1 nmdc:mga08x19_79203_c1_34_552 151
479 3300050515 nmdc:mga0a205_10346_c1 nmdc:mga0a205_10346_c1_6128_6646 151
480 3300050515 nmdc:mga0a205_255698_c1 nmdc:mga0a205_255698_c1_43_561 151
481 3300050515 nmdc:mga0a205_6655_c1 nmdc:mga0a205_6655_c1_4924_5442 151
482 3300053077 Ga0495601_0073947 Ga0495601_0073947_952_1470 151
483 3300053077 Ga0495601_0179517 Ga0495601_0179517_88_606 151
484 3300053078 Ga0495612_0206914 Ga0495612_0206914_109_627 151
485 3300053084 Ga0495595_0015689 Ga0495595_0015689_340_858 151
486 3300053084 Ga0495595_0099791 Ga0495595_0099791_141_659 151
487 3300053084 Ga0495595_0246585 Ga0495595_0246585_315_833 151
488 3300053084 Ga0495595_0247835 Ga0495595_0247835_116_634 151
489 3300053085 Ga0495619_0076292 Ga0495619_0076292_1068_1586 151
490 3300053085 Ga0495619_0163154 Ga0495619_0163154_872_1390 151
491 3300053134 Ga0500658_0026256 Ga0500658_0026256_714_1232 151
492 3300053158 Ga0500627_0271257 Ga0500627_0271257_80_598 151
493 3300005295 Ga0065707_10089023 Ga0065707_100890239 152
494 3300005328 Ga0070676_10007044 Ga0070676_100070447 152
495 3300005331 Ga0070670_100050949 Ga0070670_1000509494 152
496 3300005335 Ga0070666_10123865 Ga0070666_101238652 152
497 3300005337 Ga0070682_100444190 Ga0070682_1004441901 152
498 3300005341 Ga0070691_10004188 Ga0070691_100041886 152
499 3300005343 Ga0070687_100080522 Ga0070687_1000805223 152
500 3300005353 Ga0070669_100110504 Ga0070669_1001105042 152
501 3300005356 Ga0070674_100278160 Ga0070674_1002781602 152
502 3300005364 Ga0070673_100460085 Ga0070673_1004600852 152
503 3300005438 Ga0070701_10010126 Ga0070701_100101267 152
504 3300005440 Ga0070705_100044955 Ga0070705_1000449552 152
505 3300005440 Ga0070705_100971410 Ga0070705_1009714101 152
506 3300005459 Ga0068867_100035655 Ga0068867_1000356558 152
507 3300005518 Ga0070699_100741988 Ga0070699_1007419882 152
508 3300005543 Ga0070672_100454407 Ga0070672_1004544072 152
509 3300005544 Ga0070686_100002243 Ga0070686_1000022436 152
510 3300005546 Ga0070696_100012605 Ga0070696_1000126054 152
511 3300005577 Ga0068857_101000445 Ga0068857_1010004452 152
512 3300005578 Ga0068854_100637221 Ga0068854_1006372211 152
513 3300005614 Ga0068856_100018557 Ga0068856_1000185577 152
514 3300005615 Ga0070702_100002883 Ga0070702_1000028835 152
515 3300005617 Ga0068859_100020008 Ga0068859_10002000815 152
516 3300005719 Ga0068861_100024888 Ga0068861_1000248888 152
517 3300005840 Ga0068870_10321948 Ga0068870_103219482 152
518 3300005841 Ga0068863_100116322 Ga0068863_1001163221 152
519 3300005843 Ga0068860_100129065 Ga0068860_1001290655 152
520 3300005843 Ga0068860_100328276 Ga0068860_1003282762 152
521 3300005843 Ga0068860_100344425 Ga0068860_1003444252 152
522 3300005844 Ga0068862_100157630 Ga0068862_1001576302 152
523 3300006844 Ga0075428_100348183 Ga0075428_1003481834 152
524 3300006852 Ga0075433_10530184 Ga0075433_105301842 152
525 3300006852 Ga0075433_11134277 Ga0075433_111342772 152
526 3300006871 Ga0075434_100135753 Ga0075434_1001357534 152
527 3300006871 Ga0075434_100385465 Ga0075434_1003854652 152
528 3300006931 Ga0097620_100020008 Ga0097620_10002000815 152
529 3300007076 Ga0075435_100001542 Ga0075435_10000154215 152
530 3300009093 Ga0105240_10177867 Ga0105240_101778674 152
531 3300009093 Ga0105240_11200222 Ga0105240_112002221 152
532 3300009098 Ga0105245_10062980 Ga0105245_100629801 152
533 3300009147 Ga0114129_10117140 Ga0114129_101171406 152
534 3300009147 Ga0114129_10148538 Ga0114129_101485383 152
535 3300012503 Ga0157313_1011512 Ga0157313_10115122 152
536 3300013296 Ga0157374_10899348 Ga0157374_108993481 152
537 3300014326 Ga0157380_10007827 Ga0157380_100078277 152
538 3300014326 Ga0157380_10547053 Ga0157380_105470532 152
539 3300025903 Ga0207680_10142428 Ga0207680_101424283 152
540 3300025911 Ga0207654_10223831 Ga0207654_102238312 152
541 3300025913 Ga0207695_10131709 Ga0207695_101317094 152
542 3300025918 Ga0207662_10178874 Ga0207662_101788741 152
543 3300025927 Ga0207687_10063053 Ga0207687_100630532 152
544 3300025935 Ga0207709_10007222 Ga0207709_1000722212 152
545 3300025937 Ga0207669_10337513 Ga0207669_103375132 152
546 3300025941 Ga0207711_10137892 Ga0207711_101378924 152
547 3300026075 Ga0207708_10105615 Ga0207708_101056154 152
548 3300026078 Ga0207702_10262266 Ga0207702_102622662 152
549 3300026089 Ga0207648_10016724 Ga0207648_100167248 152
550 3300026095 Ga0207676_10694427 Ga0207676_106944272 152
551 3300026118 Ga0207675_100818367 Ga0207675_1008183673 152
552 3300027907 Ga0207428_10072788 Ga0207428_100727882 152
553 3300027907 Ga0207428_10073024 Ga0207428_100730243 152
554 3300028380 Ga0268265_10005520 Ga0268265_100055207 152
555 3300037068 Ga0373925_0545741 Ga0373925_0545741_337_861 152
556 3300044694 Ga0466963_0109939 Ga0466963_0109939_1183_1704 152
557 3300046473 Ga0495582_0606613 Ga0495582_0606613_88_609 152
558 3300048905 Ga0496102_0457266 Ga0496102_0457266_453_977 152
559 3300048913 Ga0496110_0399484 Ga0496110_0399484_576_1097 152
560 3300048915 Ga0496112_0745016 Ga0496112_0745016_79_606 152
561 3300049571 Ga0501034_0077055 Ga0501034_0077055_2680_3207 152
562 3300049572 Ga0501036_0997737 Ga0501036_0997737_41_568 152
563 3300049577 Ga0501041_0273442 Ga0501041_0273442_212_739 152
564 3300049579 Ga0501043_0067123 Ga0501043_0067123_695_1222 152
565 3300049581 Ga0501047_0015370 Ga0501047_0015370_6646_7173 152
566 3300049588 Ga0501072_0531812 Ga0501072_0531812_372_893 152
567 3300049823 Ga0501044_0003452 Ga0501044_0003452_1377_1904 152
568 3300050507 nmdc:mga05p37_361676_c1 nmdc:mga05p37_361676_c1_199_720 152
569 3300050507 nmdc:mga05p37_403716_c1 nmdc:mga05p37_403716_c1_989_1510 152
570 3300050507 nmdc:mga05p37_6561_c1 nmdc:mga05p37_6561_c1_12791_13312 152
571 3300050509 nmdc:mga0qj67_297758_c1 nmdc:mga0qj67_297758_c1_624_1178 152
572 3300050511 nmdc:mga08y16_1463818_c1 nmdc:mga08y16_1463818_c1_102_623 152
573 3300050511 nmdc:mga08y16_16207_c1 nmdc:mga08y16_16207_c1_6628_7149 152
574 3300050512 nmdc:mga0n895_12982_c1 nmdc:mga0n895_12982_c1_2624_3148 152
575 3300050512 nmdc:mga0n895_27160_c1 nmdc:mga0n895_27160_c1_3279_3800 152
576 3300050513 nmdc:mga0rr50_2205_c1 nmdc:mga0rr50_2205_c1_1657_2181 152
577 3300050515 nmdc:mga0a205_14317_c1 nmdc:mga0a205_14317_c1_5015_5536 152
578 3300050515 nmdc:mga0a205_162299_c1 nmdc:mga0a205_162299_c1_1178_1702 152
579 3300005335 Ga0070666_10310169 Ga0070666_103101692 153
580 3300005356 Ga0070674_100202289 Ga0070674_1002022892 153
581 3300005356 Ga0070674_100554456 Ga0070674_1005544562 153
582 3300005367 Ga0070667_101228191 Ga0070667_1012281912 153
583 3300005471 Ga0070698_100367829 Ga0070698_1003678292 153
584 3300005471 Ga0070698_100995188 Ga0070698_1009951881 153
585 3300005530 Ga0070679_100044653 Ga0070679_1000446531 153
586 3300005563 Ga0068855_100286434 Ga0068855_1002864342 153
587 3300005615 Ga0070702_100036054 Ga0070702_1000360542 153
588 3300006237 Ga0097621_100228720 Ga0097621_1002287203 153
589 3300006852 Ga0075433_10422349 Ga0075433_104223492 153
590 3300009094 Ga0111539_10293747 Ga0111539_102937474 153
591 3300009177 Ga0105248_10261960 Ga0105248_102619603 153
592 3300009551 Ga0105238_10125557 Ga0105238_101255574 153
593 3300013296 Ga0157374_10311603 Ga0157374_103116033 153
594 3300014968 Ga0157379_10138355 Ga0157379_101383554 153
595 3300025904 Ga0207647_10156595 Ga0207647_101565953 153
596 3300025917 Ga0207660_10323655 Ga0207660_103236551 153
597 3300025919 Ga0207657_10013143 Ga0207657_1001314311 153
598 3300025937 Ga0207669_10297868 Ga0207669_102978683 153
599 3300025938 Ga0207704_10707716 Ga0207704_107077161 153
600 3300025941 Ga0207711_10212107 Ga0207711_102121073 153
601 3300025944 Ga0207661_10337766 Ga0207661_103377662 153
602 3300025986 Ga0207658_11054258 Ga0207658_110542582 153
603 3300026142 Ga0207698_11764993 Ga0207698_117649931 153
604 3300027614 Ga0209970_1014250 Ga0209970_10142502 153
605 3300028800 Ga0265338_10656703 Ga0265338_106567031 153
606 3300031711 Ga0265314_10013729 Ga0265314_100137297 153
607 3300031712 Ga0265342_10192479 Ga0265342_101924792 153
608 3300032002 Ga0307416_100922927 Ga0307416_1009229272 153
609 3300035170 Ga0373943_0571512 Ga0373943_0571512_74_598 153
610 3300035171 Ga0373946_0369495 Ga0373946_0369495_51_575 153
611 3300035172 Ga0373955_0273145 Ga0373955_0273145_265_789 153
612 3300044712 Ga0453684_0121001 Ga0453684_0121001_389_979 153
613 3300046454 Ga0495592_0087298 Ga0495592_0087298_759_1283 153
614 3300046455 Ga0495603_0566865 Ga0495603_0566865_79_606 153
615 3300046473 Ga0495582_0041828 Ga0495582_0041828_1284_1808 153
616 3300046475 Ga0495639_0206318 Ga0495639_0206318_333_857 153
617 3300046501 Ga0495607_0238917 Ga0495607_0238917_290_817 153
618 3300046511 Ga0495608_0039741 Ga0495608_0039741_1389_1913 153
619 3300046516 Ga0495628_0154047 Ga0495628_0154047_1105_1629 153
620 3300046517 Ga0495630_0010900 Ga0495630_0010900_215_739 153
621 3300046529 Ga0495652_0401588 Ga0495652_0401588_270_794 153
622 3300046536 Ga0495587_0053831 Ga0495587_0053831_1316_1840 153
623 3300046675 Ga0495657_0047275 Ga0495657_0047275_479_1003 153
624 3300046678 Ga0495599_0110128 Ga0495599_0110128_1083_1607 153
625 3300046681 Ga0495647_0029173 Ga0495647_0029173_1029_1556 153
626 3300046689 Ga0495613_0013985 Ga0495613_0013985_130_654 153
627 3300046691 Ga0495670_0481795 Ga0495670_0481795_11_538 153
628 3300046809 Ga0495600_0488459 Ga0495600_0488459_124_648 153
629 3300047317 Ga0495604_0039449 Ga0495604_0039449_2440_2964 153
630 3300047319 Ga0495674_0044746 Ga0495674_0044746_362_886 153
631 3300047322 Ga0495680_0155995 Ga0495680_0155995_695_1219 153
632 3300047471 Ga0495684_0001687 Ga0495684_0001687_16758_17282 153
633 3300048915 Ga0496112_0394138 Ga0496112_0394138_461_985 153
634 3300048917 Ga0496114_0172098 Ga0496114_0172098_957_1484 153
635 3300049534 Ga0501318_058812 Ga0501318_058812_13_537 153
636 3300049584 Ga0501068_0172060 Ga0501068_0172060_724_1248 153
637 3300050493 nmdc:mga0k408_227432_c1 nmdc:mga0k408_227432_c1_268_891 153
638 3300050507 nmdc:mga05p37_411029_c1 nmdc:mga05p37_411029_c1_814_1338 153
639 3300050510 nmdc:mga06r32_490383_c1 nmdc:mga06r32_490383_c1_506_1063 153
640 3300050515 nmdc:mga0a205_193005_c1 nmdc:mga0a205_193005_c1_145_669 153
641 3300050515 nmdc:mga0a205_616154_c1 nmdc:mga0a205_616154_c1_100_624 153
642 3300053077 Ga0495601_0040645 Ga0495601_0040645_517_1041 153
643 3300053078 Ga0495612_0184035 Ga0495612_0184035_240_764 153
644 3300053084 Ga0495595_0015791 Ga0495595_0015791_1494_2018 153
645 3300060353 Ga0501082_0139167 Ga0501082_0139167_386_913 153
646 3300005615 Ga0070702_100096432 Ga0070702_1000964322 154
647 3300005842 Ga0068858_100793695 Ga0068858_1007936952 154
648 3300006237 Ga0097621_100238936 Ga0097621_1002389363 154
649 3300009148 Ga0105243_11686437 Ga0105243_116864372 154
650 3300013297 Ga0157378_10067386 Ga0157378_100673864 154
651 3300042156 Ga0439446_0172916 Ga0439446_0172916_24_590 154
652 3300042461 Ga0439460_0019860 Ga0439460_0019860_75_602 154
653 3300049586 Ga0501070_0443810 Ga0501070_0443810_188_727 154
654 3300053103 Ga0500555_000474 Ga0500555_000474_8688_9224 154
655 3300053104 Ga0500556_0001889 Ga0500556_0001889_1048_1578 154
656 3300053153 Ga0500616_0000173 Ga0500616_0000173_14145_14681 154
657 3300059421 Ga0590071_010704 Ga0590071_010704_323_892 154
658 3300059424 Ga0590075_059940 Ga0590075_059940_115_684 154
659 3300049575 Ga0501039_0924243 Ga0501039_0924243_34_591 155
660 3300049592 Ga0501076_0161703 Ga0501076_0161703_951_1508 155
661 3300006178 Ga0075367_10010203 Ga0075367_100102035 157
662 3300027866 Ga0209813_10100043 Ga0209813_101000432 157
663 3300028379 Ga0268266_10219488 Ga0268266_102194881 157
664 3300046615 Ga0495656_0119836 Ga0495656_0119836_324_872 157
665 3300050491 nmdc:mga00v17_169418_c1 nmdc:mga00v17_169418_c1_246_872 157
666 3300050494 nmdc:mga06z11_54011_c1 nmdc:mga06z11_54011_c1_1394_2020 157
667 3300050495 nmdc:mga04h51_118064_c1 nmdc:mga04h51_118064_c1_95_721 157
668 3300053139 Ga0500568_0002524 Ga0500568_0002524_2016_2687 158
669 3300031824 Ga0307413_10091526 Ga0307413_100915263 159
670 3300005331 Ga0070670_100362036 Ga0070670_1003620362 161
671 3300004800 Ga0058861_12003411 Ga0058861_120034113 213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00333

Ribosomal_S5

Ribosomal protein S5, N-terminal domain

28

92

0.98

PF03719

Ribosomal_S5_C

Ribosomal protein S5, C-terminal domain

104

130

0.89

Feature Viewer

pLDDT pTM Quality
48.24 0.35 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map