F474133
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 671 | 321 | 671 | 173 |
Family's Representative Sequence
| Representative Sequence | 3300004800|Ga0058861_12003411|Ga0058861_120034113 |
| Length | 213 |
| Sequence | MVVGADLRVGPGIHMRTRERIDASQLDIKDNVVSINRVTKVVKGGKNLSFSALVVVGDGHGVVGFGVGKAKEVPSAIKKGIEAAKKNLIRVPLAGNTIPHRIVGVFGAGSVLLKPAPDGTGIIARRGARGDHEHPHQVARIGQPAQRRACDDHRARLAEGSRDDRAAARQRAERRHVRHGLTRPTNEQRGSVRFGRTREIWLIRERIRRAPAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 107 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 177 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 178 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 179 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 180 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 181 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 182 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 184 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 189 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 191 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 192 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 197 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 204 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 212 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 213 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 214 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 215 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 216 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 217 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 218 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 219 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 220 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 262 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 263 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 264 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 265 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 266 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 267 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 270 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 273 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 274 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 275 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 297 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 298 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 299 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 300 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 314 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 315 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 316 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 317 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 318 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 319 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 320 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 321 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.38 |
| Nodule | 0 |
| Rhizoplane | 5.96 |
| Rhizosphere | 91.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058861_12003411 | 3300004800 | Bacteria | 1805 |
| 2 | Ga0065712_10033738 | 3300005290 | Bacteria | 1066 |
| 3 | Ga0065715_10238277 | 3300005293 | Bacteria | 1206 |
| 4 | Ga0065707_10089023 | 3300005295 | Bacteria | 4482 |
| 5 | Ga0065707_10519979 | 3300005295 | Bacteria | 743 |
| 6 | Ga0070658_10302065 | 3300005327 | Bacteria | 1365 |
| 7 | Ga0070676_10007044 | 3300005328 | Bacteria | 6019 |
| 8 | Ga0070676_10100742 | 3300005328 | Bacteria | 1784 |
| 9 | Ga0070676_10285363 | 3300005328 | Bacteria | 1114 |
| 10 | Ga0070683_100763243 | 3300005329 | Bacteria | 926 |
| 11 | Ga0070670_100050949 | 3300005331 | Bacteria | 3557 |
| 12 | Ga0070670_100280626 | 3300005331 | Bacteria | 1454 |
| 13 | Ga0070670_100362036 | 3300005331 | Bacteria | 1275 |
| 14 | Ga0070670_100596116 | 3300005331 | Bacteria | 988 |
| 15 | Ga0070677_10104469 | 3300005333 | Bacteria | 1255 |
| 16 | Ga0070666_10051882 | 3300005335 | Bacteria | 2763 |
| 17 | Ga0070666_10123865 | 3300005335 | Bacteria | 1793 |
| 18 | Ga0070666_10212816 | 3300005335 | Bacteria | 1362 |
| 19 | Ga0070666_10310169 | 3300005335 | Bacteria | 1124 |
| 20 | Ga0070682_100444190 | 3300005337 | Bacteria | 992 |
| 21 | Ga0068868_100055137 | 3300005338 | Bacteria | 3135 |
| 22 | Ga0068868_100553795 | 3300005338 | Bacteria | 1014 |
| 23 | Ga0068868_100887592 | 3300005338 | Bacteria | 809 |
| 24 | Ga0070660_100520246 | 3300005339 | Bacteria | 991 |
| 25 | Ga0070689_100460205 | 3300005340 | Unclassified | 1084 |
| 26 | Ga0070691_10004188 | 3300005341 | Bacteria | 6554 |
| 27 | Ga0070687_100080522 | 3300005343 | Bacteria | 1776 |
| 28 | Ga0070668_100489968 | 3300005347 | Bacteria | 1062 |
| 29 | Ga0070669_100110504 | 3300005353 | Bacteria | 2085 |
| 30 | Ga0070675_100000056 | 3300005354 | Bacteria | 66985 |
| 31 | Ga0070675_100029203 | 3300005354 | Bacteria | 4445 |
| 32 | Ga0070675_100546245 | 3300005354 | Bacteria | 1047 |
| 33 | Ga0070675_100735796 | 3300005354 | Bacteria | 899 |
| 34 | Ga0070674_100007417 | 3300005356 | Bacteria | 6470 |
| 35 | Ga0070674_100046049 | 3300005356 | Bacteria | 2982 |
| 36 | Ga0070674_100078891 | 3300005356 | Bacteria | 2347 |
| 37 | Ga0070674_100192253 | 3300005356 | Bacteria | 1571 |
| 38 | Ga0070674_100202289 | 3300005356 | Bacteria | 1534 |
| 39 | Ga0070674_100278160 | 3300005356 | Bacteria | 1325 |
| 40 | Ga0070674_100554456 | 3300005356 | Bacteria | 965 |
| 41 | Ga0070673_100003427 | 3300005364 | Bacteria | 9877 |
| 42 | Ga0070673_100043981 | 3300005364 | Bacteria | 3455 |
| 43 | Ga0070673_100460085 | 3300005364 | Bacteria | 1145 |
| 44 | Ga0070667_100165408 | 3300005367 | Bacteria | 1951 |
| 45 | Ga0070667_100168474 | 3300005367 | Bacteria | 1932 |
| 46 | Ga0070667_100643276 | 3300005367 | Bacteria | 979 |
| 47 | Ga0070667_101228191 | 3300005367 | Bacteria | 702 |
| 48 | Ga0070714_100050502 | 3300005435 | Bacteria | 3543 |
| 49 | Ga0070701_10010126 | 3300005438 | Bacteria | 4157 |
| 50 | Ga0070701_10205854 | 3300005438 | Bacteria | 1166 |
| 51 | Ga0070711_100592938 | 3300005439 | Bacteria | 924 |
| 52 | Ga0070705_100044955 | 3300005440 | Bacteria | 2538 |
| 53 | Ga0070705_100573723 | 3300005440 | Bacteria | 869 |
| 54 | Ga0070705_100971410 | 3300005440 | Bacteria | 688 |
| 55 | Ga0070700_100432017 | 3300005441 | Bacteria | 997 |
| 56 | Ga0070694_100016422 | 3300005444 | Bacteria | 4660 |
| 57 | Ga0070708_100055234 | 3300005445 | Bacteria | 3531 |
| 58 | Ga0070663_100654247 | 3300005455 | Bacteria | 889 |
| 59 | Ga0070678_100092251 | 3300005456 | Bacteria | 2326 |
| 60 | Ga0070662_100496398 | 3300005457 | Bacteria | 1018 |
| 61 | Ga0070681_10042357 | 3300005458 | Bacteria | 4563 |
| 62 | Ga0070681_10348644 | 3300005458 | Bacteria | 1391 |
| 63 | Ga0068867_100035655 | 3300005459 | Bacteria | 3609 |
| 64 | Ga0068867_100041777 | 3300005459 | Bacteria | 3351 |
| 65 | Ga0068867_100073877 | 3300005459 | Bacteria | 2554 |
| 66 | Ga0068867_100513996 | 3300005459 | Bacteria | 1031 |
| 67 | Ga0068867_100588601 | 3300005459 | Bacteria | 969 |
| 68 | Ga0068867_100816926 | 3300005459 | Bacteria | 833 |
| 69 | Ga0070706_100556565 | 3300005467 | Bacteria | 1067 |
| 70 | Ga0070707_100125461 | 3300005468 | Bacteria | 2494 |
| 71 | Ga0070707_100175008 | 3300005468 | Bacteria | 2092 |
| 72 | Ga0070698_100034124 | 3300005471 | Bacteria | 5270 |
| 73 | Ga0070698_100183947 | 3300005471 | Bacteria | 2028 |
| 74 | Ga0070698_100367829 | 3300005471 | Bacteria | 1370 |
| 75 | Ga0070698_100995188 | 3300005471 | Bacteria | 786 |
| 76 | Ga0070699_100119032 | 3300005518 | Bacteria | 2322 |
| 77 | Ga0070699_100741988 | 3300005518 | Bacteria | 898 |
| 78 | Ga0070679_100044653 | 3300005530 | Bacteria | 4415 |
| 79 | Ga0070684_100744697 | 3300005535 | Bacteria | 915 |
| 80 | Ga0070697_100193729 | 3300005536 | Bacteria | 1726 |
| 81 | Ga0070672_100417490 | 3300005543 | Bacteria | 1152 |
| 82 | Ga0070672_100454407 | 3300005543 | Bacteria | 1104 |
| 83 | Ga0070686_100002243 | 3300005544 | Bacteria | 10661 |
| 84 | Ga0070686_100024325 | 3300005544 | Bacteria | 3629 |
| 85 | Ga0070695_100063603 | 3300005545 | Bacteria | 2398 |
| 86 | Ga0070695_100169060 | 3300005545 | Bacteria | 1541 |
| 87 | Ga0070696_100012605 | 3300005546 | Bacteria | 5675 |
| 88 | Ga0070696_100133503 | 3300005546 | Bacteria | 1809 |
| 89 | Ga0070696_100145121 | 3300005546 | Bacteria | 1738 |
| 90 | Ga0070696_100184966 | 3300005546 | Bacteria | 1547 |
| 91 | Ga0070696_100694764 | 3300005546 | Bacteria | 829 |
| 92 | Ga0070693_100512486 | 3300005547 | Bacteria | 853 |
| 93 | Ga0070665_100004733 | 3300005548 | Bacteria | 14164 |
| 94 | Ga0070665_100005447 | 3300005548 | Bacteria | 13122 |
| 95 | Ga0070665_100010437 | 3300005548 | Bacteria | 9398 |
| 96 | Ga0070704_100096664 | 3300005549 | Bacteria | 2215 |
| 97 | Ga0070704_100355660 | 3300005549 | Bacteria | 1238 |
| 98 | Ga0070704_100462367 | 3300005549 | Bacteria | 1095 |
| 99 | Ga0068855_100286434 | 3300005563 | Bacteria | 1827 |
| 100 | Ga0070664_100563231 | 3300005564 | Bacteria | 1054 |
| 101 | Ga0068857_101000445 | 3300005577 | Bacteria | 805 |
| 102 | Ga0068854_100177554 | 3300005578 | Bacteria | 1661 |
| 103 | Ga0068854_100637221 | 3300005578 | Bacteria | 914 |
| 104 | Ga0068856_100018557 | 3300005614 | Bacteria | 6740 |
| 105 | Ga0070702_100002883 | 3300005615 | Bacteria | 7557 |
| 106 | Ga0070702_100036054 | 3300005615 | Bacteria | 2737 |
| 107 | Ga0070702_100096432 | 3300005615 | Bacteria | 1805 |
| 108 | Ga0068859_100020008 | 3300005617 | Bacteria | 6721 |
| 109 | Ga0068859_100168307 | 3300005617 | Bacteria | 2272 |
| 110 | Ga0068859_100700495 | 3300005617 | Bacteria | 1103 |
| 111 | Ga0068864_100075695 | 3300005618 | Bacteria | 2940 |
| 112 | Ga0068866_10332190 | 3300005718 | Bacteria | 960 |
| 113 | Ga0068861_100024888 | 3300005719 | Bacteria | 4334 |
| 114 | Ga0068861_100463764 | 3300005719 | Bacteria | 1138 |
| 115 | Ga0068861_101645756 | 3300005719 | Bacteria | 633 |
| 116 | Ga0068870_10321948 | 3300005840 | Bacteria | 983 |
| 117 | Ga0068863_100116322 | 3300005841 | Bacteria | 2548 |
| 118 | Ga0068863_100116801 | 3300005841 | Bacteria | 2542 |
| 119 | Ga0068858_100001254 | 3300005842 | Bacteria | 26256 |
| 120 | Ga0068858_100008638 | 3300005842 | Bacteria | 9781 |
| 121 | Ga0068858_100189424 | 3300005842 | Bacteria | 1944 |
| 122 | Ga0068858_100524546 | 3300005842 | Bacteria | 1146 |
| 123 | Ga0068858_100793695 | 3300005842 | Bacteria | 924 |
| 124 | Ga0068858_101016433 | 3300005842 | Bacteria | 813 |
| 125 | Ga0068858_101641368 | 3300005842 | Bacteria | 635 |
| 126 | Ga0068860_100123715 | 3300005843 | Bacteria | 2479 |
| 127 | Ga0068860_100129065 | 3300005843 | Bacteria | 2424 |
| 128 | Ga0068860_100304196 | 3300005843 | Bacteria | 1563 |
| 129 | Ga0068860_100304719 | 3300005843 | Bacteria | 1561 |
| 130 | Ga0068860_100328276 | 3300005843 | Bacteria | 1502 |
| 131 | Ga0068860_100344425 | 3300005843 | Bacteria | 1466 |
| 132 | Ga0068860_100534033 | 3300005843 | Bacteria | 1174 |
| 133 | Ga0068862_100109135 | 3300005844 | Bacteria | 2427 |
| 134 | Ga0068862_100110658 | 3300005844 | Bacteria | 2410 |
| 135 | Ga0068862_100157630 | 3300005844 | Bacteria | 2025 |
| 136 | Ga0081455_10174261 | 3300005937 | Bacteria | 1635 |
| 137 | Ga0081455_10345681 | 3300005937 | Bacteria | 1051 |
| 138 | Ga0081540_1096511 | 3300005983 | Bacteria | 1286 |
| 139 | Ga0081539_10100098 | 3300005985 | Bacteria | 1479 |
| 140 | Ga0081539_10197007 | 3300005985 | Bacteria | 933 |
| 141 | Ga0075368_10004958 | 3300006042 | Bacteria | 4544 |
| 142 | Ga0075432_10185114 | 3300006058 | Bacteria | 817 |
| 143 | Ga0070716_100341366 | 3300006173 | Bacteria | 1057 |
| 144 | Ga0075367_10010203 | 3300006178 | Bacteria | 4925 |
| 145 | Ga0075367_10028961 | 3300006178 | Bacteria | 3163 |
| 146 | Ga0075367_10258480 | 3300006178 | Bacteria | 1093 |
| 147 | Ga0097621_100006061 | 3300006237 | Bacteria | 8549 |
| 148 | Ga0097621_100118810 | 3300006237 | Bacteria | 2241 |
| 149 | Ga0097621_100228720 | 3300006237 | Bacteria | 1623 |
| 150 | Ga0097621_100238936 | 3300006237 | Bacteria | 1588 |
| 151 | Ga0068871_100006055 | 3300006358 | Bacteria | 8509 |
| 152 | Ga0068871_100075510 | 3300006358 | Bacteria | 2782 |
| 153 | Ga0075428_100000009 | 3300006844 | Bacteria | 266370 |
| 154 | Ga0075428_100312003 | 3300006844 | Bacteria | 1690 |
| 155 | Ga0075428_100319068 | 3300006844 | Bacteria | 1670 |
| 156 | Ga0075428_100348183 | 3300006844 | Bacteria | 1590 |
| 157 | Ga0075430_100105326 | 3300006846 | Bacteria | 2354 |
| 158 | Ga0075431_100261523 | 3300006847 | Bacteria | 1756 |
| 159 | Ga0075431_100598368 | 3300006847 | Bacteria | 1087 |
| 160 | Ga0075433_10100150 | 3300006852 | Bacteria | 2565 |
| 161 | Ga0075433_10128181 | 3300006852 | Bacteria | 2254 |
| 162 | Ga0075433_10422349 | 3300006852 | Bacteria | 1176 |
| 163 | Ga0075433_10530184 | 3300006852 | Bacteria | 1036 |
| 164 | Ga0075433_10616820 | 3300006852 | Bacteria | 952 |
| 165 | Ga0075433_11134277 | 3300006852 | Bacteria | 679 |
| 166 | Ga0075434_100069571 | 3300006871 | Bacteria | 3509 |
| 167 | Ga0075434_100109389 | 3300006871 | Bacteria | 2774 |
| 168 | Ga0075434_100110530 | 3300006871 | Bacteria | 2759 |
| 169 | Ga0075434_100135753 | 3300006871 | Bacteria | 2479 |
| 170 | Ga0075434_100385465 | 3300006871 | Bacteria | 1422 |
| 171 | Ga0075434_101223515 | 3300006871 | Bacteria | 763 |
| 172 | Ga0075429_100522210 | 3300006880 | Bacteria | 1040 |
| 173 | Ga0068865_100006729 | 3300006881 | Bacteria | 7032 |
| 174 | Ga0068865_100055357 | 3300006881 | Bacteria | 2759 |
| 175 | Ga0075436_100018272 | 3300006914 | Bacteria | 4802 |
| 176 | Ga0075436_100038116 | 3300006914 | Bacteria | 3318 |
| 177 | Ga0075436_100110506 | 3300006914 | Bacteria | 1918 |
| 178 | Ga0097620_100020008 | 3300006931 | Bacteria | 6721 |
| 179 | Ga0097620_100168317 | 3300006931 | Bacteria | 2272 |
| 180 | Ga0097620_100700471 | 3300006931 | Bacteria | 1103 |
| 181 | Ga0075435_100001542 | 3300007076 | Bacteria | 14846 |
| 182 | Ga0075435_100001694 | 3300007076 | Bacteria | 14328 |
| 183 | Ga0075435_100028991 | 3300007076 | Bacteria | 4343 |
| 184 | Ga0075435_100038141 | 3300007076 | Bacteria | 3830 |
| 185 | Ga0105240_10045226 | 3300009093 | Bacteria | 5587 |
| 186 | Ga0105240_10177867 | 3300009093 | Bacteria | 2514 |
| 187 | Ga0105240_11200222 | 3300009093 | Bacteria | 803 |
| 188 | Ga0111539_10000010 | 3300009094 | Bacteria | 366246 |
| 189 | Ga0111539_10000566 | 3300009094 | Bacteria | 47366 |
| 190 | Ga0111539_10293747 | 3300009094 | Bacteria | 1891 |
| 191 | Ga0111539_11332686 | 3300009094 | Bacteria | 833 |
| 192 | Ga0105245_10035527 | 3300009098 | Bacteria | 4423 |
| 193 | Ga0105245_10062980 | 3300009098 | Bacteria | 3348 |
| 194 | Ga0105245_10473430 | 3300009098 | Bacteria | 1265 |
| 195 | Ga0105247_10004209 | 3300009101 | Bacteria | 9230 |
| 196 | Ga0105247_10511839 | 3300009101 | Bacteria | 876 |
| 197 | Ga0114129_10017270 | 3300009147 | Bacteria | 10276 |
| 198 | Ga0114129_10117140 | 3300009147 | Bacteria | 3671 |
| 199 | Ga0114129_10118442 | 3300009147 | Bacteria | 3648 |
| 200 | Ga0114129_10148538 | 3300009147 | Bacteria | 3209 |
| 201 | Ga0114129_10216991 | 3300009147 | Bacteria | 2583 |
| 202 | Ga0114129_11634253 | 3300009147 | Bacteria | 788 |
| 203 | Ga0105243_10054004 | 3300009148 | Bacteria | 3188 |
| 204 | Ga0105243_10105863 | 3300009148 | Bacteria | 2343 |
| 205 | Ga0105243_11686437 | 3300009148 | Bacteria | 662 |
| 206 | Ga0105241_10100846 | 3300009174 | Bacteria | 2295 |
| 207 | Ga0105242_10013585 | 3300009176 | Bacteria | 6299 |
| 208 | Ga0105242_10035616 | 3300009176 | Bacteria | 3991 |
| 209 | Ga0105242_10125367 | 3300009176 | Bacteria | 2210 |
| 210 | Ga0105242_10177665 | 3300009176 | Bacteria | 1876 |
| 211 | Ga0105248_10026461 | 3300009177 | Bacteria | 6454 |
| 212 | Ga0105248_10261960 | 3300009177 | Bacteria | 1946 |
| 213 | Ga0105248_10387276 | 3300009177 | Bacteria | 1574 |
| 214 | Ga0105248_10404784 | 3300009177 | Bacteria | 1536 |
| 215 | Ga0105248_10452960 | 3300009177 | Bacteria | 1446 |
| 216 | Ga0105248_10819264 | 3300009177 | Bacteria | 1051 |
| 217 | Ga0105238_10125557 | 3300009551 | Bacteria | 2545 |
| 218 | Ga0105238_11387555 | 3300009551 | Bacteria | 730 |
| 219 | Ga0105249_10455911 | 3300009553 | Bacteria | 1318 |
| 220 | Ga0099796_10030103 | 3300010159 | Bacteria | 1758 |
| 221 | Ga0105239_11680584 | 3300010375 | Bacteria | 735 |
| 222 | Ga0157313_1011512 | 3300012503 | Bacteria | 770 |
| 223 | Ga0157374_10119547 | 3300013296 | Bacteria | 2541 |
| 224 | Ga0157374_10311603 | 3300013296 | Bacteria | 1558 |
| 225 | Ga0157374_10433731 | 3300013296 | Bacteria | 1314 |
| 226 | Ga0157374_10899348 | 3300013296 | Bacteria | 903 |
| 227 | Ga0157374_11120636 | 3300013296 | Bacteria | 808 |
| 228 | Ga0157378_10067386 | 3300013297 | Bacteria | 3207 |
| 229 | Ga0163162_10364795 | 3300013306 | Bacteria | 1577 |
| 230 | Ga0163162_10519827 | 3300013306 | Bacteria | 1320 |
| 231 | Ga0157375_10053326 | 3300013308 | Bacteria | 3978 |
| 232 | Ga0157375_10277484 | 3300013308 | Bacteria | 1839 |
| 233 | Ga0163163_10087285 | 3300014325 | Bacteria | 3130 |
| 234 | Ga0163163_10125545 | 3300014325 | Bacteria | 2604 |
| 235 | Ga0163163_10548400 | 3300014325 | Bacteria | 1219 |
| 236 | Ga0163163_10641362 | 3300014325 | Bacteria | 1126 |
| 237 | Ga0157380_10007827 | 3300014326 | Bacteria | 7605 |
| 238 | Ga0157380_10190699 | 3300014326 | Bacteria | 1809 |
| 239 | Ga0157380_10194070 | 3300014326 | Bacteria | 1795 |
| 240 | Ga0157380_10489694 | 3300014326 | Bacteria | 1191 |
| 241 | Ga0157380_10547053 | 3300014326 | Bacteria | 1135 |
| 242 | Ga0157377_10019122 | 3300014745 | Bacteria | 3575 |
| 243 | Ga0157379_10018550 | 3300014968 | Bacteria | 6136 |
| 244 | Ga0157379_10063370 | 3300014968 | Bacteria | 3306 |
| 245 | Ga0157379_10138355 | 3300014968 | Bacteria | 2195 |
| 246 | Ga0157379_10146389 | 3300014968 | Bacteria | 2130 |
| 247 | Ga0157379_10802200 | 3300014968 | Bacteria | 889 |
| 248 | Ga0157379_11038565 | 3300014968 | Bacteria | 783 |
| 249 | Ga0157376_10057273 | 3300014969 | Bacteria | 3259 |
| 250 | Ga0157376_10145796 | 3300014969 | Bacteria | 2129 |
| 251 | Ga0157376_11266519 | 3300014969 | Bacteria | 767 |
| 252 | Ga0213873_10124294 | 3300021358 | Bacteria | 760 |
| 253 | Ga0207697_10089053 | 3300025315 | Bacteria | 1307 |
| 254 | Ga0207697_10157139 | 3300025315 | Bacteria | 991 |
| 255 | Ga0207682_10094553 | 3300025893 | Bacteria | 1300 |
| 256 | Ga0207682_10146518 | 3300025893 | Bacteria | 1062 |
| 257 | Ga0207682_10342783 | 3300025893 | Bacteria | 703 |
| 258 | Ga0207642_10054168 | 3300025899 | Bacteria | 1828 |
| 259 | Ga0207642_10258962 | 3300025899 | Bacteria | 991 |
| 260 | Ga0207642_10948925 | 3300025899 | Bacteria | 552 |
| 261 | Ga0207688_10190402 | 3300025901 | Bacteria | 1227 |
| 262 | Ga0207688_10337075 | 3300025901 | Bacteria | 927 |
| 263 | Ga0207680_10142428 | 3300025903 | Bacteria | 1590 |
| 264 | Ga0207680_10349441 | 3300025903 | Bacteria | 1038 |
| 265 | Ga0207680_10364852 | 3300025903 | Bacteria | 1016 |
| 266 | Ga0207647_10156595 | 3300025904 | Bacteria | 1330 |
| 267 | Ga0207645_10096400 | 3300025907 | Bacteria | 1905 |
| 268 | Ga0207645_10155591 | 3300025907 | Bacteria | 1493 |
| 269 | Ga0207645_10307973 | 3300025907 | Bacteria | 1055 |
| 270 | Ga0207643_10090349 | 3300025908 | Bacteria | 1785 |
| 271 | Ga0207705_10423658 | 3300025909 | Bacteria | 1031 |
| 272 | Ga0207705_10546213 | 3300025909 | Bacteria | 901 |
| 273 | Ga0207654_10223831 | 3300025911 | Bacteria | 1249 |
| 274 | Ga0207707_10312425 | 3300025912 | Bacteria | 1358 |
| 275 | Ga0207695_10084625 | 3300025913 | Bacteria | 3202 |
| 276 | Ga0207695_10131709 | 3300025913 | Bacteria | 2458 |
| 277 | Ga0207695_10642497 | 3300025913 | Bacteria | 942 |
| 278 | Ga0207693_10257754 | 3300025915 | Bacteria | 1368 |
| 279 | Ga0207663_10236530 | 3300025916 | Bacteria | 1337 |
| 280 | Ga0207660_10323655 | 3300025917 | Bacteria | 1232 |
| 281 | Ga0207662_10178874 | 3300025918 | Bacteria | 1364 |
| 282 | Ga0207657_10013143 | 3300025919 | Bacteria | 8130 |
| 283 | Ga0207649_10659408 | 3300025920 | Bacteria | 809 |
| 284 | Ga0207649_10693416 | 3300025920 | Bacteria | 789 |
| 285 | Ga0207646_10097073 | 3300025922 | Bacteria | 2640 |
| 286 | Ga0207646_10731602 | 3300025922 | Bacteria | 884 |
| 287 | Ga0207694_10261502 | 3300025924 | Bacteria | 1418 |
| 288 | Ga0207694_10758091 | 3300025924 | Bacteria | 819 |
| 289 | Ga0207694_10758852 | 3300025924 | Bacteria | 819 |
| 290 | Ga0207650_10877977 | 3300025925 | Bacteria | 761 |
| 291 | Ga0207659_10126623 | 3300025926 | Bacteria | 1965 |
| 292 | Ga0207687_10015584 | 3300025927 | Bacteria | 4986 |
| 293 | Ga0207687_10063053 | 3300025927 | Bacteria | 2623 |
| 294 | Ga0207687_10098805 | 3300025927 | Bacteria | 2143 |
| 295 | Ga0207664_10050545 | 3300025929 | Bacteria | 3278 |
| 296 | Ga0207644_10120436 | 3300025931 | Bacteria | 1997 |
| 297 | Ga0207644_11023801 | 3300025931 | Bacteria | 693 |
| 298 | Ga0207690_10232957 | 3300025932 | Bacteria | 1415 |
| 299 | Ga0207706_10450722 | 3300025933 | Bacteria | 1113 |
| 300 | Ga0207686_10013361 | 3300025934 | Bacteria | 4541 |
| 301 | Ga0207686_10016494 | 3300025934 | Bacteria | 4146 |
| 302 | Ga0207686_10147455 | 3300025934 | Bacteria | 1634 |
| 303 | Ga0207686_10160445 | 3300025934 | Bacteria | 1575 |
| 304 | Ga0207709_10007222 | 3300025935 | Bacteria | 6197 |
| 305 | Ga0207669_10039737 | 3300025937 | Bacteria | 2722 |
| 306 | Ga0207669_10127353 | 3300025937 | Bacteria | 1742 |
| 307 | Ga0207669_10297868 | 3300025937 | Bacteria | 1224 |
| 308 | Ga0207669_10337513 | 3300025937 | Bacteria | 1159 |
| 309 | Ga0207669_10392616 | 3300025937 | Bacteria | 1084 |
| 310 | Ga0207669_10553177 | 3300025937 | Bacteria | 929 |
| 311 | Ga0207669_11301839 | 3300025937 | Bacteria | 617 |
| 312 | Ga0207704_10005828 | 3300025938 | Bacteria | 5701 |
| 313 | Ga0207704_10169986 | 3300025938 | Bacteria | 1562 |
| 314 | Ga0207704_10211258 | 3300025938 | Bacteria | 1428 |
| 315 | Ga0207704_10464569 | 3300025938 | Bacteria | 1013 |
| 316 | Ga0207704_10707716 | 3300025938 | Unclassified | 834 |
| 317 | Ga0207665_10048683 | 3300025939 | Bacteria | 2846 |
| 318 | Ga0207665_10565550 | 3300025939 | Bacteria | 885 |
| 319 | Ga0207665_10847167 | 3300025939 | Bacteria | 724 |
| 320 | Ga0207691_10339779 | 3300025940 | Bacteria | 1285 |
| 321 | Ga0207691_10419050 | 3300025940 | Bacteria | 1141 |
| 322 | Ga0207691_10555542 | 3300025940 | Bacteria | 973 |
| 323 | Ga0207711_10026433 | 3300025941 | Bacteria | 4870 |
| 324 | Ga0207711_10058386 | 3300025941 | Bacteria | 3320 |
| 325 | Ga0207711_10137892 | 3300025941 | Bacteria | 2192 |
| 326 | Ga0207711_10169022 | 3300025941 | Bacteria | 1983 |
| 327 | Ga0207711_10212107 | 3300025941 | Bacteria | 1769 |
| 328 | Ga0207711_10393563 | 3300025941 | Bacteria | 1287 |
| 329 | Ga0207689_10034411 | 3300025942 | Bacteria | 4209 |
| 330 | Ga0207661_10337766 | 3300025944 | Bacteria | 1357 |
| 331 | Ga0207667_10168529 | 3300025949 | Bacteria | 2251 |
| 332 | Ga0207651_10041000 | 3300025960 | Bacteria | 3069 |
| 333 | Ga0207651_10110459 | 3300025960 | Bacteria | 2062 |
| 334 | Ga0207651_10149189 | 3300025960 | Bacteria | 1818 |
| 335 | Ga0207651_10156204 | 3300025960 | Bacteria | 1782 |
| 336 | Ga0207712_10726235 | 3300025961 | Bacteria | 869 |
| 337 | Ga0207712_11612361 | 3300025961 | Bacteria | 582 |
| 338 | Ga0207668_10076681 | 3300025972 | Bacteria | 2408 |
| 339 | Ga0207668_10092168 | 3300025972 | Bacteria | 2229 |
| 340 | Ga0207668_10098613 | 3300025972 | Bacteria | 2165 |
| 341 | Ga0207640_10114374 | 3300025981 | Bacteria | 1920 |
| 342 | Ga0207658_10276346 | 3300025986 | Bacteria | 1438 |
| 343 | Ga0207658_11054258 | 3300025986 | Bacteria | 742 |
| 344 | Ga0207677_10497170 | 3300026023 | Bacteria | 1054 |
| 345 | Ga0207677_11060195 | 3300026023 | Bacteria | 737 |
| 346 | Ga0207703_10215416 | 3300026035 | Bacteria | 1714 |
| 347 | Ga0207703_10280457 | 3300026035 | Bacteria | 1513 |
| 348 | Ga0207703_10361518 | 3300026035 | Bacteria | 1339 |
| 349 | Ga0207703_11452727 | 3300026035 | Bacteria | 660 |
| 350 | Ga0207639_10543413 | 3300026041 | Bacteria | 1066 |
| 351 | Ga0207708_10105615 | 3300026075 | Bacteria | 2183 |
| 352 | Ga0207708_10328664 | 3300026075 | Bacteria | 1249 |
| 353 | Ga0207702_10262266 | 3300026078 | Bacteria | 1627 |
| 354 | Ga0207641_10752171 | 3300026088 | Bacteria | 962 |
| 355 | Ga0207648_10016724 | 3300026089 | Bacteria | 6693 |
| 356 | Ga0207648_10037722 | 3300026089 | Bacteria | 4256 |
| 357 | Ga0207648_10082760 | 3300026089 | Bacteria | 2799 |
| 358 | Ga0207648_10319166 | 3300026089 | Bacteria | 1396 |
| 359 | Ga0207676_10028142 | 3300026095 | Bacteria | 4195 |
| 360 | Ga0207676_10069079 | 3300026095 | Bacteria | 2828 |
| 361 | Ga0207676_10164224 | 3300026095 | Bacteria | 1927 |
| 362 | Ga0207676_10416489 | 3300026095 | Bacteria | 1259 |
| 363 | Ga0207676_10694427 | 3300026095 | Bacteria | 985 |
| 364 | Ga0207674_10203527 | 3300026116 | Bacteria | 1929 |
| 365 | Ga0207675_100014045 | 3300026118 | Bacteria | 7468 |
| 366 | Ga0207675_100038967 | 3300026118 | Bacteria | 4435 |
| 367 | Ga0207675_100412832 | 3300026118 | Bacteria | 1332 |
| 368 | Ga0207675_100818367 | 3300026118 | Bacteria | 945 |
| 369 | Ga0207683_11447570 | 3300026121 | Bacteria | 635 |
| 370 | Ga0207698_11764993 | 3300026142 | Bacteria | 634 |
| 371 | Ga0209967_1039820 | 3300027364 | Bacteria | 713 |
| 372 | Ga0209970_1014250 | 3300027614 | Bacteria | 1320 |
| 373 | Ga0209813_10100043 | 3300027866 | Bacteria | 985 |
| 374 | Ga0207428_10000034 | 3300027907 | Bacteria | 231306 |
| 375 | Ga0207428_10072788 | 3300027907 | Bacteria | 2697 |
| 376 | Ga0207428_10073024 | 3300027907 | Bacteria | 2692 |
| 377 | Ga0207428_10107542 | 3300027907 | Bacteria | 2149 |
| 378 | Ga0207428_10120374 | 3300027907 | Bacteria | 2013 |
| 379 | Ga0268266_10005896 | 3300028379 | Bacteria | 11335 |
| 380 | Ga0268266_10029767 | 3300028379 | Bacteria | 4639 |
| 381 | Ga0268266_10219488 | 3300028379 | Bacteria | 1747 |
| 382 | Ga0268265_10005520 | 3300028380 | Bacteria | 8630 |
| 383 | Ga0268265_10025303 | 3300028380 | Bacteria | 4210 |
| 384 | Ga0268265_10113738 | 3300028380 | Bacteria | 2215 |
| 385 | Ga0268265_10733702 | 3300028380 | Bacteria | 957 |
| 386 | Ga0268264_10042810 | 3300028381 | Bacteria | 3749 |
| 387 | Ga0268264_10050141 | 3300028381 | Bacteria | 3475 |
| 388 | Ga0268264_10317611 | 3300028381 | Bacteria | 1472 |
| 389 | Ga0268264_11287382 | 3300028381 | Bacteria | 741 |
| 390 | Ga0265338_10656703 | 3300028800 | Bacteria | 726 |
| 391 | Ga0265332_10048353 | 3300031238 | Bacteria | 1830 |
| 392 | Ga0265316_10261546 | 3300031344 | Bacteria | 1269 |
| 393 | Ga0265314_10007579 | 3300031711 | Bacteria | 9400 |
| 394 | Ga0265314_10013729 | 3300031711 | Bacteria | 6530 |
| 395 | Ga0265342_10192479 | 3300031712 | Bacteria | 1112 |
| 396 | Ga0307413_10091526 | 3300031824 | Bacteria | 1982 |
| 397 | Ga0307413_10220584 | 3300031824 | Bacteria | 1385 |
| 398 | Ga0307413_10391449 | 3300031824 | Bacteria | 1086 |
| 399 | Ga0307412_10843067 | 3300031911 | Bacteria | 799 |
| 400 | Ga0307416_100160347 | 3300032002 | Bacteria | 2078 |
| 401 | Ga0307416_100512333 | 3300032002 | Bacteria | 1266 |
| 402 | Ga0307416_100922927 | 3300032002 | Bacteria | 974 |
| 403 | Ga0307411_10170887 | 3300032005 | Bacteria | 1639 |
| 404 | Ga0307411_10594306 | 3300032005 | Bacteria | 951 |
| 405 | Ga0373930_0002995 | 3300034816 | Bacteria | 2656 |
| 406 | Ga0373948_0001483 | 3300034817 | Bacteria | 3266 |
| 407 | Ga0373958_0000045 | 3300034819 | Bacteria | 12165 |
| 408 | Ga0373959_0001151 | 3300034820 | Bacteria | 4278 |
| 409 | Ga0373938_0000418 | 3300034957 | Bacteria | 6847 |
| 410 | Ga0373928_0001212 | 3300035084 | Bacteria | 5090 |
| 411 | Ga0373929_0000116 | 3300035085 | Bacteria | 13311 |
| 412 | Ga0373940_0000084 | 3300035088 | Bacteria | 11367 |
| 413 | Ga0373944_0043759 | 3300035089 | Bacteria | 1392 |
| 414 | Ga0373944_0073733 | 3300035089 | Bacteria | 1116 |
| 415 | Ga0373944_0224850 | 3300035089 | Bacteria | 686 |
| 416 | Ga0373949_0000597 | 3300035090 | Bacteria | 11806 |
| 417 | Ga0373949_0033224 | 3300035090 | Bacteria | 1239 |
| 418 | Ga0373951_0001673 | 3300035091 | Bacteria | 5805 |
| 419 | Ga0373952_0001387 | 3300035092 | Bacteria | 4428 |
| 420 | Ga0373932_0006095 | 3300035112 | Bacteria | 2845 |
| 421 | Ga0373936_0092396 | 3300035113 | Bacteria | 1270 |
| 422 | Ga0373936_0346338 | 3300035113 | Bacteria | 676 |
| 423 | Ga0373939_0001888 | 3300035114 | Bacteria | 5012 |
| 424 | Ga0373939_0031755 | 3300035114 | Bacteria | 1529 |
| 425 | Ga0373939_0107081 | 3300035114 | Bacteria | 968 |
| 426 | Ga0373941_0000161 | 3300035115 | Bacteria | 12224 |
| 427 | Ga0373945_0056786 | 3300035116 | Bacteria | 1453 |
| 428 | Ga0373953_0044678 | 3300035117 | Bacteria | 1772 |
| 429 | Ga0373953_0132653 | 3300035117 | Bacteria | 1063 |
| 430 | Ga0373956_0208787 | 3300035119 | Bacteria | 926 |
| 431 | Ga0373957_0061355 | 3300035120 | Bacteria | 1457 |
| 432 | Ga0373960_0001448 | 3300035121 | Bacteria | 5252 |
| 433 | Ga0373943_0571512 | 3300035170 | Bacteria | 664 |
| 434 | Ga0373946_0369495 | 3300035171 | Bacteria | 720 |
| 435 | Ga0373955_0047351 | 3300035172 | Bacteria | 2328 |
| 436 | Ga0373955_0059904 | 3300035172 | Bacteria | 2098 |
| 437 | Ga0373955_0171915 | 3300035172 | Bacteria | 1283 |
| 438 | Ga0373955_0273145 | 3300035172 | Bacteria | 1016 |
| 439 | Ga0373942_0001757 | 3300035207 | Bacteria | 5486 |
| 440 | Ga0373961_0001591 | 3300035241 | Bacteria | 6457 |
| 441 | Ga0373961_0111475 | 3300035241 | Bacteria | 897 |
| 442 | Ga0373962_0000245 | 3300035242 | Bacteria | 11519 |
| 443 | Ga0373924_0173653 | 3300035410 | Bacteria | 947 |
| 444 | Ga0373931_0009494 | 3300035691 | Bacteria | 4653 |
| 445 | Ga0373931_0169020 | 3300035691 | Bacteria | 1287 |
| 446 | Ga0373935_0087624 | 3300035692 | Bacteria | 2033 |
| 447 | Ga0373935_1067504 | 3300035692 | Bacteria | 601 |
| 448 | Ga0373927_0199653 | 3300035695 | Bacteria | 1313 |
| 449 | Ga0373947_0085310 | 3300035725 | Bacteria | 1961 |
| 450 | Ga0373937_0055553 | 3300036401 | Bacteria | 3635 |
| 451 | Ga0373937_0139222 | 3300036401 | Bacteria | 2270 |
| 452 | Ga0373937_0170677 | 3300036401 | Bacteria | 2041 |
| 453 | Ga0373937_0356987 | 3300036401 | Bacteria | 1385 |
| 454 | Ga0373925_0160073 | 3300037068 | Bacteria | 1773 |
| 455 | Ga0373925_0251097 | 3300037068 | Bacteria | 1419 |
| 456 | Ga0373925_0281546 | 3300037068 | Bacteria | 1339 |
| 457 | Ga0373925_0545741 | 3300037068 | Bacteria | 953 |
| 458 | Ga0436362_0941488 | 3300039453 | Bacteria | 849 |
| 459 | Ga0451839_1310317 | 3300041496 | Bacteria | 642 |
| 460 | Ga0450920_048426 | 3300042122 | Bacteria | 851 |
| 461 | Ga0450920_056922 | 3300042122 | Bacteria | 788 |
| 462 | Ga0439446_0031821 | 3300042156 | Bacteria | 1528 |
| 463 | Ga0439446_0172916 | 3300042156 | Bacteria | 719 |
| 464 | Ga0439460_0019860 | 3300042461 | Bacteria | 1823 |
| 465 | Ga0450916_000502 | 3300042530 | Bacteria | 3425 |
| 466 | Ga0466963_0109939 | 3300044694 | Bacteria | 1891 |
| 467 | Ga0453684_0121001 | 3300044712 | Bacteria | 3161 |
| 468 | Ga0451576_0071334 | 3300045051 | Bacteria | 3615 |
| 469 | Ga0451576_0277902 | 3300045051 | Bacteria | 1751 |
| 470 | Ga0451576_1037898 | 3300045051 | Bacteria | 859 |
| 471 | Ga0451576_1823096 | 3300045051 | Bacteria | 629 |
| 472 | Ga0495592_0087298 | 3300046454 | Bacteria | 2244 |
| 473 | Ga0495603_0056649 | 3300046455 | Bacteria | 2320 |
| 474 | Ga0495603_0297709 | 3300046455 | Bacteria | 926 |
| 475 | Ga0495603_0566865 | 3300046455 | Bacteria | 650 |
| 476 | Ga0495629_0108936 | 3300046459 | Bacteria | 1932 |
| 477 | Ga0495641_0068787 | 3300046461 | Bacteria | 1592 |
| 478 | Ga0495651_0599107 | 3300046462 | Bacteria | 695 |
| 479 | Ga0495653_0159656 | 3300046463 | Bacteria | 1566 |
| 480 | Ga0495653_0252550 | 3300046463 | Bacteria | 1170 |
| 481 | Ga0495582_0041828 | 3300046473 | Bacteria | 2525 |
| 482 | Ga0495582_0422807 | 3300046473 | Bacteria | 769 |
| 483 | Ga0495582_0606613 | 3300046473 | Bacteria | 633 |
| 484 | Ga0495639_0206318 | 3300046475 | Bacteria | 963 |
| 485 | Ga0495639_0395149 | 3300046475 | Bacteria | 698 |
| 486 | Ga0495607_0238917 | 3300046501 | Bacteria | 880 |
| 487 | Ga0495608_0039741 | 3300046511 | Bacteria | 3152 |
| 488 | Ga0495608_0213098 | 3300046511 | Bacteria | 1214 |
| 489 | Ga0495610_0116527 | 3300046512 | Bacteria | 1177 |
| 490 | Ga0495628_0154047 | 3300046516 | Bacteria | 1749 |
| 491 | Ga0495628_0162934 | 3300046516 | Bacteria | 1694 |
| 492 | Ga0495628_0203404 | 3300046516 | Bacteria | 1491 |
| 493 | Ga0495630_0010900 | 3300046517 | Bacteria | 6565 |
| 494 | Ga0495630_0318966 | 3300046517 | Bacteria | 1188 |
| 495 | Ga0495630_0406660 | 3300046517 | Bacteria | 1043 |
| 496 | Ga0495666_0192761 | 3300046526 | Bacteria | 939 |
| 497 | Ga0495652_0401588 | 3300046529 | Bacteria | 970 |
| 498 | Ga0495640_0332366 | 3300046533 | Bacteria | 940 |
| 499 | Ga0495640_0593247 | 3300046533 | Bacteria | 669 |
| 500 | Ga0495587_0053831 | 3300046536 | Bacteria | 2372 |
| 501 | Ga0495587_0368436 | 3300046536 | Bacteria | 800 |
| 502 | Ga0495598_0209738 | 3300046537 | Bacteria | 707 |
| 503 | Ga0495645_0004427 | 3300046543 | Bacteria | 9593 |
| 504 | Ga0495656_0119836 | 3300046615 | Bacteria | 1241 |
| 505 | Ga0495656_0287918 | 3300046615 | Bacteria | 839 |
| 506 | Ga0495634_0280130 | 3300046642 | Bacteria | 1013 |
| 507 | Ga0495611_0179280 | 3300046648 | Bacteria | 990 |
| 508 | Ga0495635_0471561 | 3300046663 | Bacteria | 828 |
| 509 | Ga0495657_0047275 | 3300046675 | Bacteria | 2910 |
| 510 | Ga0495599_0110128 | 3300046678 | Bacteria | 1716 |
| 511 | Ga0495599_0240460 | 3300046678 | Bacteria | 1104 |
| 512 | Ga0495647_0024667 | 3300046681 | Bacteria | 2191 |
| 513 | Ga0495647_0029173 | 3300046681 | Bacteria | 2039 |
| 514 | Ga0495647_0031489 | 3300046681 | Bacteria | 1973 |
| 515 | Ga0495647_0187512 | 3300046681 | Bacteria | 902 |
| 516 | Ga0495658_0046802 | 3300046683 | Bacteria | 2433 |
| 517 | Ga0495658_0063955 | 3300046683 | Bacteria | 2118 |
| 518 | Ga0495669_0134426 | 3300046684 | Bacteria | 1165 |
| 519 | Ga0495613_0013985 | 3300046689 | Bacteria | 5957 |
| 520 | Ga0495613_0199781 | 3300046689 | Bacteria | 1410 |
| 521 | Ga0495613_0202812 | 3300046689 | Bacteria | 1398 |
| 522 | Ga0495624_0143899 | 3300046690 | Bacteria | 1460 |
| 523 | Ga0495670_0317137 | 3300046691 | Bacteria | 837 |
| 524 | Ga0495670_0481795 | 3300046691 | Bacteria | 673 |
| 525 | Ga0495600_0293614 | 3300046809 | Bacteria | 1027 |
| 526 | Ga0495600_0488459 | 3300046809 | Bacteria | 758 |
| 527 | Ga0495600_0494407 | 3300046809 | Bacteria | 752 |
| 528 | Ga0495581_0450625 | 3300047315 | Bacteria | 749 |
| 529 | Ga0495604_0039449 | 3300047317 | Bacteria | 3711 |
| 530 | Ga0495604_0115887 | 3300047317 | Bacteria | 1946 |
| 531 | Ga0495674_0044746 | 3300047319 | Bacteria | 3934 |
| 532 | Ga0495674_0130151 | 3300047319 | Bacteria | 2120 |
| 533 | Ga0495680_0155995 | 3300047322 | Bacteria | 1660 |
| 534 | Ga0495680_0180664 | 3300047322 | Bacteria | 1523 |
| 535 | Ga0495680_0290614 | 3300047322 | Bacteria | 1150 |
| 536 | Ga0495675_0369920 | 3300047444 | Bacteria | 840 |
| 537 | Ga0495684_0001687 | 3300047471 | Bacteria | 17745 |
| 538 | Ga0495684_0073724 | 3300047471 | Bacteria | 2593 |
| 539 | Ga0495602_0306123 | 3300048088 | Bacteria | 1161 |
| 540 | Ga0496100_0004796 | 3300048903 | Bacteria | 7222 |
| 541 | Ga0496100_0149902 | 3300048903 | Bacteria | 1662 |
| 542 | Ga0496101_0000396 | 3300048904 | Bacteria | 28444 |
| 543 | Ga0496102_0213093 | 3300048905 | Bacteria | 1821 |
| 544 | Ga0496102_0267652 | 3300048905 | Bacteria | 1611 |
| 545 | Ga0496102_0404817 | 3300048905 | Bacteria | 1283 |
| 546 | Ga0496102_0457266 | 3300048905 | Bacteria | 1197 |
| 547 | Ga0496103_0584234 | 3300048906 | Bacteria | 712 |
| 548 | Ga0496104_0017385 | 3300048907 | Bacteria | 6549 |
| 549 | Ga0496104_0021813 | 3300048907 | Bacteria | 5883 |
| 550 | Ga0496104_0083357 | 3300048907 | Bacteria | 3049 |
| 551 | Ga0496104_0354243 | 3300048907 | Bacteria | 1380 |
| 552 | Ga0496104_0368628 | 3300048907 | Bacteria | 1349 |
| 553 | Ga0496105_0090691 | 3300048908 | Bacteria | 2524 |
| 554 | Ga0496105_0124564 | 3300048908 | Bacteria | 2124 |
| 555 | Ga0496106_0311109 | 3300048909 | Bacteria | 1264 |
| 556 | Ga0496107_0031098 | 3300048910 | Bacteria | 3807 |
| 557 | Ga0496107_0104604 | 3300048910 | Bacteria | 2078 |
| 558 | Ga0496108_0011060 | 3300048911 | Bacteria | 7328 |
| 559 | Ga0496108_0310386 | 3300048911 | Bacteria | 1374 |
| 560 | Ga0496109_0151382 | 3300048912 | Bacteria | 2172 |
| 561 | Ga0496109_0191312 | 3300048912 | Bacteria | 1923 |
| 562 | Ga0496110_0157481 | 3300048913 | Bacteria | 2058 |
| 563 | Ga0496110_0399484 | 3300048913 | Bacteria | 1253 |
| 564 | Ga0496110_1004039 | 3300048913 | Bacteria | 742 |
| 565 | Ga0496111_0549294 | 3300048914 | Bacteria | 848 |
| 566 | Ga0496112_0016237 | 3300048915 | Bacteria | 6967 |
| 567 | Ga0496112_0055326 | 3300048915 | Bacteria | 3901 |
| 568 | Ga0496112_0199485 | 3300048915 | Bacteria | 1961 |
| 569 | Ga0496112_0394138 | 3300048915 | Bacteria | 1325 |
| 570 | Ga0496112_0745016 | 3300048915 | Bacteria | 906 |
| 571 | Ga0496113_0032056 | 3300048916 | Bacteria | 3817 |
| 572 | Ga0496114_0000246 | 3300048917 | Bacteria | 39480 |
| 573 | Ga0496114_0013645 | 3300048917 | Bacteria | 6514 |
| 574 | Ga0496114_0172098 | 3300048917 | Bacteria | 1888 |
| 575 | Ga0496114_0259315 | 3300048917 | Bacteria | 1530 |
| 576 | Ga0496114_0333337 | 3300048917 | Bacteria | 1341 |
| 577 | Ga0496114_0489114 | 3300048917 | Bacteria | 1088 |
| 578 | Ga0496115_0383448 | 3300048918 | Bacteria | 1143 |
| 579 | Ga0496115_0513647 | 3300048918 | Bacteria | 961 |
| 580 | Ga0495682_0101315 | 3300049460 | Bacteria | 1033 |
| 581 | Ga0501318_058812 | 3300049534 | Bacteria | 586 |
| 582 | Ga0501034_0077055 | 3300049571 | Bacteria | 3340 |
| 583 | Ga0501034_0108508 | 3300049571 | Bacteria | 2767 |
| 584 | Ga0501036_0997737 | 3300049572 | Bacteria | 685 |
| 585 | Ga0501038_0525123 | 3300049574 | Bacteria | 903 |
| 586 | Ga0501039_0924243 | 3300049575 | Bacteria | 679 |
| 587 | Ga0501041_0273442 | 3300049577 | Bacteria | 1063 |
| 588 | Ga0501042_1188518 | 3300049578 | Bacteria | 556 |
| 589 | Ga0501043_0067123 | 3300049579 | Bacteria | 2817 |
| 590 | Ga0501047_0015370 | 3300049581 | Bacteria | 7290 |
| 591 | Ga0501047_0399559 | 3300049581 | Bacteria | 1207 |
| 592 | Ga0501048_0193859 | 3300049582 | Bacteria | 1440 |
| 593 | Ga0501068_0172060 | 3300049584 | Bacteria | 1367 |
| 594 | Ga0501070_0443810 | 3300049586 | Bacteria | 1047 |
| 595 | Ga0501072_0531812 | 3300049588 | Bacteria | 929 |
| 596 | Ga0501073_0177565 | 3300049589 | Bacteria | 1474 |
| 597 | Ga0501076_0161703 | 3300049592 | Bacteria | 1824 |
| 598 | Ga0501080_0958755 | 3300049742 | Bacteria | 743 |
| 599 | Ga0501081_0126226 | 3300049743 | Bacteria | 1825 |
| 600 | Ga0501083_0137210 | 3300049744 | Bacteria | 1602 |
| 601 | Ga0501044_0003452 | 3300049823 | Bacteria | 17800 |
| 602 | Ga0501045_0482481 | 3300049824 | Bacteria | 921 |
| 603 | nmdc:mga00v17_169418_c1 | 3300050491 | Bacteria | 1408 |
| 604 | nmdc:mga0k408_227432_c1 | 3300050493 | Bacteria | 1114 |
| 605 | nmdc:mga06z11_310287_c1 | 3300050494 | Bacteria | 939 |
| 606 | nmdc:mga06z11_54011_c1 | 3300050494 | Bacteria | 2069 |
| 607 | nmdc:mga04h51_118064_c1 | 3300050495 | Bacteria | 985 |
| 608 | nmdc:mga05p37_119480_c1 | 3300050507 | Bacteria | 3238 |
| 609 | nmdc:mga05p37_260703_c1 | 3300050507 | Bacteria | 2075 |
| 610 | nmdc:mga05p37_361676_c1 | 3300050507 | Bacteria | 1706 |
| 611 | nmdc:mga05p37_403716_c1 | 3300050507 | Bacteria | 1595 |
| 612 | nmdc:mga05p37_411029_c1 | 3300050507 | Bacteria | 1577 |
| 613 | nmdc:mga05p37_416605_c1 | 3300050507 | Bacteria | 1564 |
| 614 | nmdc:mga05p37_6561_c1 | 3300050507 | Bacteria | 13712 |
| 615 | nmdc:mga09592_112102_c1 | 3300050508 | Bacteria | 2340 |
| 616 | nmdc:mga0qj67_297758_c1 | 3300050509 | Bacteria | 1307 |
| 617 | nmdc:mga0qj67_786687_c1 | 3300050509 | Bacteria | 754 |
| 618 | nmdc:mga06r32_45742_c1 | 3300050510 | Bacteria | 4173 |
| 619 | nmdc:mga06r32_490383_c1 | 3300050510 | Bacteria | 1206 |
| 620 | nmdc:mga08y16_1091636_c1 | 3300050511 | Bacteria | 773 |
| 621 | nmdc:mga08y16_10_c1 | 3300050511 | Bacteria | 470512 |
| 622 | nmdc:mga08y16_1463818_c1 | 3300050511 | Bacteria | 644 |
| 623 | nmdc:mga08y16_16207_c1 | 3300050511 | Bacteria | 7835 |
| 624 | nmdc:mga08y16_20665_c1 | 3300050511 | Bacteria | 6949 |
| 625 | nmdc:mga08y16_95418_c1 | 3300050511 | Bacteria | 3098 |
| 626 | nmdc:mga0n895_12982_c1 | 3300050512 | Bacteria | 4790 |
| 627 | nmdc:mga0n895_17757_c1 | 3300050512 | Bacteria | 6566 |
| 628 | nmdc:mga0n895_24421_c1 | 3300050512 | Bacteria | 5697 |
| 629 | nmdc:mga0n895_27160_c1 | 3300050512 | Bacteria | 5435 |
| 630 | nmdc:mga0n895_449050_c1 | 3300050512 | Bacteria | 1302 |
| 631 | nmdc:mga0n895_490768_c1 | 3300050512 | Bacteria | 1238 |
| 632 | nmdc:mga0n895_7101_c1 | 3300050512 | Bacteria | 9574 |
| 633 | nmdc:mga0n895_957514_c1 | 3300050512 | Bacteria | 839 |
| 634 | nmdc:mga0rr50_140171_c1 | 3300050513 | Bacteria | 1945 |
| 635 | nmdc:mga0rr50_1773_c1 | 3300050513 | Bacteria | 11923 |
| 636 | nmdc:mga0rr50_2205_c1 | 3300050513 | Bacteria | 10927 |
| 637 | nmdc:mga0rr50_373_c1 | 3300050513 | Bacteria | 24506 |
| 638 | nmdc:mga0rr50_40661_c1 | 3300050513 | Bacteria | 3382 |
| 639 | nmdc:mga0rr50_435801_c1 | 3300050513 | Bacteria | 1110 |
| 640 | nmdc:mga08x19_10007_c1 | 3300050514 | Bacteria | 5684 |
| 641 | nmdc:mga08x19_189510_c1 | 3300050514 | Bacteria | 1407 |
| 642 | nmdc:mga08x19_441276_c1 | 3300050514 | Bacteria | 916 |
| 643 | nmdc:mga08x19_79203_c1 | 3300050514 | Bacteria | 2155 |
| 644 | nmdc:mga0a205_10346_c1 | 3300050515 | Bacteria | 8575 |
| 645 | nmdc:mga0a205_14317_c1 | 3300050515 | Bacteria | 7396 |
| 646 | nmdc:mga0a205_162299_c1 | 3300050515 | Bacteria | 2131 |
| 647 | nmdc:mga0a205_193005_c1 | 3300050515 | Bacteria | 1928 |
| 648 | nmdc:mga0a205_255698_c1 | 3300050515 | Bacteria | 1630 |
| 649 | nmdc:mga0a205_616154_c1 | 3300050515 | Bacteria | 938 |
| 650 | nmdc:mga0a205_6655_c1 | 3300050515 | Bacteria | 10458 |
| 651 | Ga0495601_0040645 | 3300053077 | Bacteria | 2913 |
| 652 | Ga0495601_0073947 | 3300053077 | Bacteria | 2180 |
| 653 | Ga0495601_0179517 | 3300053077 | Bacteria | 1384 |
| 654 | Ga0495612_0184035 | 3300053078 | Bacteria | 918 |
| 655 | Ga0495612_0206914 | 3300053078 | Bacteria | 867 |
| 656 | Ga0495595_0015689 | 3300053084 | Bacteria | 3233 |
| 657 | Ga0495595_0015791 | 3300053084 | Bacteria | 3224 |
| 658 | Ga0495595_0099791 | 3300053084 | Bacteria | 1400 |
| 659 | Ga0495595_0246585 | 3300053084 | Bacteria | 894 |
| 660 | Ga0495595_0247835 | 3300053084 | Bacteria | 892 |
| 661 | Ga0495619_0076292 | 3300053085 | Bacteria | 2250 |
| 662 | Ga0495619_0163154 | 3300053085 | Bacteria | 1539 |
| 663 | Ga0500555_000474 | 3300053103 | Bacteria | 16656 |
| 664 | Ga0500556_0001889 | 3300053104 | Bacteria | 7496 |
| 665 | Ga0500658_0026256 | 3300053134 | Bacteria | 2243 |
| 666 | Ga0500568_0002524 | 3300053139 | Bacteria | 10698 |
| 667 | Ga0500616_0000173 | 3300053153 | Bacteria | 107646 |
| 668 | Ga0500627_0271257 | 3300053158 | Bacteria | 747 |
| 669 | Ga0590071_010704 | 3300059421 | Bacteria | 2145 |
| 670 | Ga0590075_059940 | 3300059424 | Bacteria | 980 |
| 671 | Ga0501082_0139167 | 3300060353 | Bacteria | 2107 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005441 | Ga0070700_100432017 | Ga0070700_1004320172 | 147 |
| 2 | 3300005457 | Ga0070662_100496398 | Ga0070662_1004963982 | 147 |
| 3 | 3300005471 | Ga0070698_100183947 | Ga0070698_1001839472 | 147 |
| 4 | 3300005546 | Ga0070696_100133503 | Ga0070696_1001335031 | 147 |
| 5 | 3300005546 | Ga0070696_100184966 | Ga0070696_1001849662 | 147 |
| 6 | 3300005617 | Ga0068859_100700495 | Ga0068859_1007004952 | 147 |
| 7 | 3300005719 | Ga0068861_101645756 | Ga0068861_1016457562 | 147 |
| 8 | 3300005842 | Ga0068858_100524546 | Ga0068858_1005245462 | 147 |
| 9 | 3300006931 | Ga0097620_100700471 | Ga0097620_1007004712 | 147 |
| 10 | 3300009148 | Ga0105243_10054004 | Ga0105243_100540046 | 147 |
| 11 | 3300009553 | Ga0105249_10455911 | Ga0105249_104559112 | 147 |
| 12 | 3300025899 | Ga0207642_10054168 | Ga0207642_100541684 | 147 |
| 13 | 3300025931 | Ga0207644_11023801 | Ga0207644_110238012 | 147 |
| 14 | 3300025933 | Ga0207706_10450722 | Ga0207706_104507223 | 147 |
| 15 | 3300025934 | Ga0207686_10160445 | Ga0207686_101604453 | 147 |
| 16 | 3300025938 | Ga0207704_10464569 | Ga0207704_104645692 | 147 |
| 17 | 3300025961 | Ga0207712_10726235 | Ga0207712_107262352 | 147 |
| 18 | 3300025972 | Ga0207668_10076681 | Ga0207668_100766814 | 147 |
| 19 | 3300026035 | Ga0207703_10361518 | Ga0207703_103615182 | 147 |
| 20 | 3300026118 | Ga0207675_100014045 | Ga0207675_10001404514 | 147 |
| 21 | 3300028380 | Ga0268265_10025303 | Ga0268265_100253035 | 147 |
| 22 | 3300048909 | Ga0496106_0311109 | Ga0496106_0311109_719_1237 | 147 |
| 23 | 3300025899 | Ga0207642_10948925 | Ga0207642_109489251 | 148 |
| 24 | 3300005347 | Ga0070668_100489968 | Ga0070668_1004899683 | 150 |
| 25 | 3300005438 | Ga0070701_10205854 | Ga0070701_102058543 | 150 |
| 26 | 3300005719 | Ga0068861_100463764 | Ga0068861_1004637643 | 150 |
| 27 | 3300005842 | Ga0068858_100189424 | Ga0068858_1001894243 | 150 |
| 28 | 3300005842 | Ga0068858_101641368 | Ga0068858_1016413681 | 150 |
| 29 | 3300005844 | Ga0068862_100109135 | Ga0068862_1001091355 | 150 |
| 30 | 3300006058 | Ga0075432_10185114 | Ga0075432_101851141 | 150 |
| 31 | 3300006844 | Ga0075428_100319068 | Ga0075428_1003190683 | 150 |
| 32 | 3300006847 | Ga0075431_100598368 | Ga0075431_1005983682 | 150 |
| 33 | 3300009101 | Ga0105247_10511839 | Ga0105247_105118391 | 150 |
| 34 | 3300009147 | Ga0114129_10017270 | Ga0114129_100172705 | 150 |
| 35 | 3300009147 | Ga0114129_10118442 | Ga0114129_101184426 | 150 |
| 36 | 3300009177 | Ga0105248_10404784 | Ga0105248_104047841 | 150 |
| 37 | 3300014326 | Ga0157380_10190699 | Ga0157380_101906993 | 150 |
| 38 | 3300014968 | Ga0157379_11038565 | Ga0157379_110385652 | 150 |
| 39 | 3300027364 | Ga0209967_1039820 | Ga0209967_10398202 | 150 |
| 40 | 3300005290 | Ga0065712_10033738 | Ga0065712_100337382 | 151 |
| 41 | 3300005293 | Ga0065715_10238277 | Ga0065715_102382772 | 151 |
| 42 | 3300005295 | Ga0065707_10519979 | Ga0065707_105199791 | 151 |
| 43 | 3300005327 | Ga0070658_10302065 | Ga0070658_103020653 | 151 |
| 44 | 3300005328 | Ga0070676_10100742 | Ga0070676_101007423 | 151 |
| 45 | 3300005328 | Ga0070676_10285363 | Ga0070676_102853632 | 151 |
| 46 | 3300005329 | Ga0070683_100763243 | Ga0070683_1007632432 | 151 |
| 47 | 3300005331 | Ga0070670_100280626 | Ga0070670_1002806263 | 151 |
| 48 | 3300005331 | Ga0070670_100596116 | Ga0070670_1005961162 | 151 |
| 49 | 3300005333 | Ga0070677_10104469 | Ga0070677_101044693 | 151 |
| 50 | 3300005335 | Ga0070666_10051882 | Ga0070666_100518824 | 151 |
| 51 | 3300005335 | Ga0070666_10212816 | Ga0070666_102128163 | 151 |
| 52 | 3300005338 | Ga0068868_100055137 | Ga0068868_1000551374 | 151 |
| 53 | 3300005338 | Ga0068868_100553795 | Ga0068868_1005537952 | 151 |
| 54 | 3300005338 | Ga0068868_100887592 | Ga0068868_1008875921 | 151 |
| 55 | 3300005339 | Ga0070660_100520246 | Ga0070660_1005202462 | 151 |
| 56 | 3300005340 | Ga0070689_100460205 | Ga0070689_1004602052 | 151 |
| 57 | 3300005354 | Ga0070675_100000056 | Ga0070675_10000005628 | 151 |
| 58 | 3300005354 | Ga0070675_100029203 | Ga0070675_1000292036 | 151 |
| 59 | 3300005354 | Ga0070675_100546245 | Ga0070675_1005462452 | 151 |
| 60 | 3300005354 | Ga0070675_100735796 | Ga0070675_1007357962 | 151 |
| 61 | 3300005356 | Ga0070674_100007417 | Ga0070674_1000074174 | 151 |
| 62 | 3300005356 | Ga0070674_100046049 | Ga0070674_1000460496 | 151 |
| 63 | 3300005356 | Ga0070674_100078891 | Ga0070674_1000788912 | 151 |
| 64 | 3300005356 | Ga0070674_100192253 | Ga0070674_1001922534 | 151 |
| 65 | 3300005364 | Ga0070673_100003427 | Ga0070673_1000034278 | 151 |
| 66 | 3300005364 | Ga0070673_100043981 | Ga0070673_1000439814 | 151 |
| 67 | 3300005367 | Ga0070667_100165408 | Ga0070667_1001654083 | 151 |
| 68 | 3300005367 | Ga0070667_100168474 | Ga0070667_1001684744 | 151 |
| 69 | 3300005367 | Ga0070667_100643276 | Ga0070667_1006432762 | 151 |
| 70 | 3300005435 | Ga0070714_100050502 | Ga0070714_1000505024 | 151 |
| 71 | 3300005439 | Ga0070711_100592938 | Ga0070711_1005929382 | 151 |
| 72 | 3300005440 | Ga0070705_100573723 | Ga0070705_1005737232 | 151 |
| 73 | 3300005444 | Ga0070694_100016422 | Ga0070694_1000164223 | 151 |
| 74 | 3300005445 | Ga0070708_100055234 | Ga0070708_1000552343 | 151 |
| 75 | 3300005455 | Ga0070663_100654247 | Ga0070663_1006542472 | 151 |
| 76 | 3300005456 | Ga0070678_100092251 | Ga0070678_1000922515 | 151 |
| 77 | 3300005458 | Ga0070681_10042357 | Ga0070681_100423572 | 151 |
| 78 | 3300005458 | Ga0070681_10348644 | Ga0070681_103486442 | 151 |
| 79 | 3300005459 | Ga0068867_100041777 | Ga0068867_1000417773 | 151 |
| 80 | 3300005459 | Ga0068867_100073877 | Ga0068867_1000738774 | 151 |
| 81 | 3300005459 | Ga0068867_100513996 | Ga0068867_1005139962 | 151 |
| 82 | 3300005459 | Ga0068867_100588601 | Ga0068867_1005886012 | 151 |
| 83 | 3300005459 | Ga0068867_100816926 | Ga0068867_1008169262 | 151 |
| 84 | 3300005467 | Ga0070706_100556565 | Ga0070706_1005565652 | 151 |
| 85 | 3300005468 | Ga0070707_100125461 | Ga0070707_1001254616 | 151 |
| 86 | 3300005468 | Ga0070707_100175008 | Ga0070707_1001750084 | 151 |
| 87 | 3300005471 | Ga0070698_100034124 | Ga0070698_1000341243 | 151 |
| 88 | 3300005518 | Ga0070699_100119032 | Ga0070699_1001190323 | 151 |
| 89 | 3300005535 | Ga0070684_100744697 | Ga0070684_1007446972 | 151 |
| 90 | 3300005536 | Ga0070697_100193729 | Ga0070697_1001937293 | 151 |
| 91 | 3300005543 | Ga0070672_100417490 | Ga0070672_1004174903 | 151 |
| 92 | 3300005544 | Ga0070686_100024325 | Ga0070686_1000243253 | 151 |
| 93 | 3300005545 | Ga0070695_100063603 | Ga0070695_1000636033 | 151 |
| 94 | 3300005545 | Ga0070695_100169060 | Ga0070695_1001690602 | 151 |
| 95 | 3300005546 | Ga0070696_100145121 | Ga0070696_1001451213 | 151 |
| 96 | 3300005546 | Ga0070696_100694764 | Ga0070696_1006947642 | 151 |
| 97 | 3300005547 | Ga0070693_100512486 | Ga0070693_1005124862 | 151 |
| 98 | 3300005548 | Ga0070665_100004733 | Ga0070665_10000473311 | 151 |
| 99 | 3300005548 | Ga0070665_100005447 | Ga0070665_1000054473 | 151 |
| 100 | 3300005548 | Ga0070665_100010437 | Ga0070665_1000104375 | 151 |
| 101 | 3300005549 | Ga0070704_100096664 | Ga0070704_1000966643 | 151 |
| 102 | 3300005549 | Ga0070704_100355660 | Ga0070704_1003556601 | 151 |
| 103 | 3300005549 | Ga0070704_100462367 | Ga0070704_1004623672 | 151 |
| 104 | 3300005564 | Ga0070664_100563231 | Ga0070664_1005632312 | 151 |
| 105 | 3300005578 | Ga0068854_100177554 | Ga0068854_1001775543 | 151 |
| 106 | 3300005617 | Ga0068859_100168307 | Ga0068859_1001683073 | 151 |
| 107 | 3300005618 | Ga0068864_100075695 | Ga0068864_1000756957 | 151 |
| 108 | 3300005718 | Ga0068866_10332190 | Ga0068866_103321902 | 151 |
| 109 | 3300005841 | Ga0068863_100116801 | Ga0068863_1001168015 | 151 |
| 110 | 3300005842 | Ga0068858_100001254 | Ga0068858_10000125427 | 151 |
| 111 | 3300005842 | Ga0068858_100008638 | Ga0068858_10000863814 | 151 |
| 112 | 3300005842 | Ga0068858_101016433 | Ga0068858_1010164331 | 151 |
| 113 | 3300005843 | Ga0068860_100123715 | Ga0068860_1001237153 | 151 |
| 114 | 3300005843 | Ga0068860_100304196 | Ga0068860_1003041962 | 151 |
| 115 | 3300005843 | Ga0068860_100304719 | Ga0068860_1003047193 | 151 |
| 116 | 3300005843 | Ga0068860_100534033 | Ga0068860_1005340333 | 151 |
| 117 | 3300005844 | Ga0068862_100110658 | Ga0068862_1001106583 | 151 |
| 118 | 3300005937 | Ga0081455_10174261 | Ga0081455_101742613 | 151 |
| 119 | 3300005937 | Ga0081455_10345681 | Ga0081455_103456813 | 151 |
| 120 | 3300005983 | Ga0081540_1096511 | Ga0081540_10965112 | 151 |
| 121 | 3300005985 | Ga0081539_10100098 | Ga0081539_101000983 | 151 |
| 122 | 3300005985 | Ga0081539_10197007 | Ga0081539_101970072 | 151 |
| 123 | 3300006042 | Ga0075368_10004958 | Ga0075368_100049583 | 151 |
| 124 | 3300006173 | Ga0070716_100341366 | Ga0070716_1003413662 | 151 |
| 125 | 3300006178 | Ga0075367_10028961 | Ga0075367_100289614 | 151 |
| 126 | 3300006178 | Ga0075367_10258480 | Ga0075367_102584803 | 151 |
| 127 | 3300006237 | Ga0097621_100006061 | Ga0097621_10000606114 | 151 |
| 128 | 3300006237 | Ga0097621_100118810 | Ga0097621_1001188102 | 151 |
| 129 | 3300006358 | Ga0068871_100006055 | Ga0068871_1000060559 | 151 |
| 130 | 3300006358 | Ga0068871_100075510 | Ga0068871_1000755104 | 151 |
| 131 | 3300006844 | Ga0075428_100000009 | Ga0075428_100000009203 | 151 |
| 132 | 3300006844 | Ga0075428_100312003 | Ga0075428_1003120034 | 151 |
| 133 | 3300006846 | Ga0075430_100105326 | Ga0075430_1001053262 | 151 |
| 134 | 3300006847 | Ga0075431_100261523 | Ga0075431_1002615232 | 151 |
| 135 | 3300006852 | Ga0075433_10100150 | Ga0075433_101001506 | 151 |
| 136 | 3300006852 | Ga0075433_10128181 | Ga0075433_101281814 | 151 |
| 137 | 3300006852 | Ga0075433_10616820 | Ga0075433_106168202 | 151 |
| 138 | 3300006871 | Ga0075434_100069571 | Ga0075434_1000695712 | 151 |
| 139 | 3300006871 | Ga0075434_100109389 | Ga0075434_1001093895 | 151 |
| 140 | 3300006871 | Ga0075434_100110530 | Ga0075434_1001105304 | 151 |
| 141 | 3300006871 | Ga0075434_101223515 | Ga0075434_1012235152 | 151 |
| 142 | 3300006880 | Ga0075429_100522210 | Ga0075429_1005222102 | 151 |
| 143 | 3300006881 | Ga0068865_100006729 | Ga0068865_10000672915 | 151 |
| 144 | 3300006881 | Ga0068865_100055357 | Ga0068865_1000553572 | 151 |
| 145 | 3300006914 | Ga0075436_100018272 | Ga0075436_1000182721 | 151 |
| 146 | 3300006914 | Ga0075436_100038116 | Ga0075436_1000381161 | 151 |
| 147 | 3300006914 | Ga0075436_100110506 | Ga0075436_1001105064 | 151 |
| 148 | 3300006931 | Ga0097620_100168317 | Ga0097620_1001683173 | 151 |
| 149 | 3300007076 | Ga0075435_100001694 | Ga0075435_10000169419 | 151 |
| 150 | 3300007076 | Ga0075435_100028991 | Ga0075435_1000289918 | 151 |
| 151 | 3300007076 | Ga0075435_100038141 | Ga0075435_1000381418 | 151 |
| 152 | 3300009093 | Ga0105240_10045226 | Ga0105240_100452269 | 151 |
| 153 | 3300009094 | Ga0111539_10000010 | Ga0111539_1000001035 | 151 |
| 154 | 3300009094 | Ga0111539_10000566 | Ga0111539_1000056612 | 151 |
| 155 | 3300009094 | Ga0111539_11332686 | Ga0111539_113326862 | 151 |
| 156 | 3300009098 | Ga0105245_10035527 | Ga0105245_1003552711 | 151 |
| 157 | 3300009098 | Ga0105245_10473430 | Ga0105245_104734302 | 151 |
| 158 | 3300009101 | Ga0105247_10004209 | Ga0105247_100042096 | 151 |
| 159 | 3300009147 | Ga0114129_10216991 | Ga0114129_102169913 | 151 |
| 160 | 3300009147 | Ga0114129_11634253 | Ga0114129_116342532 | 151 |
| 161 | 3300009148 | Ga0105243_10105863 | Ga0105243_101058631 | 151 |
| 162 | 3300009174 | Ga0105241_10100846 | Ga0105241_101008463 | 151 |
| 163 | 3300009176 | Ga0105242_10013585 | Ga0105242_1001358513 | 151 |
| 164 | 3300009176 | Ga0105242_10035616 | Ga0105242_100356168 | 151 |
| 165 | 3300009176 | Ga0105242_10125367 | Ga0105242_101253674 | 151 |
| 166 | 3300009176 | Ga0105242_10177665 | Ga0105242_101776654 | 151 |
| 167 | 3300009177 | Ga0105248_10026461 | Ga0105248_100264614 | 151 |
| 168 | 3300009177 | Ga0105248_10387276 | Ga0105248_103872762 | 151 |
| 169 | 3300009177 | Ga0105248_10452960 | Ga0105248_104529602 | 151 |
| 170 | 3300009177 | Ga0105248_10819264 | Ga0105248_108192642 | 151 |
| 171 | 3300009551 | Ga0105238_11387555 | Ga0105238_113875552 | 151 |
| 172 | 3300010159 | Ga0099796_10030103 | Ga0099796_100301033 | 151 |
| 173 | 3300010375 | Ga0105239_11680584 | Ga0105239_116805841 | 151 |
| 174 | 3300013296 | Ga0157374_10119547 | Ga0157374_101195471 | 151 |
| 175 | 3300013296 | Ga0157374_10433731 | Ga0157374_104337313 | 151 |
| 176 | 3300013296 | Ga0157374_11120636 | Ga0157374_111206361 | 151 |
| 177 | 3300013306 | Ga0163162_10364795 | Ga0163162_103647953 | 151 |
| 178 | 3300013306 | Ga0163162_10519827 | Ga0163162_105198272 | 151 |
| 179 | 3300013308 | Ga0157375_10053326 | Ga0157375_100533266 | 151 |
| 180 | 3300013308 | Ga0157375_10277484 | Ga0157375_102774843 | 151 |
| 181 | 3300014325 | Ga0163163_10087285 | Ga0163163_100872853 | 151 |
| 182 | 3300014325 | Ga0163163_10125545 | Ga0163163_101255456 | 151 |
| 183 | 3300014325 | Ga0163163_10548400 | Ga0163163_105484003 | 151 |
| 184 | 3300014325 | Ga0163163_10641362 | Ga0163163_106413623 | 151 |
| 185 | 3300014326 | Ga0157380_10194070 | Ga0157380_101940703 | 151 |
| 186 | 3300014326 | Ga0157380_10489694 | Ga0157380_104896942 | 151 |
| 187 | 3300014745 | Ga0157377_10019122 | Ga0157377_100191224 | 151 |
| 188 | 3300014968 | Ga0157379_10018550 | Ga0157379_100185506 | 151 |
| 189 | 3300014968 | Ga0157379_10063370 | Ga0157379_100633703 | 151 |
| 190 | 3300014968 | Ga0157379_10146389 | Ga0157379_101463893 | 151 |
| 191 | 3300014968 | Ga0157379_10802200 | Ga0157379_108022002 | 151 |
| 192 | 3300014969 | Ga0157376_10057273 | Ga0157376_100572735 | 151 |
| 193 | 3300014969 | Ga0157376_10145796 | Ga0157376_101457961 | 151 |
| 194 | 3300014969 | Ga0157376_11266519 | Ga0157376_112665192 | 151 |
| 195 | 3300021358 | Ga0213873_10124294 | Ga0213873_101242942 | 151 |
| 196 | 3300025315 | Ga0207697_10089053 | Ga0207697_100890532 | 151 |
| 197 | 3300025315 | Ga0207697_10157139 | Ga0207697_101571392 | 151 |
| 198 | 3300025893 | Ga0207682_10094553 | Ga0207682_100945532 | 151 |
| 199 | 3300025893 | Ga0207682_10146518 | Ga0207682_101465182 | 151 |
| 200 | 3300025893 | Ga0207682_10342783 | Ga0207682_103427832 | 151 |
| 201 | 3300025899 | Ga0207642_10258962 | Ga0207642_102589622 | 151 |
| 202 | 3300025901 | Ga0207688_10190402 | Ga0207688_101904023 | 151 |
| 203 | 3300025901 | Ga0207688_10337075 | Ga0207688_103370752 | 151 |
| 204 | 3300025903 | Ga0207680_10349441 | Ga0207680_103494413 | 151 |
| 205 | 3300025903 | Ga0207680_10364852 | Ga0207680_103648523 | 151 |
| 206 | 3300025907 | Ga0207645_10096400 | Ga0207645_100964002 | 151 |
| 207 | 3300025907 | Ga0207645_10155591 | Ga0207645_101555913 | 151 |
| 208 | 3300025907 | Ga0207645_10307973 | Ga0207645_103079731 | 151 |
| 209 | 3300025908 | Ga0207643_10090349 | Ga0207643_100903494 | 151 |
| 210 | 3300025909 | Ga0207705_10423658 | Ga0207705_104236582 | 151 |
| 211 | 3300025909 | Ga0207705_10546213 | Ga0207705_105462133 | 151 |
| 212 | 3300025912 | Ga0207707_10312425 | Ga0207707_103124252 | 151 |
| 213 | 3300025913 | Ga0207695_10084625 | Ga0207695_100846252 | 151 |
| 214 | 3300025913 | Ga0207695_10642497 | Ga0207695_106424971 | 151 |
| 215 | 3300025915 | Ga0207693_10257754 | Ga0207693_102577542 | 151 |
| 216 | 3300025916 | Ga0207663_10236530 | Ga0207663_102365303 | 151 |
| 217 | 3300025920 | Ga0207649_10659408 | Ga0207649_106594082 | 151 |
| 218 | 3300025920 | Ga0207649_10693416 | Ga0207649_106934162 | 151 |
| 219 | 3300025922 | Ga0207646_10097073 | Ga0207646_100970731 | 151 |
| 220 | 3300025922 | Ga0207646_10731602 | Ga0207646_107316021 | 151 |
| 221 | 3300025924 | Ga0207694_10261502 | Ga0207694_102615023 | 151 |
| 222 | 3300025924 | Ga0207694_10758091 | Ga0207694_107580911 | 151 |
| 223 | 3300025924 | Ga0207694_10758852 | Ga0207694_107588522 | 151 |
| 224 | 3300025925 | Ga0207650_10877977 | Ga0207650_108779772 | 151 |
| 225 | 3300025926 | Ga0207659_10126623 | Ga0207659_101266233 | 151 |
| 226 | 3300025927 | Ga0207687_10015584 | Ga0207687_100155843 | 151 |
| 227 | 3300025927 | Ga0207687_10098805 | Ga0207687_100988052 | 151 |
| 228 | 3300025929 | Ga0207664_10050545 | Ga0207664_100505454 | 151 |
| 229 | 3300025931 | Ga0207644_10120436 | Ga0207644_101204364 | 151 |
| 230 | 3300025932 | Ga0207690_10232957 | Ga0207690_102329572 | 151 |
| 231 | 3300025934 | Ga0207686_10013361 | Ga0207686_100133612 | 151 |
| 232 | 3300025934 | Ga0207686_10016494 | Ga0207686_100164944 | 151 |
| 233 | 3300025934 | Ga0207686_10147455 | Ga0207686_101474552 | 151 |
| 234 | 3300025937 | Ga0207669_10039737 | Ga0207669_100397372 | 151 |
| 235 | 3300025937 | Ga0207669_10127353 | Ga0207669_101273533 | 151 |
| 236 | 3300025937 | Ga0207669_10392616 | Ga0207669_103926162 | 151 |
| 237 | 3300025937 | Ga0207669_10553177 | Ga0207669_105531772 | 151 |
| 238 | 3300025937 | Ga0207669_11301839 | Ga0207669_113018391 | 151 |
| 239 | 3300025938 | Ga0207704_10005828 | Ga0207704_100058284 | 151 |
| 240 | 3300025938 | Ga0207704_10169986 | Ga0207704_101699863 | 151 |
| 241 | 3300025938 | Ga0207704_10211258 | Ga0207704_102112583 | 151 |
| 242 | 3300025939 | Ga0207665_10048683 | Ga0207665_100486832 | 151 |
| 243 | 3300025939 | Ga0207665_10565550 | Ga0207665_105655502 | 151 |
| 244 | 3300025939 | Ga0207665_10847167 | Ga0207665_108471672 | 151 |
| 245 | 3300025940 | Ga0207691_10339779 | Ga0207691_103397792 | 151 |
| 246 | 3300025940 | Ga0207691_10419050 | Ga0207691_104190502 | 151 |
| 247 | 3300025940 | Ga0207691_10555542 | Ga0207691_105555422 | 151 |
| 248 | 3300025941 | Ga0207711_10026433 | Ga0207711_100264337 | 151 |
| 249 | 3300025941 | Ga0207711_10058386 | Ga0207711_100583864 | 151 |
| 250 | 3300025941 | Ga0207711_10169022 | Ga0207711_101690222 | 151 |
| 251 | 3300025941 | Ga0207711_10393563 | Ga0207711_103935632 | 151 |
| 252 | 3300025942 | Ga0207689_10034411 | Ga0207689_100344113 | 151 |
| 253 | 3300025949 | Ga0207667_10168529 | Ga0207667_101685294 | 151 |
| 254 | 3300025960 | Ga0207651_10041000 | Ga0207651_100410003 | 151 |
| 255 | 3300025960 | Ga0207651_10110459 | Ga0207651_101104593 | 151 |
| 256 | 3300025960 | Ga0207651_10149189 | Ga0207651_101491893 | 151 |
| 257 | 3300025960 | Ga0207651_10156204 | Ga0207651_101562044 | 151 |
| 258 | 3300025961 | Ga0207712_11612361 | Ga0207712_116123611 | 151 |
| 259 | 3300025972 | Ga0207668_10092168 | Ga0207668_100921682 | 151 |
| 260 | 3300025972 | Ga0207668_10098613 | Ga0207668_100986134 | 151 |
| 261 | 3300025981 | Ga0207640_10114374 | Ga0207640_101143743 | 151 |
| 262 | 3300025986 | Ga0207658_10276346 | Ga0207658_102763463 | 151 |
| 263 | 3300026023 | Ga0207677_10497170 | Ga0207677_104971703 | 151 |
| 264 | 3300026023 | Ga0207677_11060195 | Ga0207677_110601952 | 151 |
| 265 | 3300026035 | Ga0207703_10215416 | Ga0207703_102154163 | 151 |
| 266 | 3300026035 | Ga0207703_10280457 | Ga0207703_102804572 | 151 |
| 267 | 3300026035 | Ga0207703_11452727 | Ga0207703_114527271 | 151 |
| 268 | 3300026041 | Ga0207639_10543413 | Ga0207639_105434132 | 151 |
| 269 | 3300026075 | Ga0207708_10328664 | Ga0207708_103286641 | 151 |
| 270 | 3300026088 | Ga0207641_10752171 | Ga0207641_107521713 | 151 |
| 271 | 3300026089 | Ga0207648_10037722 | Ga0207648_100377225 | 151 |
| 272 | 3300026089 | Ga0207648_10082760 | Ga0207648_100827605 | 151 |
| 273 | 3300026089 | Ga0207648_10319166 | Ga0207648_103191663 | 151 |
| 274 | 3300026095 | Ga0207676_10028142 | Ga0207676_100281422 | 151 |
| 275 | 3300026095 | Ga0207676_10069079 | Ga0207676_100690793 | 151 |
| 276 | 3300026095 | Ga0207676_10164224 | Ga0207676_101642242 | 151 |
| 277 | 3300026095 | Ga0207676_10416489 | Ga0207676_104164893 | 151 |
| 278 | 3300026116 | Ga0207674_10203527 | Ga0207674_102035273 | 151 |
| 279 | 3300026118 | Ga0207675_100038967 | Ga0207675_1000389674 | 151 |
| 280 | 3300026118 | Ga0207675_100412832 | Ga0207675_1004128322 | 151 |
| 281 | 3300026121 | Ga0207683_11447570 | Ga0207683_114475701 | 151 |
| 282 | 3300027907 | Ga0207428_10000034 | Ga0207428_10000034185 | 151 |
| 283 | 3300027907 | Ga0207428_10107542 | Ga0207428_101075423 | 151 |
| 284 | 3300027907 | Ga0207428_10120374 | Ga0207428_101203744 | 151 |
| 285 | 3300028379 | Ga0268266_10005896 | Ga0268266_1000589610 | 151 |
| 286 | 3300028379 | Ga0268266_10029767 | Ga0268266_100297673 | 151 |
| 287 | 3300028380 | Ga0268265_10113738 | Ga0268265_101137384 | 151 |
| 288 | 3300028380 | Ga0268265_10733702 | Ga0268265_107337021 | 151 |
| 289 | 3300028381 | Ga0268264_10042810 | Ga0268264_100428104 | 151 |
| 290 | 3300028381 | Ga0268264_10050141 | Ga0268264_100501416 | 151 |
| 291 | 3300028381 | Ga0268264_10317611 | Ga0268264_103176113 | 151 |
| 292 | 3300028381 | Ga0268264_11287382 | Ga0268264_112873821 | 151 |
| 293 | 3300031238 | Ga0265332_10048353 | Ga0265332_100483532 | 151 |
| 294 | 3300031344 | Ga0265316_10261546 | Ga0265316_102615463 | 151 |
| 295 | 3300031711 | Ga0265314_10007579 | Ga0265314_100075795 | 151 |
| 296 | 3300031824 | Ga0307413_10220584 | Ga0307413_102205843 | 151 |
| 297 | 3300031824 | Ga0307413_10391449 | Ga0307413_103914493 | 151 |
| 298 | 3300031911 | Ga0307412_10843067 | Ga0307412_108430672 | 151 |
| 299 | 3300032002 | Ga0307416_100160347 | Ga0307416_1001603473 | 151 |
| 300 | 3300032002 | Ga0307416_100512333 | Ga0307416_1005123332 | 151 |
| 301 | 3300032005 | Ga0307411_10170887 | Ga0307411_101708872 | 151 |
| 302 | 3300032005 | Ga0307411_10594306 | Ga0307411_105943062 | 151 |
| 303 | 3300034816 | Ga0373930_0002995 | Ga0373930_0002995_2039_2557 | 151 |
| 304 | 3300034817 | Ga0373948_0001483 | Ga0373948_0001483_1258_1776 | 151 |
| 305 | 3300034819 | Ga0373958_0000045 | Ga0373958_0000045_1633_2151 | 151 |
| 306 | 3300034820 | Ga0373959_0001151 | Ga0373959_0001151_31_549 | 151 |
| 307 | 3300034957 | Ga0373938_0000418 | Ga0373938_0000418_968_1486 | 151 |
| 308 | 3300035084 | Ga0373928_0001212 | Ga0373928_0001212_1812_2330 | 151 |
| 309 | 3300035085 | Ga0373929_0000116 | Ga0373929_0000116_8975_9493 | 151 |
| 310 | 3300035088 | Ga0373940_0000084 | Ga0373940_0000084_5809_6327 | 151 |
| 311 | 3300035089 | Ga0373944_0043759 | Ga0373944_0043759_476_994 | 151 |
| 312 | 3300035089 | Ga0373944_0073733 | Ga0373944_0073733_546_1064 | 151 |
| 313 | 3300035089 | Ga0373944_0224850 | Ga0373944_0224850_69_587 | 151 |
| 314 | 3300035090 | Ga0373949_0000597 | Ga0373949_0000597_8771_9289 | 151 |
| 315 | 3300035090 | Ga0373949_0033224 | Ga0373949_0033224_498_1016 | 151 |
| 316 | 3300035091 | Ga0373951_0001673 | Ga0373951_0001673_3207_3725 | 151 |
| 317 | 3300035092 | Ga0373952_0001387 | Ga0373952_0001387_1054_1572 | 151 |
| 318 | 3300035112 | Ga0373932_0006095 | Ga0373932_0006095_2303_2821 | 151 |
| 319 | 3300035113 | Ga0373936_0092396 | Ga0373936_0092396_492_1010 | 151 |
| 320 | 3300035113 | Ga0373936_0346338 | Ga0373936_0346338_38_556 | 151 |
| 321 | 3300035114 | Ga0373939_0001888 | Ga0373939_0001888_2441_2959 | 151 |
| 322 | 3300035114 | Ga0373939_0031755 | Ga0373939_0031755_389_907 | 151 |
| 323 | 3300035114 | Ga0373939_0107081 | Ga0373939_0107081_78_596 | 151 |
| 324 | 3300035115 | Ga0373941_0000161 | Ga0373941_0000161_6988_7506 | 151 |
| 325 | 3300035116 | Ga0373945_0056786 | Ga0373945_0056786_525_1043 | 151 |
| 326 | 3300035117 | Ga0373953_0044678 | Ga0373953_0044678_537_1055 | 151 |
| 327 | 3300035117 | Ga0373953_0132653 | Ga0373953_0132653_116_634 | 151 |
| 328 | 3300035119 | Ga0373956_0208787 | Ga0373956_0208787_88_606 | 151 |
| 329 | 3300035120 | Ga0373957_0061355 | Ga0373957_0061355_312_830 | 151 |
| 330 | 3300035121 | Ga0373960_0001448 | Ga0373960_0001448_4615_5133 | 151 |
| 331 | 3300035172 | Ga0373955_0047351 | Ga0373955_0047351_1049_1567 | 151 |
| 332 | 3300035172 | Ga0373955_0059904 | Ga0373955_0059904_396_914 | 151 |
| 333 | 3300035172 | Ga0373955_0171915 | Ga0373955_0171915_30_548 | 151 |
| 334 | 3300035207 | Ga0373942_0001757 | Ga0373942_0001757_3794_4312 | 151 |
| 335 | 3300035241 | Ga0373961_0001591 | Ga0373961_0001591_4151_4669 | 151 |
| 336 | 3300035241 | Ga0373961_0111475 | Ga0373961_0111475_331_849 | 151 |
| 337 | 3300035242 | Ga0373962_0000245 | Ga0373962_0000245_3795_4313 | 151 |
| 338 | 3300035410 | Ga0373924_0173653 | Ga0373924_0173653_273_791 | 151 |
| 339 | 3300035691 | Ga0373931_0009494 | Ga0373931_0009494_2961_3479 | 151 |
| 340 | 3300035691 | Ga0373931_0169020 | Ga0373931_0169020_348_866 | 151 |
| 341 | 3300035692 | Ga0373935_0087624 | Ga0373935_0087624_444_962 | 151 |
| 342 | 3300035692 | Ga0373935_1067504 | Ga0373935_1067504_25_543 | 151 |
| 343 | 3300035695 | Ga0373927_0199653 | Ga0373927_0199653_92_610 | 151 |
| 344 | 3300035725 | Ga0373947_0085310 | Ga0373947_0085310_1397_1915 | 151 |
| 345 | 3300036401 | Ga0373937_0055553 | Ga0373937_0055553_1054_1572 | 151 |
| 346 | 3300036401 | Ga0373937_0139222 | Ga0373937_0139222_116_634 | 151 |
| 347 | 3300036401 | Ga0373937_0170677 | Ga0373937_0170677_1390_1908 | 151 |
| 348 | 3300036401 | Ga0373937_0356987 | Ga0373937_0356987_182_700 | 151 |
| 349 | 3300037068 | Ga0373925_0160073 | Ga0373925_0160073_312_830 | 151 |
| 350 | 3300037068 | Ga0373925_0251097 | Ga0373925_0251097_300_818 | 151 |
| 351 | 3300037068 | Ga0373925_0281546 | Ga0373925_0281546_246_764 | 151 |
| 352 | 3300039453 | Ga0436362_0941488 | Ga0436362_0941488_22_540 | 151 |
| 353 | 3300041496 | Ga0451839_1310317 | Ga0451839_1310317_29_547 | 151 |
| 354 | 3300042122 | Ga0450920_048426 | Ga0450920_048426_182_700 | 151 |
| 355 | 3300042122 | Ga0450920_056922 | Ga0450920_056922_208_726 | 151 |
| 356 | 3300042156 | Ga0439446_0031821 | Ga0439446_0031821_930_1448 | 151 |
| 357 | 3300042530 | Ga0450916_000502 | Ga0450916_000502_2610_3128 | 151 |
| 358 | 3300045051 | Ga0451576_0071334 | Ga0451576_0071334_1841_2359 | 151 |
| 359 | 3300045051 | Ga0451576_0277902 | Ga0451576_0277902_398_916 | 151 |
| 360 | 3300045051 | Ga0451576_1037898 | Ga0451576_1037898_47_565 | 151 |
| 361 | 3300045051 | Ga0451576_1823096 | Ga0451576_1823096_39_557 | 151 |
| 362 | 3300046455 | Ga0495603_0056649 | Ga0495603_0056649_1587_2105 | 151 |
| 363 | 3300046455 | Ga0495603_0297709 | Ga0495603_0297709_312_830 | 151 |
| 364 | 3300046459 | Ga0495629_0108936 | Ga0495629_0108936_529_1047 | 151 |
| 365 | 3300046461 | Ga0495641_0068787 | Ga0495641_0068787_362_880 | 151 |
| 366 | 3300046462 | Ga0495651_0599107 | Ga0495651_0599107_123_641 | 151 |
| 367 | 3300046463 | Ga0495653_0159656 | Ga0495653_0159656_559_1077 | 151 |
| 368 | 3300046463 | Ga0495653_0252550 | Ga0495653_0252550_295_813 | 151 |
| 369 | 3300046473 | Ga0495582_0422807 | Ga0495582_0422807_32_550 | 151 |
| 370 | 3300046475 | Ga0495639_0395149 | Ga0495639_0395149_14_532 | 151 |
| 371 | 3300046511 | Ga0495608_0213098 | Ga0495608_0213098_38_556 | 151 |
| 372 | 3300046512 | Ga0495610_0116527 | Ga0495610_0116527_253_771 | 151 |
| 373 | 3300046516 | Ga0495628_0162934 | Ga0495628_0162934_458_976 | 151 |
| 374 | 3300046516 | Ga0495628_0203404 | Ga0495628_0203404_798_1316 | 151 |
| 375 | 3300046517 | Ga0495630_0318966 | Ga0495630_0318966_510_1028 | 151 |
| 376 | 3300046517 | Ga0495630_0406660 | Ga0495630_0406660_185_703 | 151 |
| 377 | 3300046526 | Ga0495666_0192761 | Ga0495666_0192761_59_577 | 151 |
| 378 | 3300046533 | Ga0495640_0332366 | Ga0495640_0332366_182_700 | 151 |
| 379 | 3300046533 | Ga0495640_0593247 | Ga0495640_0593247_84_602 | 151 |
| 380 | 3300046536 | Ga0495587_0368436 | Ga0495587_0368436_211_729 | 151 |
| 381 | 3300046537 | Ga0495598_0209738 | Ga0495598_0209738_176_694 | 151 |
| 382 | 3300046543 | Ga0495645_0004427 | Ga0495645_0004427_3505_4023 | 151 |
| 383 | 3300046615 | Ga0495656_0287918 | Ga0495656_0287918_107_625 | 151 |
| 384 | 3300046642 | Ga0495634_0280130 | Ga0495634_0280130_102_620 | 151 |
| 385 | 3300046648 | Ga0495611_0179280 | Ga0495611_0179280_195_713 | 151 |
| 386 | 3300046663 | Ga0495635_0471561 | Ga0495635_0471561_265_783 | 151 |
| 387 | 3300046678 | Ga0495599_0240460 | Ga0495599_0240460_502_1020 | 151 |
| 388 | 3300046681 | Ga0495647_0024667 | Ga0495647_0024667_339_857 | 151 |
| 389 | 3300046681 | Ga0495647_0031489 | Ga0495647_0031489_1380_1898 | 151 |
| 390 | 3300046681 | Ga0495647_0187512 | Ga0495647_0187512_232_750 | 151 |
| 391 | 3300046683 | Ga0495658_0046802 | Ga0495658_0046802_162_680 | 151 |
| 392 | 3300046683 | Ga0495658_0063955 | Ga0495658_0063955_1513_2031 | 151 |
| 393 | 3300046684 | Ga0495669_0134426 | Ga0495669_0134426_116_634 | 151 |
| 394 | 3300046689 | Ga0495613_0199781 | Ga0495613_0199781_73_591 | 151 |
| 395 | 3300046689 | Ga0495613_0202812 | Ga0495613_0202812_317_835 | 151 |
| 396 | 3300046690 | Ga0495624_0143899 | Ga0495624_0143899_713_1231 | 151 |
| 397 | 3300046691 | Ga0495670_0317137 | Ga0495670_0317137_267_785 | 151 |
| 398 | 3300046809 | Ga0495600_0293614 | Ga0495600_0293614_131_649 | 151 |
| 399 | 3300046809 | Ga0495600_0494407 | Ga0495600_0494407_104_622 | 151 |
| 400 | 3300047315 | Ga0495581_0450625 | Ga0495581_0450625_28_546 | 151 |
| 401 | 3300047317 | Ga0495604_0115887 | Ga0495604_0115887_1124_1642 | 151 |
| 402 | 3300047319 | Ga0495674_0130151 | Ga0495674_0130151_447_965 | 151 |
| 403 | 3300047322 | Ga0495680_0180664 | Ga0495680_0180664_799_1317 | 151 |
| 404 | 3300047322 | Ga0495680_0290614 | Ga0495680_0290614_161_679 | 151 |
| 405 | 3300047444 | Ga0495675_0369920 | Ga0495675_0369920_101_619 | 151 |
| 406 | 3300047471 | Ga0495684_0073724 | Ga0495684_0073724_23_541 | 151 |
| 407 | 3300048088 | Ga0495602_0306123 | Ga0495602_0306123_201_719 | 151 |
| 408 | 3300048903 | Ga0496100_0004796 | Ga0496100_0004796_3103_3621 | 151 |
| 409 | 3300048903 | Ga0496100_0149902 | Ga0496100_0149902_647_1165 | 151 |
| 410 | 3300048904 | Ga0496101_0000396 | Ga0496101_0000396_24756_25274 | 151 |
| 411 | 3300048905 | Ga0496102_0213093 | Ga0496102_0213093_1160_1678 | 151 |
| 412 | 3300048905 | Ga0496102_0267652 | Ga0496102_0267652_726_1244 | 151 |
| 413 | 3300048905 | Ga0496102_0404817 | Ga0496102_0404817_168_686 | 151 |
| 414 | 3300048906 | Ga0496103_0584234 | Ga0496103_0584234_93_611 | 151 |
| 415 | 3300048907 | Ga0496104_0017385 | Ga0496104_0017385_5023_5541 | 151 |
| 416 | 3300048907 | Ga0496104_0021813 | Ga0496104_0021813_2036_2554 | 151 |
| 417 | 3300048907 | Ga0496104_0083357 | Ga0496104_0083357_43_561 | 151 |
| 418 | 3300048907 | Ga0496104_0354243 | Ga0496104_0354243_280_798 | 151 |
| 419 | 3300048907 | Ga0496104_0368628 | Ga0496104_0368628_618_1136 | 151 |
| 420 | 3300048908 | Ga0496105_0090691 | Ga0496105_0090691_729_1247 | 151 |
| 421 | 3300048908 | Ga0496105_0124564 | Ga0496105_0124564_904_1422 | 151 |
| 422 | 3300048910 | Ga0496107_0031098 | Ga0496107_0031098_3201_3719 | 151 |
| 423 | 3300048910 | Ga0496107_0104604 | Ga0496107_0104604_704_1222 | 151 |
| 424 | 3300048911 | Ga0496108_0011060 | Ga0496108_0011060_2207_2725 | 151 |
| 425 | 3300048911 | Ga0496108_0310386 | Ga0496108_0310386_104_622 | 151 |
| 426 | 3300048912 | Ga0496109_0151382 | Ga0496109_0151382_719_1237 | 151 |
| 427 | 3300048912 | Ga0496109_0191312 | Ga0496109_0191312_452_970 | 151 |
| 428 | 3300048913 | Ga0496110_0157481 | Ga0496110_0157481_1392_1910 | 151 |
| 429 | 3300048913 | Ga0496110_1004039 | Ga0496110_1004039_115_633 | 151 |
| 430 | 3300048914 | Ga0496111_0549294 | Ga0496111_0549294_204_722 | 151 |
| 431 | 3300048915 | Ga0496112_0016237 | Ga0496112_0016237_6298_6816 | 151 |
| 432 | 3300048915 | Ga0496112_0055326 | Ga0496112_0055326_821_1339 | 151 |
| 433 | 3300048915 | Ga0496112_0199485 | Ga0496112_0199485_527_1045 | 151 |
| 434 | 3300048916 | Ga0496113_0032056 | Ga0496113_0032056_197_715 | 151 |
| 435 | 3300048917 | Ga0496114_0000246 | Ga0496114_0000246_11812_12330 | 151 |
| 436 | 3300048917 | Ga0496114_0013645 | Ga0496114_0013645_1711_2229 | 151 |
| 437 | 3300048917 | Ga0496114_0259315 | Ga0496114_0259315_363_881 | 151 |
| 438 | 3300048917 | Ga0496114_0333337 | Ga0496114_0333337_624_1142 | 151 |
| 439 | 3300048917 | Ga0496114_0489114 | Ga0496114_0489114_369_887 | 151 |
| 440 | 3300048918 | Ga0496115_0383448 | Ga0496115_0383448_565_1083 | 151 |
| 441 | 3300048918 | Ga0496115_0513647 | Ga0496115_0513647_241_759 | 151 |
| 442 | 3300049460 | Ga0495682_0101315 | Ga0495682_0101315_113_631 | 151 |
| 443 | 3300049571 | Ga0501034_0108508 | Ga0501034_0108508_753_1271 | 151 |
| 444 | 3300049574 | Ga0501038_0525123 | Ga0501038_0525123_280_798 | 151 |
| 445 | 3300049578 | Ga0501042_1188518 | Ga0501042_1188518_24_542 | 151 |
| 446 | 3300049581 | Ga0501047_0399559 | Ga0501047_0399559_273_791 | 151 |
| 447 | 3300049582 | Ga0501048_0193859 | Ga0501048_0193859_148_666 | 151 |
| 448 | 3300049589 | Ga0501073_0177565 | Ga0501073_0177565_57_575 | 151 |
| 449 | 3300049742 | Ga0501080_0958755 | Ga0501080_0958755_211_729 | 151 |
| 450 | 3300049743 | Ga0501081_0126226 | Ga0501081_0126226_383_901 | 151 |
| 451 | 3300049744 | Ga0501083_0137210 | Ga0501083_0137210_871_1389 | 151 |
| 452 | 3300049824 | Ga0501045_0482481 | Ga0501045_0482481_36_554 | 151 |
| 453 | 3300050494 | nmdc:mga06z11_310287_c1 | nmdc:mga06z11_310287_c1_350_868 | 151 |
| 454 | 3300050507 | nmdc:mga05p37_119480_c1 | nmdc:mga05p37_119480_c1_789_1307 | 151 |
| 455 | 3300050507 | nmdc:mga05p37_260703_c1 | nmdc:mga05p37_260703_c1_1155_1673 | 151 |
| 456 | 3300050507 | nmdc:mga05p37_416605_c1 | nmdc:mga05p37_416605_c1_158_676 | 151 |
| 457 | 3300050508 | nmdc:mga09592_112102_c1 | nmdc:mga09592_112102_c1_1563_2081 | 151 |
| 458 | 3300050509 | nmdc:mga0qj67_786687_c1 | nmdc:mga0qj67_786687_c1_107_625 | 151 |
| 459 | 3300050510 | nmdc:mga06r32_45742_c1 | nmdc:mga06r32_45742_c1_3524_4042 | 151 |
| 460 | 3300050511 | nmdc:mga08y16_1091636_c1 | nmdc:mga08y16_1091636_c1_41_559 | 151 |
| 461 | 3300050511 | nmdc:mga08y16_10_c1 | nmdc:mga08y16_10_c1_435452_435970 | 151 |
| 462 | 3300050511 | nmdc:mga08y16_20665_c1 | nmdc:mga08y16_20665_c1_4403_4921 | 151 |
| 463 | 3300050511 | nmdc:mga08y16_95418_c1 | nmdc:mga08y16_95418_c1_2464_2982 | 151 |
| 464 | 3300050512 | nmdc:mga0n895_17757_c1 | nmdc:mga0n895_17757_c1_3056_3574 | 151 |
| 465 | 3300050512 | nmdc:mga0n895_24421_c1 | nmdc:mga0n895_24421_c1_940_1458 | 151 |
| 466 | 3300050512 | nmdc:mga0n895_449050_c1 | nmdc:mga0n895_449050_c1_757_1275 | 151 |
| 467 | 3300050512 | nmdc:mga0n895_490768_c1 | nmdc:mga0n895_490768_c1_50_568 | 151 |
| 468 | 3300050512 | nmdc:mga0n895_7101_c1 | nmdc:mga0n895_7101_c1_2891_3409 | 151 |
| 469 | 3300050512 | nmdc:mga0n895_957514_c1 | nmdc:mga0n895_957514_c1_260_778 | 151 |
| 470 | 3300050513 | nmdc:mga0rr50_140171_c1 | nmdc:mga0rr50_140171_c1_1012_1530 | 151 |
| 471 | 3300050513 | nmdc:mga0rr50_1773_c1 | nmdc:mga0rr50_1773_c1_10425_10943 | 151 |
| 472 | 3300050513 | nmdc:mga0rr50_373_c1 | nmdc:mga0rr50_373_c1_18722_19240 | 151 |
| 473 | 3300050513 | nmdc:mga0rr50_40661_c1 | nmdc:mga0rr50_40661_c1_1154_1672 | 151 |
| 474 | 3300050513 | nmdc:mga0rr50_435801_c1 | nmdc:mga0rr50_435801_c1_527_1045 | 151 |
| 475 | 3300050514 | nmdc:mga08x19_10007_c1 | nmdc:mga08x19_10007_c1_824_1342 | 151 |
| 476 | 3300050514 | nmdc:mga08x19_189510_c1 | nmdc:mga08x19_189510_c1_559_1077 | 151 |
| 477 | 3300050514 | nmdc:mga08x19_441276_c1 | nmdc:mga08x19_441276_c1_111_629 | 151 |
| 478 | 3300050514 | nmdc:mga08x19_79203_c1 | nmdc:mga08x19_79203_c1_34_552 | 151 |
| 479 | 3300050515 | nmdc:mga0a205_10346_c1 | nmdc:mga0a205_10346_c1_6128_6646 | 151 |
| 480 | 3300050515 | nmdc:mga0a205_255698_c1 | nmdc:mga0a205_255698_c1_43_561 | 151 |
| 481 | 3300050515 | nmdc:mga0a205_6655_c1 | nmdc:mga0a205_6655_c1_4924_5442 | 151 |
| 482 | 3300053077 | Ga0495601_0073947 | Ga0495601_0073947_952_1470 | 151 |
| 483 | 3300053077 | Ga0495601_0179517 | Ga0495601_0179517_88_606 | 151 |
| 484 | 3300053078 | Ga0495612_0206914 | Ga0495612_0206914_109_627 | 151 |
| 485 | 3300053084 | Ga0495595_0015689 | Ga0495595_0015689_340_858 | 151 |
| 486 | 3300053084 | Ga0495595_0099791 | Ga0495595_0099791_141_659 | 151 |
| 487 | 3300053084 | Ga0495595_0246585 | Ga0495595_0246585_315_833 | 151 |
| 488 | 3300053084 | Ga0495595_0247835 | Ga0495595_0247835_116_634 | 151 |
| 489 | 3300053085 | Ga0495619_0076292 | Ga0495619_0076292_1068_1586 | 151 |
| 490 | 3300053085 | Ga0495619_0163154 | Ga0495619_0163154_872_1390 | 151 |
| 491 | 3300053134 | Ga0500658_0026256 | Ga0500658_0026256_714_1232 | 151 |
| 492 | 3300053158 | Ga0500627_0271257 | Ga0500627_0271257_80_598 | 151 |
| 493 | 3300005295 | Ga0065707_10089023 | Ga0065707_100890239 | 152 |
| 494 | 3300005328 | Ga0070676_10007044 | Ga0070676_100070447 | 152 |
| 495 | 3300005331 | Ga0070670_100050949 | Ga0070670_1000509494 | 152 |
| 496 | 3300005335 | Ga0070666_10123865 | Ga0070666_101238652 | 152 |
| 497 | 3300005337 | Ga0070682_100444190 | Ga0070682_1004441901 | 152 |
| 498 | 3300005341 | Ga0070691_10004188 | Ga0070691_100041886 | 152 |
| 499 | 3300005343 | Ga0070687_100080522 | Ga0070687_1000805223 | 152 |
| 500 | 3300005353 | Ga0070669_100110504 | Ga0070669_1001105042 | 152 |
| 501 | 3300005356 | Ga0070674_100278160 | Ga0070674_1002781602 | 152 |
| 502 | 3300005364 | Ga0070673_100460085 | Ga0070673_1004600852 | 152 |
| 503 | 3300005438 | Ga0070701_10010126 | Ga0070701_100101267 | 152 |
| 504 | 3300005440 | Ga0070705_100044955 | Ga0070705_1000449552 | 152 |
| 505 | 3300005440 | Ga0070705_100971410 | Ga0070705_1009714101 | 152 |
| 506 | 3300005459 | Ga0068867_100035655 | Ga0068867_1000356558 | 152 |
| 507 | 3300005518 | Ga0070699_100741988 | Ga0070699_1007419882 | 152 |
| 508 | 3300005543 | Ga0070672_100454407 | Ga0070672_1004544072 | 152 |
| 509 | 3300005544 | Ga0070686_100002243 | Ga0070686_1000022436 | 152 |
| 510 | 3300005546 | Ga0070696_100012605 | Ga0070696_1000126054 | 152 |
| 511 | 3300005577 | Ga0068857_101000445 | Ga0068857_1010004452 | 152 |
| 512 | 3300005578 | Ga0068854_100637221 | Ga0068854_1006372211 | 152 |
| 513 | 3300005614 | Ga0068856_100018557 | Ga0068856_1000185577 | 152 |
| 514 | 3300005615 | Ga0070702_100002883 | Ga0070702_1000028835 | 152 |
| 515 | 3300005617 | Ga0068859_100020008 | Ga0068859_10002000815 | 152 |
| 516 | 3300005719 | Ga0068861_100024888 | Ga0068861_1000248888 | 152 |
| 517 | 3300005840 | Ga0068870_10321948 | Ga0068870_103219482 | 152 |
| 518 | 3300005841 | Ga0068863_100116322 | Ga0068863_1001163221 | 152 |
| 519 | 3300005843 | Ga0068860_100129065 | Ga0068860_1001290655 | 152 |
| 520 | 3300005843 | Ga0068860_100328276 | Ga0068860_1003282762 | 152 |
| 521 | 3300005843 | Ga0068860_100344425 | Ga0068860_1003444252 | 152 |
| 522 | 3300005844 | Ga0068862_100157630 | Ga0068862_1001576302 | 152 |
| 523 | 3300006844 | Ga0075428_100348183 | Ga0075428_1003481834 | 152 |
| 524 | 3300006852 | Ga0075433_10530184 | Ga0075433_105301842 | 152 |
| 525 | 3300006852 | Ga0075433_11134277 | Ga0075433_111342772 | 152 |
| 526 | 3300006871 | Ga0075434_100135753 | Ga0075434_1001357534 | 152 |
| 527 | 3300006871 | Ga0075434_100385465 | Ga0075434_1003854652 | 152 |
| 528 | 3300006931 | Ga0097620_100020008 | Ga0097620_10002000815 | 152 |
| 529 | 3300007076 | Ga0075435_100001542 | Ga0075435_10000154215 | 152 |
| 530 | 3300009093 | Ga0105240_10177867 | Ga0105240_101778674 | 152 |
| 531 | 3300009093 | Ga0105240_11200222 | Ga0105240_112002221 | 152 |
| 532 | 3300009098 | Ga0105245_10062980 | Ga0105245_100629801 | 152 |
| 533 | 3300009147 | Ga0114129_10117140 | Ga0114129_101171406 | 152 |
| 534 | 3300009147 | Ga0114129_10148538 | Ga0114129_101485383 | 152 |
| 535 | 3300012503 | Ga0157313_1011512 | Ga0157313_10115122 | 152 |
| 536 | 3300013296 | Ga0157374_10899348 | Ga0157374_108993481 | 152 |
| 537 | 3300014326 | Ga0157380_10007827 | Ga0157380_100078277 | 152 |
| 538 | 3300014326 | Ga0157380_10547053 | Ga0157380_105470532 | 152 |
| 539 | 3300025903 | Ga0207680_10142428 | Ga0207680_101424283 | 152 |
| 540 | 3300025911 | Ga0207654_10223831 | Ga0207654_102238312 | 152 |
| 541 | 3300025913 | Ga0207695_10131709 | Ga0207695_101317094 | 152 |
| 542 | 3300025918 | Ga0207662_10178874 | Ga0207662_101788741 | 152 |
| 543 | 3300025927 | Ga0207687_10063053 | Ga0207687_100630532 | 152 |
| 544 | 3300025935 | Ga0207709_10007222 | Ga0207709_1000722212 | 152 |
| 545 | 3300025937 | Ga0207669_10337513 | Ga0207669_103375132 | 152 |
| 546 | 3300025941 | Ga0207711_10137892 | Ga0207711_101378924 | 152 |
| 547 | 3300026075 | Ga0207708_10105615 | Ga0207708_101056154 | 152 |
| 548 | 3300026078 | Ga0207702_10262266 | Ga0207702_102622662 | 152 |
| 549 | 3300026089 | Ga0207648_10016724 | Ga0207648_100167248 | 152 |
| 550 | 3300026095 | Ga0207676_10694427 | Ga0207676_106944272 | 152 |
| 551 | 3300026118 | Ga0207675_100818367 | Ga0207675_1008183673 | 152 |
| 552 | 3300027907 | Ga0207428_10072788 | Ga0207428_100727882 | 152 |
| 553 | 3300027907 | Ga0207428_10073024 | Ga0207428_100730243 | 152 |
| 554 | 3300028380 | Ga0268265_10005520 | Ga0268265_100055207 | 152 |
| 555 | 3300037068 | Ga0373925_0545741 | Ga0373925_0545741_337_861 | 152 |
| 556 | 3300044694 | Ga0466963_0109939 | Ga0466963_0109939_1183_1704 | 152 |
| 557 | 3300046473 | Ga0495582_0606613 | Ga0495582_0606613_88_609 | 152 |
| 558 | 3300048905 | Ga0496102_0457266 | Ga0496102_0457266_453_977 | 152 |
| 559 | 3300048913 | Ga0496110_0399484 | Ga0496110_0399484_576_1097 | 152 |
| 560 | 3300048915 | Ga0496112_0745016 | Ga0496112_0745016_79_606 | 152 |
| 561 | 3300049571 | Ga0501034_0077055 | Ga0501034_0077055_2680_3207 | 152 |
| 562 | 3300049572 | Ga0501036_0997737 | Ga0501036_0997737_41_568 | 152 |
| 563 | 3300049577 | Ga0501041_0273442 | Ga0501041_0273442_212_739 | 152 |
| 564 | 3300049579 | Ga0501043_0067123 | Ga0501043_0067123_695_1222 | 152 |
| 565 | 3300049581 | Ga0501047_0015370 | Ga0501047_0015370_6646_7173 | 152 |
| 566 | 3300049588 | Ga0501072_0531812 | Ga0501072_0531812_372_893 | 152 |
| 567 | 3300049823 | Ga0501044_0003452 | Ga0501044_0003452_1377_1904 | 152 |
| 568 | 3300050507 | nmdc:mga05p37_361676_c1 | nmdc:mga05p37_361676_c1_199_720 | 152 |
| 569 | 3300050507 | nmdc:mga05p37_403716_c1 | nmdc:mga05p37_403716_c1_989_1510 | 152 |
| 570 | 3300050507 | nmdc:mga05p37_6561_c1 | nmdc:mga05p37_6561_c1_12791_13312 | 152 |
| 571 | 3300050509 | nmdc:mga0qj67_297758_c1 | nmdc:mga0qj67_297758_c1_624_1178 | 152 |
| 572 | 3300050511 | nmdc:mga08y16_1463818_c1 | nmdc:mga08y16_1463818_c1_102_623 | 152 |
| 573 | 3300050511 | nmdc:mga08y16_16207_c1 | nmdc:mga08y16_16207_c1_6628_7149 | 152 |
| 574 | 3300050512 | nmdc:mga0n895_12982_c1 | nmdc:mga0n895_12982_c1_2624_3148 | 152 |
| 575 | 3300050512 | nmdc:mga0n895_27160_c1 | nmdc:mga0n895_27160_c1_3279_3800 | 152 |
| 576 | 3300050513 | nmdc:mga0rr50_2205_c1 | nmdc:mga0rr50_2205_c1_1657_2181 | 152 |
| 577 | 3300050515 | nmdc:mga0a205_14317_c1 | nmdc:mga0a205_14317_c1_5015_5536 | 152 |
| 578 | 3300050515 | nmdc:mga0a205_162299_c1 | nmdc:mga0a205_162299_c1_1178_1702 | 152 |
| 579 | 3300005335 | Ga0070666_10310169 | Ga0070666_103101692 | 153 |
| 580 | 3300005356 | Ga0070674_100202289 | Ga0070674_1002022892 | 153 |
| 581 | 3300005356 | Ga0070674_100554456 | Ga0070674_1005544562 | 153 |
| 582 | 3300005367 | Ga0070667_101228191 | Ga0070667_1012281912 | 153 |
| 583 | 3300005471 | Ga0070698_100367829 | Ga0070698_1003678292 | 153 |
| 584 | 3300005471 | Ga0070698_100995188 | Ga0070698_1009951881 | 153 |
| 585 | 3300005530 | Ga0070679_100044653 | Ga0070679_1000446531 | 153 |
| 586 | 3300005563 | Ga0068855_100286434 | Ga0068855_1002864342 | 153 |
| 587 | 3300005615 | Ga0070702_100036054 | Ga0070702_1000360542 | 153 |
| 588 | 3300006237 | Ga0097621_100228720 | Ga0097621_1002287203 | 153 |
| 589 | 3300006852 | Ga0075433_10422349 | Ga0075433_104223492 | 153 |
| 590 | 3300009094 | Ga0111539_10293747 | Ga0111539_102937474 | 153 |
| 591 | 3300009177 | Ga0105248_10261960 | Ga0105248_102619603 | 153 |
| 592 | 3300009551 | Ga0105238_10125557 | Ga0105238_101255574 | 153 |
| 593 | 3300013296 | Ga0157374_10311603 | Ga0157374_103116033 | 153 |
| 594 | 3300014968 | Ga0157379_10138355 | Ga0157379_101383554 | 153 |
| 595 | 3300025904 | Ga0207647_10156595 | Ga0207647_101565953 | 153 |
| 596 | 3300025917 | Ga0207660_10323655 | Ga0207660_103236551 | 153 |
| 597 | 3300025919 | Ga0207657_10013143 | Ga0207657_1001314311 | 153 |
| 598 | 3300025937 | Ga0207669_10297868 | Ga0207669_102978683 | 153 |
| 599 | 3300025938 | Ga0207704_10707716 | Ga0207704_107077161 | 153 |
| 600 | 3300025941 | Ga0207711_10212107 | Ga0207711_102121073 | 153 |
| 601 | 3300025944 | Ga0207661_10337766 | Ga0207661_103377662 | 153 |
| 602 | 3300025986 | Ga0207658_11054258 | Ga0207658_110542582 | 153 |
| 603 | 3300026142 | Ga0207698_11764993 | Ga0207698_117649931 | 153 |
| 604 | 3300027614 | Ga0209970_1014250 | Ga0209970_10142502 | 153 |
| 605 | 3300028800 | Ga0265338_10656703 | Ga0265338_106567031 | 153 |
| 606 | 3300031711 | Ga0265314_10013729 | Ga0265314_100137297 | 153 |
| 607 | 3300031712 | Ga0265342_10192479 | Ga0265342_101924792 | 153 |
| 608 | 3300032002 | Ga0307416_100922927 | Ga0307416_1009229272 | 153 |
| 609 | 3300035170 | Ga0373943_0571512 | Ga0373943_0571512_74_598 | 153 |
| 610 | 3300035171 | Ga0373946_0369495 | Ga0373946_0369495_51_575 | 153 |
| 611 | 3300035172 | Ga0373955_0273145 | Ga0373955_0273145_265_789 | 153 |
| 612 | 3300044712 | Ga0453684_0121001 | Ga0453684_0121001_389_979 | 153 |
| 613 | 3300046454 | Ga0495592_0087298 | Ga0495592_0087298_759_1283 | 153 |
| 614 | 3300046455 | Ga0495603_0566865 | Ga0495603_0566865_79_606 | 153 |
| 615 | 3300046473 | Ga0495582_0041828 | Ga0495582_0041828_1284_1808 | 153 |
| 616 | 3300046475 | Ga0495639_0206318 | Ga0495639_0206318_333_857 | 153 |
| 617 | 3300046501 | Ga0495607_0238917 | Ga0495607_0238917_290_817 | 153 |
| 618 | 3300046511 | Ga0495608_0039741 | Ga0495608_0039741_1389_1913 | 153 |
| 619 | 3300046516 | Ga0495628_0154047 | Ga0495628_0154047_1105_1629 | 153 |
| 620 | 3300046517 | Ga0495630_0010900 | Ga0495630_0010900_215_739 | 153 |
| 621 | 3300046529 | Ga0495652_0401588 | Ga0495652_0401588_270_794 | 153 |
| 622 | 3300046536 | Ga0495587_0053831 | Ga0495587_0053831_1316_1840 | 153 |
| 623 | 3300046675 | Ga0495657_0047275 | Ga0495657_0047275_479_1003 | 153 |
| 624 | 3300046678 | Ga0495599_0110128 | Ga0495599_0110128_1083_1607 | 153 |
| 625 | 3300046681 | Ga0495647_0029173 | Ga0495647_0029173_1029_1556 | 153 |
| 626 | 3300046689 | Ga0495613_0013985 | Ga0495613_0013985_130_654 | 153 |
| 627 | 3300046691 | Ga0495670_0481795 | Ga0495670_0481795_11_538 | 153 |
| 628 | 3300046809 | Ga0495600_0488459 | Ga0495600_0488459_124_648 | 153 |
| 629 | 3300047317 | Ga0495604_0039449 | Ga0495604_0039449_2440_2964 | 153 |
| 630 | 3300047319 | Ga0495674_0044746 | Ga0495674_0044746_362_886 | 153 |
| 631 | 3300047322 | Ga0495680_0155995 | Ga0495680_0155995_695_1219 | 153 |
| 632 | 3300047471 | Ga0495684_0001687 | Ga0495684_0001687_16758_17282 | 153 |
| 633 | 3300048915 | Ga0496112_0394138 | Ga0496112_0394138_461_985 | 153 |
| 634 | 3300048917 | Ga0496114_0172098 | Ga0496114_0172098_957_1484 | 153 |
| 635 | 3300049534 | Ga0501318_058812 | Ga0501318_058812_13_537 | 153 |
| 636 | 3300049584 | Ga0501068_0172060 | Ga0501068_0172060_724_1248 | 153 |
| 637 | 3300050493 | nmdc:mga0k408_227432_c1 | nmdc:mga0k408_227432_c1_268_891 | 153 |
| 638 | 3300050507 | nmdc:mga05p37_411029_c1 | nmdc:mga05p37_411029_c1_814_1338 | 153 |
| 639 | 3300050510 | nmdc:mga06r32_490383_c1 | nmdc:mga06r32_490383_c1_506_1063 | 153 |
| 640 | 3300050515 | nmdc:mga0a205_193005_c1 | nmdc:mga0a205_193005_c1_145_669 | 153 |
| 641 | 3300050515 | nmdc:mga0a205_616154_c1 | nmdc:mga0a205_616154_c1_100_624 | 153 |
| 642 | 3300053077 | Ga0495601_0040645 | Ga0495601_0040645_517_1041 | 153 |
| 643 | 3300053078 | Ga0495612_0184035 | Ga0495612_0184035_240_764 | 153 |
| 644 | 3300053084 | Ga0495595_0015791 | Ga0495595_0015791_1494_2018 | 153 |
| 645 | 3300060353 | Ga0501082_0139167 | Ga0501082_0139167_386_913 | 153 |
| 646 | 3300005615 | Ga0070702_100096432 | Ga0070702_1000964322 | 154 |
| 647 | 3300005842 | Ga0068858_100793695 | Ga0068858_1007936952 | 154 |
| 648 | 3300006237 | Ga0097621_100238936 | Ga0097621_1002389363 | 154 |
| 649 | 3300009148 | Ga0105243_11686437 | Ga0105243_116864372 | 154 |
| 650 | 3300013297 | Ga0157378_10067386 | Ga0157378_100673864 | 154 |
| 651 | 3300042156 | Ga0439446_0172916 | Ga0439446_0172916_24_590 | 154 |
| 652 | 3300042461 | Ga0439460_0019860 | Ga0439460_0019860_75_602 | 154 |
| 653 | 3300049586 | Ga0501070_0443810 | Ga0501070_0443810_188_727 | 154 |
| 654 | 3300053103 | Ga0500555_000474 | Ga0500555_000474_8688_9224 | 154 |
| 655 | 3300053104 | Ga0500556_0001889 | Ga0500556_0001889_1048_1578 | 154 |
| 656 | 3300053153 | Ga0500616_0000173 | Ga0500616_0000173_14145_14681 | 154 |
| 657 | 3300059421 | Ga0590071_010704 | Ga0590071_010704_323_892 | 154 |
| 658 | 3300059424 | Ga0590075_059940 | Ga0590075_059940_115_684 | 154 |
| 659 | 3300049575 | Ga0501039_0924243 | Ga0501039_0924243_34_591 | 155 |
| 660 | 3300049592 | Ga0501076_0161703 | Ga0501076_0161703_951_1508 | 155 |
| 661 | 3300006178 | Ga0075367_10010203 | Ga0075367_100102035 | 157 |
| 662 | 3300027866 | Ga0209813_10100043 | Ga0209813_101000432 | 157 |
| 663 | 3300028379 | Ga0268266_10219488 | Ga0268266_102194881 | 157 |
| 664 | 3300046615 | Ga0495656_0119836 | Ga0495656_0119836_324_872 | 157 |
| 665 | 3300050491 | nmdc:mga00v17_169418_c1 | nmdc:mga00v17_169418_c1_246_872 | 157 |
| 666 | 3300050494 | nmdc:mga06z11_54011_c1 | nmdc:mga06z11_54011_c1_1394_2020 | 157 |
| 667 | 3300050495 | nmdc:mga04h51_118064_c1 | nmdc:mga04h51_118064_c1_95_721 | 157 |
| 668 | 3300053139 | Ga0500568_0002524 | Ga0500568_0002524_2016_2687 | 158 |
| 669 | 3300031824 | Ga0307413_10091526 | Ga0307413_100915263 | 159 |
| 670 | 3300005331 | Ga0070670_100362036 | Ga0070670_1003620362 | 161 |
| 671 | 3300004800 | Ga0058861_12003411 | Ga0058861_120034113 | 213 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar