F474112

General Info

Members Datasets Scaffolds Average Seq Length
670 317 647 210

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0098238|Ga0496117_0098238_785_1468
Length 227
Sequence VLDYIRDAAEIYRQSFAAIRAEADLTRFPDDVARVVVRLIHTCGQVDVAEHVAYTDDVVARAGAALRRGAPVLCDSSMVAAGITTARLPAGNEVVSLVADPRAPELAARRRTTRSAAAVELWAERLAGAVLAIGNAPTALFRLLELIDEGVSPPAAVLGGPVGFVGSAQSKQELIERPRGMAYLVVRGRRGGSAMAAAALNAIASDSELPGAASYLGWGWGPAIRSW

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
4 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
5 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
6 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
7 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
8 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
9 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
10 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
11 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
12 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
13 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
14 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
15 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
16 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
17 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
18 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
19 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
20 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
21 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
22 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
23 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
24 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
127 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
184 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
185 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
186 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
199 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
200 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
201 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
205 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
210 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
211 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
212 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
213 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
214 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
215 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
216 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
217 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
218 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
219 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
232 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
233 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
237 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
238 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
241 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
246 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
247 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
267 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
270 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
273 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
274 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
275 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
276 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
289 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
290 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
291 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
292 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
296 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
297 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
298 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
299 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
300 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
301 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
306 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
307 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
308 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
309 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
310 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
311 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
312 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
313 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
314 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
315 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
316 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
317 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.42
Metatranscriptomes 0.15
Isolates 3.43

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 11.19
Nodule 0.15
Rhizoplane 12.69
Rhizosphere 65.37
Stem 0
Stem Tuber 0
Unclassified 10.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001858 3300001977 Bacteria 3367
2 JGI24739J22299_10130990 3300001989 Bacteria 746
3 JGI24744J21845_10000510 3300002077 Bacteria 6920
4 Ga0055540_1000003 3300003792 Bacteria 428375
5 Ga0055540_1000883 3300003792 Bacteria 19852
6 Ga0055540_1014578 3300003792 Bacteria 2332
7 Ga0070676_10008262 3300005328 Bacteria 5604
8 Ga0070676_10410933 3300005328 Bacteria 944
9 Ga0070683_100231016 3300005329 Bacteria 1759
10 Ga0070683_100364963 3300005329 Bacteria 1375
11 Ga0070690_100035522 3300005330 Bacteria 3128
12 Ga0070690_100505548 3300005330 Bacteria 905
13 Ga0068869_100017057 3300005334 Bacteria 4913
14 Ga0070666_10085278 3300005335 Bacteria 2163
15 Ga0070666_10163932 3300005335 Bacteria 1554
16 Ga0070680_100226992 3300005336 Bacteria 1577
17 Ga0070682_100020291 3300005337 Bacteria 3909
18 Ga0070682_100103520 3300005337 Bacteria 1884
19 Ga0070682_100437656 3300005337 Bacteria 998
20 Ga0068868_100000368 3300005338 Bacteria 30659
21 Ga0068868_100691825 3300005338 Bacteria 911
22 Ga0068868_100760211 3300005338 Bacteria 871
23 Ga0070660_100078661 3300005339 Bacteria 2586
24 Ga0070689_100007743 3300005340 Bacteria 7529
25 Ga0070689_100063106 3300005340 Bacteria 2883
26 Ga0070691_10000295 3300005341 Bacteria 17402
27 Ga0070687_100142883 3300005343 Bacteria 1396
28 Ga0070661_100957183 3300005344 Bacteria 709
29 Ga0070692_10096628 3300005345 Bacteria 1614
30 Ga0070668_100000317 3300005347 Bacteria 31873
31 Ga0070668_100007746 3300005347 Bacteria 7972
32 Ga0070668_100064891 3300005347 Bacteria 2832
33 Ga0070668_100819976 3300005347 Bacteria 828
34 Ga0070669_100000608 3300005353 Bacteria 26606
35 Ga0070669_100001421 3300005353 Bacteria 17305
36 Ga0070671_100000885 3300005355 Bacteria 21862
37 Ga0070671_100112141 3300005355 Bacteria 2291
38 Ga0070671_100164488 3300005355 Bacteria 1876
39 Ga0070674_100000546 3300005356 Bacteria 18863
40 Ga0070674_100889148 3300005356 Bacteria 775
41 Ga0070659_100014528 3300005366 Bacteria 5884
42 Ga0070659_100097283 3300005366 Bacteria 2365
43 Ga0070667_100000449 3300005367 Bacteria 42699
44 Ga0070667_100001275 3300005367 Bacteria 22797
45 Ga0070667_100001922 3300005367 Bacteria 18430
46 Ga0070667_100010892 3300005367 Bacteria 7522
47 Ga0070667_100045599 3300005367 Bacteria 3686
48 Ga0070667_100062358 3300005367 Bacteria 3158
49 Ga0070667_100321273 3300005367 Bacteria 1397
50 Ga0070709_10020423 3300005434 Bacteria 3842
51 Ga0070709_10043149 3300005434 Bacteria 2788
52 Ga0070714_100343671 3300005435 Bacteria 1400
53 Ga0070710_10001273 3300005437 Bacteria 11973
54 Ga0070701_10000553 3300005438 Bacteria 12945
55 Ga0070711_100000373 3300005439 Bacteria 23196
56 Ga0070711_100001530 3300005439 Bacteria 12732
57 Ga0070705_100013036 3300005440 Bacteria 4242
58 Ga0070705_100029378 3300005440 Bacteria 3023
59 Ga0070705_100254699 3300005440 Bacteria 1234
60 Ga0070700_100001198 3300005441 Bacteria 12851
61 Ga0070700_100020109 3300005441 Bacteria 3861
62 Ga0070700_100603127 3300005441 Bacteria 860
63 Ga0070694_100405688 3300005444 Bacteria 1068
64 Ga0070708_101074948 3300005445 Bacteria 754
65 Ga0070663_100035641 3300005455 Bacteria 3453
66 Ga0070663_100409456 3300005455 Bacteria 1110
67 Ga0070678_100000037 3300005456 Bacteria 43961
68 Ga0070678_100083646 3300005456 Bacteria 2426
69 Ga0070678_100276816 3300005456 Bacteria 1417
70 Ga0070678_100528260 3300005456 Bacteria 1045
71 Ga0070662_100007600 3300005457 Bacteria 7036
72 Ga0070662_100315991 3300005457 Bacteria 1273
73 Ga0068867_100000663 3300005459 Bacteria 22813
74 Ga0070685_10020288 3300005466 Bacteria 3597
75 Ga0070697_100182750 3300005536 Bacteria 1778
76 Ga0068853_100001014 3300005539 Bacteria 19779
77 Ga0068853_100012220 3300005539 Bacteria 6982
78 Ga0070686_100023920 3300005544 Bacteria 3657
79 Ga0070686_100039417 3300005544 Bacteria 2944
80 Ga0070695_100002297 3300005545 Bacteria 10958
81 Ga0070696_100002252 3300005546 Bacteria 12720
82 Ga0070696_100035906 3300005546 Bacteria 3415
83 Ga0070665_100002725 3300005548 Bacteria 19146
84 Ga0070665_100009036 3300005548 Bacteria 10095
85 Ga0070665_100335011 3300005548 Bacteria 1518
86 Ga0070704_100000167 3300005549 Bacteria 26061
87 Ga0070704_100281754 3300005549 Bacteria 1377
88 Ga0068854_100000837 3300005578 Bacteria 18405
89 Ga0068854_100115768 3300005578 Bacteria 2028
90 Ga0068854_100300934 3300005578 Bacteria 1297
91 Ga0068854_100497279 3300005578 Bacteria 1026
92 Ga0070702_100000221 3300005615 Bacteria 19181
93 Ga0068852_100097272 3300005616 Bacteria 2648
94 Ga0068859_100000115 3300005617 Bacteria 75584
95 Ga0068859_100003512 3300005617 Bacteria 15966
96 Ga0068859_100254287 3300005617 Bacteria 1847
97 Ga0068859_100642288 3300005617 Bacteria 1153
98 Ga0068864_100281608 3300005618 Bacteria 1552
99 Ga0068864_100860380 3300005618 Bacteria 894
100 Ga0068864_101429512 3300005618 Bacteria 694
101 Ga0068866_10000433 3300005718 Bacteria 19396
102 Ga0068866_10014818 3300005718 Bacteria 3451
103 Ga0068861_100000054 3300005719 Bacteria 53529
104 Ga0068861_100719351 3300005719 Bacteria 930
105 Ga0068851_10130214 3300005834 Bacteria 1360
106 Ga0068863_100001736 3300005841 Bacteria 21578
107 Ga0068863_100004141 3300005841 Bacteria 14330
108 Ga0068863_100170764 3300005841 Bacteria 2086
109 Ga0068858_100000611 3300005842 Bacteria 37350
110 Ga0068858_100009518 3300005842 Bacteria 9271
111 Ga0068858_100243100 3300005842 Bacteria 1708
112 Ga0068858_100298082 3300005842 Bacteria 1538
113 Ga0068858_100716181 3300005842 Bacteria 974
114 Ga0068860_100000044 3300005843 Bacteria 225595
115 Ga0068860_100000518 3300005843 Bacteria 47295
116 Ga0068860_100394944 3300005843 Bacteria 1367
117 Ga0068860_100643541 3300005843 Bacteria 1068
118 Ga0068862_100000003 3300005844 Bacteria 369793
119 Ga0068862_100001262 3300005844 Bacteria 23799
120 Ga0068862_100114122 3300005844 Bacteria 2374
121 Ga0068862_100369474 3300005844 Bacteria 1335
122 Ga0081455_10034334 3300005937 Bacteria 4546
123 Ga0081455_10240099 3300005937 Bacteria 1332
124 Ga0075365_10069277 3300006038 Bacteria 2371
125 Ga0075365_10074156 3300006038 Bacteria 2295
126 Ga0075365_10083796 3300006038 Bacteria 2163
127 Ga0075365_10188425 3300006038 Bacteria 1443
128 Ga0075365_10204154 3300006038 Bacteria 1385
129 Ga0075368_10004196 3300006042 Bacteria 4855
130 Ga0075363_100036625 3300006048 Bacteria 2574
131 Ga0075363_100040520 3300006048 Bacteria 2455
132 Ga0075363_100180696 3300006048 Bacteria 1200
133 Ga0075363_100411439 3300006048 Bacteria 796
134 Ga0075364_10001027 3300006051 Bacteria 14820
135 Ga0075364_10006525 3300006051 Bacteria 6860
136 Ga0075364_10044590 3300006051 Bacteria 2885
137 Ga0075364_10128886 3300006051 Bacteria 1697
138 Ga0070715_10000541 3300006163 Bacteria 9922
139 Ga0070716_100004716 3300006173 Bacteria 6539
140 Ga0070716_100020070 3300006173 Bacteria 3504
141 Ga0070712_100000149 3300006175 Bacteria 37058
142 Ga0070712_100006865 3300006175 Bacteria 7094
143 Ga0075362_10015408 3300006177 Bacteria 3110
144 Ga0075362_10034265 3300006177 Bacteria 2212
145 Ga0075362_10154610 3300006177 Bacteria 1102
146 Ga0075367_10000319 3300006178 Bacteria 16995
147 Ga0075367_10364296 3300006178 Bacteria 913
148 Ga0075369_10001372 3300006186 Bacteria 8291
149 Ga0075369_10056795 3300006186 Bacteria 1701
150 Ga0075369_10305168 3300006186 Bacteria 743
151 Ga0075369_10312452 3300006186 Bacteria 735
152 Ga0075366_10072722 3300006195 Bacteria 2049
153 Ga0075370_10022798 3300006353 Bacteria 3442
154 Ga0075370_10047521 3300006353 Bacteria 2430
155 Ga0075370_10065067 3300006353 Bacteria 2079
156 Ga0068871_100026059 3300006358 Bacteria 4558
157 Ga0075428_100014509 3300006844 Bacteria 8751
158 Ga0075430_100936032 3300006846 Bacteria 714
159 Ga0075431_100024577 3300006847 Bacteria 6175
160 Ga0068865_100000280 3300006881 Bacteria 28132
161 Ga0068865_100059755 3300006881 Bacteria 2667
162 Ga0097620_100000115 3300006931 Bacteria 75584
163 Ga0097620_100003512 3300006931 Bacteria 15966
164 Ga0097620_100254309 3300006931 Bacteria 1847
165 Ga0097620_100642296 3300006931 Bacteria 1153
166 Ga0111539_10098088 3300009094 Bacteria 3442
167 Ga0105245_10000377 3300009098 Bacteria 41447
168 Ga0105245_10664927 3300009098 Bacteria 1073
169 Ga0105247_10000006 3300009101 Bacteria 416061
170 Ga0105247_10001325 3300009101 Bacteria 18063
171 Ga0105247_10088990 3300009101 Bacteria 1957
172 Ga0114129_10015258 3300009147 Bacteria 10934
173 Ga0105243_10000755 3300009148 Bacteria 31023
174 Ga0105243_10054529 3300009148 Bacteria 3174
175 Ga0105243_10500414 3300009148 Bacteria 1151
176 Ga0105241_10439071 3300009174 Bacteria 1152
177 Ga0105242_10000366 3300009176 Bacteria 36059
178 Ga0105242_11353990 3300009176 Bacteria 737
179 Ga0105248_10000062 3300009177 Bacteria 124366
180 Ga0105248_10005684 3300009177 Bacteria 13701
181 Ga0105248_10064178 3300009177 Bacteria 4123
182 Ga0105248_10414615 3300009177 Bacteria 1517
183 Ga0105237_10004702 3300009545 Bacteria 15713
184 Ga0105237_10037459 3300009545 Bacteria 4903
185 Ga0105238_10180343 3300009551 Bacteria 2089
186 Ga0105249_10000008 3300009553 Bacteria 341271
187 Ga0105249_10000641 3300009553 Bacteria 31931
188 Ga0105249_10002622 3300009553 Bacteria 15574
189 Ga0105239_10005099 3300010375 Bacteria 15506
190 Ga0105239_10009692 3300010375 Bacteria 10829
191 Ga0105239_10312017 3300010375 Bacteria 1773
192 Ga0105239_11186457 3300010375 Bacteria 879
193 Ga0105246_10025918 3300011119 Bacteria 3824
194 Ga0157374_10024956 3300013296 Bacteria 5363
195 Ga0157374_10058948 3300013296 Bacteria 3588
196 Ga0157378_10001832 3300013297 Bacteria 19089
197 Ga0163162_10002253 3300013306 Bacteria 18114
198 Ga0163162_10248625 3300013306 Bacteria 1910
199 Ga0163162_10719411 3300013306 Bacteria 1119
200 Ga0157372_10038543 3300013307 Bacteria 5274
201 Ga0157375_10002135 3300013308 Bacteria 17079
202 Ga0157375_10133375 3300013308 Bacteria 2605
203 Ga0163163_10162152 3300014325 Bacteria 2281
204 Ga0163163_10854240 3300014325 Bacteria 973
205 Ga0163163_10941852 3300014325 Bacteria 927
206 Ga0157380_10000116 3300014326 Bacteria 44047
207 Ga0157380_10022573 3300014326 Bacteria 4742
208 Ga0182008_10238479 3300014497 Bacteria 935
209 Ga0157377_10025833 3300014745 Bacteria 3136
210 Ga0157377_10248067 3300014745 Bacteria 1152
211 Ga0157379_10003618 3300014968 Bacteria 13115
212 Ga0157379_10633006 3300014968 Bacteria 1000
213 Ga0157376_11021086 3300014969 Bacteria 850
214 Ga0163161_10001682 3300017792 Bacteria 16227
215 Ga0163161_10420461 3300017792 Bacteria 1075
216 Ga0213876_10005413 3300021384 Bacteria 7027
217 Ga0213876_10015785 3300021384 Bacteria 3997
218 Ga0213876_10015815 3300021384 Bacteria 3993
219 Ga0213876_10059955 3300021384 Bacteria 2008
220 Ga0213876_10210755 3300021384 Bacteria 1033
221 Ga0213876_10297751 3300021384 Bacteria 857
222 Ga0213875_10004015 3300021388 Bacteria 8201
223 Ga0213875_10037620 3300021388 Bacteria 2280
224 Ga0209673_1031988 3300025273 Bacteria 1627
225 Ga0209673_1061471 3300025273 Bacteria 936
226 Ga0209051_1000011 3300025303 Bacteria 610828
227 Ga0209051_1001162 3300025303 Bacteria 23957
228 Ga0209051_1001628 3300025303 Bacteria 18205
229 Ga0207692_10003227 3300025898 Bacteria 6340
230 Ga0207642_10000079 3300025899 Bacteria 25260
231 Ga0207642_10093693 3300025899 Bacteria 1490
232 Ga0207642_10250778 3300025899 Bacteria 1004
233 Ga0207710_10000025 3300025900 Bacteria 314658
234 Ga0207710_10002391 3300025900 Bacteria 8758
235 Ga0207710_10029722 3300025900 Bacteria 2380
236 Ga0207688_10001038 3300025901 Bacteria 14239
237 Ga0207688_10004437 3300025901 Bacteria 7638
238 Ga0207685_10005401 3300025905 Bacteria 3371
239 Ga0207685_10143676 3300025905 Bacteria 1072
240 Ga0207699_10017065 3300025906 Bacteria 3812
241 Ga0207699_10135009 3300025906 Bacteria 1614
242 Ga0207645_10011399 3300025907 Bacteria 6073
243 Ga0207645_10146461 3300025907 Bacteria 1540
244 Ga0207671_10014029 3300025914 Bacteria 6354
245 Ga0207671_10147538 3300025914 Bacteria 1815
246 Ga0207693_10002006 3300025915 Bacteria 17867
247 Ga0207693_10004717 3300025915 Bacteria 11468
248 Ga0207663_10000753 3300025916 Bacteria 14446
249 Ga0207663_10004414 3300025916 Bacteria 6984
250 Ga0207660_10204815 3300025917 Bacteria 1542
251 Ga0207662_10098206 3300025918 Bacteria 1812
252 Ga0207657_10419673 3300025919 Bacteria 1051
253 Ga0207652_10226824 3300025921 Bacteria 1684
254 Ga0207681_10004038 3300025923 Bacteria 9104
255 Ga0207681_10019492 3300025923 Bacteria 4286
256 Ga0207694_10101320 3300025924 Bacteria 2282
257 Ga0207659_10323353 3300025926 Bacteria 1273
258 Ga0207687_10011682 3300025927 Bacteria 5743
259 Ga0207700_10252700 3300025928 Bacteria 1506
260 Ga0207664_10464633 3300025929 Bacteria 1130
261 Ga0207644_10015232 3300025931 Bacteria 5159
262 Ga0207644_10039181 3300025931 Bacteria 3344
263 Ga0207644_10078781 3300025931 Bacteria 2429
264 Ga0207644_10160271 3300025931 Bacteria 1748
265 Ga0207690_10004486 3300025932 Bacteria 8243
266 Ga0207690_10143708 3300025932 Bacteria 1761
267 Ga0207706_10002057 3300025933 Bacteria 19713
268 Ga0207706_10088809 3300025933 Bacteria 2717
269 Ga0207686_10012506 3300025934 Bacteria 4667
270 Ga0207686_10556506 3300025934 Bacteria 897
271 Ga0207709_10001983 3300025935 Bacteria 13354
272 Ga0207670_10023492 3300025936 Bacteria 3839
273 Ga0207669_10000369 3300025937 Bacteria 20182
274 Ga0207704_10000212 3300025938 Bacteria 29411
275 Ga0207665_10006390 3300025939 Bacteria 7818
276 Ga0207665_10016697 3300025939 Bacteria 4821
277 Ga0207711_10000358 3300025941 Bacteria 48462
278 Ga0207711_10041132 3300025941 Bacteria 3935
279 Ga0207711_10176485 3300025941 Bacteria 1941
280 Ga0207689_10007708 3300025942 Bacteria 9422
281 Ga0207661_10112191 3300025944 Bacteria 2308
282 Ga0207661_10192211 3300025944 Bacteria 1790
283 Ga0207667_10247433 3300025949 Bacteria 1824
284 Ga0207651_10224301 3300025960 Bacteria 1521
285 Ga0207712_10000011 3300025961 Bacteria 412321
286 Ga0207712_10004542 3300025961 Bacteria 8759
287 Ga0207668_10001402 3300025972 Bacteria 14196
288 Ga0207668_10004333 3300025972 Bacteria 8331
289 Ga0207668_10028012 3300025972 Bacteria 3678
290 Ga0207668_10438541 3300025972 Bacteria 1112
291 Ga0207640_10011223 3300025981 Bacteria 5068
292 Ga0207640_10209008 3300025981 Bacteria 1485
293 Ga0207640_10237538 3300025981 Bacteria 1406
294 Ga0207640_10543522 3300025981 Bacteria 975
295 Ga0207658_10000387 3300025986 Bacteria 42781
296 Ga0207658_10001930 3300025986 Bacteria 15477
297 Ga0207658_10011470 3300025986 Bacteria 6031
298 Ga0207658_10041021 3300025986 Bacteria 3349
299 Ga0207658_10050680 3300025986 Bacteria 3056
300 Ga0207658_10104058 3300025986 Bacteria 2230
301 Ga0207677_10009463 3300026023 Bacteria 5484
302 Ga0207677_10159070 3300026023 Bacteria 1753
303 Ga0207703_10007381 3300026035 Bacteria 8732
304 Ga0207703_10044490 3300026035 Bacteria 3568
305 Ga0207703_10217904 3300026035 Bacteria 1705
306 Ga0207703_10717427 3300026035 Bacteria 951
307 Ga0207639_10004955 3300026041 Bacteria 8968
308 Ga0207639_10012602 3300026041 Bacteria 5892
309 Ga0207678_10037419 3300026067 Bacteria 4220
310 Ga0207678_10231975 3300026067 Bacteria 1580
311 Ga0207678_10271153 3300026067 Bacteria 1455
312 Ga0207708_10002240 3300026075 Bacteria 14255
313 Ga0207708_10033635 3300026075 Bacteria 3896
314 Ga0207702_10517303 3300026078 Bacteria 1165
315 Ga0207641_10000450 3300026088 Bacteria 47057
316 Ga0207641_10011586 3300026088 Bacteria 7237
317 Ga0207641_10546189 3300026088 Bacteria 1129
318 Ga0207648_10000231 3300026089 Bacteria 59662
319 Ga0207648_10061408 3300026089 Bacteria 3277
320 Ga0207676_10623168 3300026095 Bacteria 1038
321 Ga0207676_10916504 3300026095 Bacteria 860
322 Ga0207675_100000398 3300026118 Bacteria 41651
323 Ga0207675_100047669 3300026118 Bacteria 4000
324 Ga0207675_100077890 3300026118 Bacteria 3106
325 Ga0207675_100355527 3300026118 Bacteria 1436
326 Ga0207675_100392835 3300026118 Bacteria 1366
327 Ga0207683_10000128 3300026121 Bacteria 62142
328 Ga0207683_10018223 3300026121 Bacteria 5989
329 Ga0207698_10060585 3300026142 Bacteria 2944
330 Ga0268266_10005109 3300028379 Bacteria 12367
331 Ga0268266_10005399 3300028379 Bacteria 11934
332 Ga0268266_10181355 3300028379 Bacteria 1917
333 Ga0268266_11150424 3300028379 Bacteria 751
334 Ga0268265_10000010 3300028380 Bacteria 370129
335 Ga0268265_10051370 3300028380 Bacteria 3111
336 Ga0268264_10000007 3300028381 Bacteria 815790
337 Ga0268264_10001462 3300028381 Bacteria 22074
338 Ga0268264_10457573 3300028381 Bacteria 1237
339 Ga0265338_10031399 3300028800 Bacteria 5209
340 Ga0316177_1030021 3300030731 Bacteria 919
341 Ga0316176_1108788 3300030732 Bacteria 2750
342 Ga0314311_1004140 3300030733 Bacteria 3540
343 Ga0316180_1058331 3300030736 Bacteria 1060
344 Ga0265327_10000825 3300031251 Bacteria 46672
345 Ga0265327_10001171 3300031251 Bacteria 35592
346 Ga0265327_10028441 3300031251 Bacteria 3198
347 Ga0265327_10043730 3300031251 Bacteria 2394
348 Ga0307408_100838391 3300031548 Bacteria 837
349 Ga0316578_10014326 3300031728 Bacteria 4233
350 Ga0307413_10161914 3300031824 Bacteria 1573
351 Ga0307406_10379966 3300031901 Bacteria 1113
352 Ga0307406_10763107 3300031901 Bacteria 813
353 Ga0307407_10156312 3300031903 Bacteria 1488
354 Ga0307412_10414974 3300031911 Bacteria 1100
355 Ga0307412_11227716 3300031911 Bacteria 672
356 Ga0307409_100109405 3300031995 Bacteria 2314
357 Ga0307416_100076630 3300032002 Bacteria 2804
358 Ga0307416_101310867 3300032002 Bacteria 830
359 Ga0307414_10839778 3300032004 Bacteria 839
360 Ga0307415_100633615 3300032126 Bacteria 956
361 Ga0373948_0018989 3300034817 Bacteria 1296
362 Ga0373959_0036356 3300034820 Bacteria 1016
363 Ga0373929_0074450 3300035085 Bacteria 817
364 Ga0373952_0016452 3300035092 Bacteria 1504
365 Ga0373931_0015952 3300035691 Bacteria 3692
366 Ga0373947_0059509 3300035725 Bacteria 2316
367 Ga0372808_000543 3300036459 Bacteria 3095
368 Ga0316584_0149949 3300036712 Bacteria 1736
369 Ga0395898_0463178 3300037466 Bacteria 1207
370 Ga0436364_0185516 3300037853 Bacteria 19672
371 Ga0436364_0793855 3300037853 Bacteria 3148
372 Ga0436365_0434410 3300039437 Bacteria 16475
373 Ga0436365_0674802 3300039437 Bacteria 19112
374 Ga0436365_0708236 3300039437 Bacteria 25469
375 Ga0436365_1329591 3300039437 Bacteria 10319
376 Ga0436365_1931466 3300039437 Bacteria 2996
377 Ga0436363_1277218 3300039450 Bacteria 923
378 Ga0436363_1338388 3300039450 Bacteria 8210
379 Ga0439461_0002376 3300041410 Bacteria 2998
380 Ga0439466_0003950 3300041411 Bacteria 5717
381 Ga0439466_0016027 3300041411 Bacteria 2714
382 Ga0439466_0021631 3300041411 Bacteria 2276
383 Ga0439466_0061425 3300041411 Bacteria 1209
384 Ga0439465_0000487 3300041413 Bacteria 11799
385 Ga0439465_0001464 3300041413 Bacteria 7651
386 Ga0439465_0027949 3300041413 Bacteria 1787
387 Ga0451791_1249914 3300041451 Bacteria 1032
388 Ga0439431_0003360 3300041997 Bacteria 3518
389 Ga0439442_022750 3300042002 Bacteria 1302
390 Ga0439445_0001092 3300042004 Bacteria 5797
391 Ga0439434_0007297 3300042435 Bacteria 3239
392 Ga0466972_0002789 3300044658 Bacteria 8662
393 Ga0466972_0019631 3300044658 Bacteria 3379
394 Ga0466972_0031037 3300044658 Bacteria 2630
395 Ga0466972_0052171 3300044658 Bacteria 1972
396 Ga0466965_0020025 3300044683 Bacteria 3214
397 Ga0466965_0020335 3300044683 Bacteria 3190
398 Ga0466965_0023239 3300044683 Bacteria 2993
399 Ga0466965_0026034 3300044683 Bacteria 2834
400 Ga0466966_0045383 3300044684 Bacteria 2809
401 Ga0466966_0445420 3300044684 Bacteria 778
402 Ga0466961_0008283 3300044693 Bacteria 6619
403 Ga0466963_0009064 3300044694 Bacteria 5980
404 Ga0466963_0143369 3300044694 Bacteria 1656
405 Ga0466971_0347592 3300044719 Bacteria 717
406 Ga0466968_0012489 3300044735 Bacteria 3326
407 Ga0466968_0026999 3300044735 Bacteria 2360
408 Ga0466968_0035172 3300044735 Bacteria 2095
409 Ga0466970_0014776 3300044765 Bacteria 4012
410 Ga0466970_0048192 3300044765 Bacteria 2271
411 Ga0466970_0127678 3300044765 Bacteria 1395
412 Ga0466957_0029594 3300044842 Bacteria 3267
413 Ga0466957_0055843 3300044842 Bacteria 2413
414 Ga0466957_0110072 3300044842 Bacteria 1746
415 Ga0466960_0000101 3300044901 Bacteria 28225
416 Ga0466960_0000133 3300044901 Bacteria 25184
417 Ga0466960_0000933 3300044901 Bacteria 10335
418 Ga0466960_0020001 3300044901 Bacteria 2959
419 Ga0466959_0015686 3300045049 Bacteria 5524
420 Ga0466959_0057556 3300045049 Bacteria 2833
421 Ga0466959_0068639 3300045049 Bacteria 2568
422 Ga0466959_0162869 3300045049 Bacteria 1567
423 Ga0466958_0001122 3300045836 Bacteria 12366
424 Ga0466958_0111650 3300045836 Bacteria 1707
425 Ga0466967_0005423 3300045976 Bacteria 8838
426 Ga0466967_0032467 3300045976 Bacteria 4409
427 Ga0466967_0034160 3300045976 Bacteria 4313
428 Ga0466967_0071500 3300045976 Bacteria 3107
429 Ga0466967_0274376 3300045976 Bacteria 1616
430 Ga0466967_0310803 3300045976 Bacteria 1518
431 Ga0466967_0350393 3300045976 Bacteria 1429
432 Ga0466967_0362300 3300045976 Bacteria 1405
433 Ga0466967_0872519 3300045976 Bacteria 894
434 Ga0495603_0059116 3300046455 Bacteria 2266
435 Ga0495638_0005329 3300046460 Bacteria 9591
436 Ga0495638_0013236 3300046460 Bacteria 5626
437 Ga0495641_0020991 3300046461 Bacteria 3296
438 Ga0495582_0026802 3300046473 Bacteria 3159
439 Ga0495630_0280023 3300046517 Bacteria 1274
440 Ga0495644_0108466 3300046523 Bacteria 1053
441 Ga0495648_0009272 3300046524 Bacteria 7649
442 Ga0495666_0069975 3300046526 Bacteria 1669
443 Ga0495652_0308664 3300046529 Bacteria 1147
444 Ga0495640_0025396 3300046533 Bacteria 4298
445 Ga0495622_0118289 3300046557 Bacteria 1211
446 Ga0495625_0152503 3300046660 Bacteria 1553
447 Ga0495658_0015674 3300046683 Bacteria 3891
448 Ga0495674_0114660 3300047319 Bacteria 2281
449 Ga0495672_0054223 3300047320 Bacteria 2345
450 Ga0495676_0039056 3300047321 Bacteria 3936
451 Ga0495673_0000862 3300047469 Bacteria 28098
452 Ga0495686_0004602 3300047472 Bacteria 11244
453 Ga0495626_0070877 3300048091 Bacteria 1567
454 Ga0496100_0000041 3300048903 Bacteria 92857
455 Ga0496100_0001769 3300048903 Bacteria 10785
456 Ga0496100_0011177 3300048903 Bacteria 5102
457 Ga0496100_0047118 3300048903 Bacteria 2776
458 Ga0496100_0100852 3300048903 Bacteria 1989
459 Ga0496100_0193381 3300048903 Bacteria 1478
460 Ga0496100_0431194 3300048903 Bacteria 1008
461 Ga0496101_0000019 3300048904 Bacteria 220382
462 Ga0496101_0000281 3300048904 Bacteria 35945
463 Ga0496101_0000628 3300048904 Bacteria 21425
464 Ga0496101_0013388 3300048904 Bacteria 5492
465 Ga0496101_0022858 3300048904 Bacteria 4311
466 Ga0496101_0037722 3300048904 Bacteria 3430
467 Ga0496101_0182725 3300048904 Bacteria 1615
468 Ga0496101_0236044 3300048904 Bacteria 1422
469 Ga0496102_0000007 3300048905 Bacteria 417224
470 Ga0496102_0000060 3300048905 Bacteria 167774
471 Ga0496102_0007600 3300048905 Bacteria 9261
472 Ga0496102_0025906 3300048905 Bacteria 5224
473 Ga0496102_0041638 3300048905 Bacteria 4160
474 Ga0496102_0129681 3300048905 Bacteria 2359
475 Ga0496102_0182657 3300048905 Bacteria 1976
476 Ga0496102_0328879 3300048905 Bacteria 1440
477 Ga0496103_0000013 3300048906 Bacteria 297928
478 Ga0496103_0000350 3300048906 Bacteria 41942
479 Ga0496103_0000704 3300048906 Bacteria 24748
480 Ga0496103_0007629 3300048906 Bacteria 6436
481 Ga0496103_0070718 3300048906 Bacteria 2183
482 Ga0496103_0115753 3300048906 Bacteria 1705
483 Ga0496103_0206325 3300048906 Bacteria 1264
484 Ga0496103_0426278 3300048906 Bacteria 851
485 Ga0496103_0548983 3300048906 Bacteria 738
486 Ga0496104_0004319 3300048907 Bacteria 12367
487 Ga0496104_0005624 3300048907 Bacteria 10978
488 Ga0496104_0550376 3300048907 Bacteria 1065
489 Ga0496105_0141317 3300048908 Bacteria 1981
490 Ga0496105_0488685 3300048908 Bacteria 968
491 Ga0496105_0710277 3300048908 Bacteria 771
492 Ga0496106_0000167 3300048909 Bacteria 47656
493 Ga0496106_0001593 3300048909 Bacteria 17059
494 Ga0496106_0009916 3300048909 Bacteria 7033
495 Ga0496106_0011697 3300048909 Bacteria 6481
496 Ga0496107_0001007 3300048910 Bacteria 16826
497 Ga0496107_0005371 3300048910 Bacteria 8766
498 Ga0496107_0011959 3300048910 Bacteria 6058
499 Ga0496107_0192189 3300048910 Bacteria 1517
500 Ga0496107_0199668 3300048910 Bacteria 1487
501 Ga0496107_0511308 3300048910 Bacteria 891
502 Ga0496108_0000986 3300048911 Bacteria 22141
503 Ga0496108_0012411 3300048911 Bacteria 6933
504 Ga0496108_0031378 3300048911 Bacteria 4409
505 Ga0496108_0205308 3300048911 Bacteria 1710
506 Ga0496108_0441944 3300048911 Bacteria 1136
507 Ga0496108_0973434 3300048911 Bacteria 726
508 Ga0496109_0001228 3300048912 Bacteria 21283
509 Ga0496109_0003917 3300048912 Bacteria 12437
510 Ga0496109_0011898 3300048912 Bacteria 7491
511 Ga0496109_0152434 3300048912 Bacteria 2164
512 Ga0496109_0438551 3300048912 Bacteria 1234
513 Ga0496110_0035065 3300048913 Bacteria 4350
514 Ga0496110_0058739 3300048913 Bacteria 3388
515 Ga0496110_0067413 3300048913 Bacteria 3167
516 Ga0496110_0169635 3300048913 Bacteria 1980
517 Ga0496110_0230661 3300048913 Bacteria 1684
518 Ga0496111_0045510 3300048914 Bacteria 3158
519 Ga0496111_0491727 3300048914 Bacteria 903
520 Ga0496112_0001398 3300048915 Bacteria 18441
521 Ga0496112_0012816 3300048915 Bacteria 7717
522 Ga0496112_0016413 3300048915 Bacteria 6937
523 Ga0496112_0018248 3300048915 Bacteria 6605
524 Ga0496112_0054898 3300048915 Bacteria 3915
525 Ga0496112_0363868 3300048915 Bacteria 1388
526 Ga0496112_0595227 3300048915 Bacteria 1038
527 Ga0496113_0018039 3300048916 Bacteria 4910
528 Ga0496113_0040891 3300048916 Bacteria 3418
529 Ga0496113_0083641 3300048916 Bacteria 2449
530 Ga0496114_0000070 3300048917 Bacteria 73843
531 Ga0496114_0001225 3300048917 Bacteria 19403
532 Ga0496114_0020927 3300048917 Bacteria 5313
533 Ga0496114_0159442 3300048917 Bacteria 1961
534 Ga0496115_0010632 3300048918 Bacteria 6883
535 Ga0496115_0016522 3300048918 Bacteria 5622
536 Ga0496115_0174547 3300048918 Bacteria 1777
537 Ga0496115_0176003 3300048918 Bacteria 1769
538 Ga0496116_0000033 3300048919 Bacteria 418191
539 Ga0496116_0022639 3300048919 Bacteria 4703
540 Ga0496116_0250048 3300048919 Bacteria 883
541 Ga0496117_0000025 3300048920 Bacteria 418106
542 Ga0496117_0000190 3300048920 Bacteria 125026
543 Ga0496117_0040290 3300048920 Bacteria 3436
544 Ga0496117_0098238 3300048920 Bacteria 1862
545 Ga0496118_0000023 3300048921 Bacteria 418106
546 Ga0496118_0001595 3300048921 Bacteria 33571
547 Ga0496118_0005068 3300048921 Bacteria 15168
548 Ga0496118_0028003 3300048921 Bacteria 4756
549 Ga0496119_0008733 3300048922 Bacteria 8841
550 Ga0496119_0054476 3300048922 Bacteria 2434
551 Ga0496119_0117736 3300048922 Bacteria 1464
552 Ga0496119_0177848 3300048922 Bacteria 1118
553 Ga0496120_0002095 3300048923 Bacteria 21379
554 Ga0496120_0017876 3300048923 Bacteria 4582
555 Ga0496121_0000016 3300048924 Bacteria 562911
556 Ga0496121_0000039 3300048924 Bacteria 351444
557 Ga0496121_0009738 3300048924 Bacteria 10992
558 Ga0496121_0338008 3300048924 Bacteria 1007
559 Ga0496122_0000470 3300048925 Bacteria 84015
560 Ga0496122_0023716 3300048925 Bacteria 5394
561 Ga0496123_0036255 3300048926 Bacteria 3500
562 Ga0496123_0047376 3300048926 Bacteria 2905
563 Ga0496124_0000015 3300048927 Bacteria 460700
564 Ga0496125_0000021 3300048928 Bacteria 460688
565 Ga0496125_0074773 3300048928 Bacteria 2625
566 Ga0496125_0150313 3300048928 Bacteria 1601
567 Ga0496126_0000015 3300048929 Bacteria 663212
568 Ga0496126_0000405 3300048929 Bacteria 87676
569 Ga0496126_0006611 3300048929 Bacteria 12907
570 Ga0496126_0015890 3300048929 Bacteria 7557
571 Ga0496126_0025402 3300048929 Bacteria 5699
572 Ga0496126_0093220 3300048929 Bacteria 2644
573 Ga0496126_0684288 3300048929 Bacteria 799
574 Ga0501032_0004043 3300049569 Bacteria 11127
575 Ga0501033_0130721 3300049570 Bacteria 1819
576 Ga0501034_0003080 3300049571 Bacteria 19235
577 Ga0501034_0004526 3300049571 Bacteria 15456
578 Ga0501034_0175650 3300049571 Bacteria 2108
579 Ga0501034_0669308 3300049571 Bacteria 938
580 Ga0501036_0030070 3300049572 Bacteria 4588
581 Ga0501036_0180311 3300049572 Bacteria 1778
582 Ga0501037_0000490 3300049573 Bacteria 32020
583 Ga0501037_0007789 3300049573 Bacteria 7842
584 Ga0501038_0021102 3300049574 Bacteria 5850
585 Ga0501039_0000886 3300049575 Bacteria 21754
586 Ga0501043_0007980 3300049579 Bacteria 8361
587 Ga0501043_0020547 3300049579 Bacteria 5180
588 Ga0501046_0000749 3300049580 Bacteria 31320
589 Ga0501047_0002869 3300049581 Bacteria 16359
590 Ga0501047_0262069 3300049581 Bacteria 1576
591 Ga0501047_0343161 3300049581 Bacteria 1331
592 Ga0501048_0007940 3300049582 Bacteria 8039
593 Ga0501067_0437485 3300049583 Bacteria 730
594 Ga0501070_0006186 3300049586 Bacteria 10199
595 Ga0501070_0012312 3300049586 Bacteria 7218
596 Ga0501071_0062549 3300049587 Bacteria 2697
597 Ga0501077_0154731 3300049593 Bacteria 1455
598 Ga0501083_0142994 3300049744 Bacteria 1566
599 Ga0501035_0015364 3300049822 Bacteria 7065
600 Ga0501044_0007663 3300049823 Bacteria 11872
601 Ga0501044_0007872 3300049823 Bacteria 11717
602 nmdc:mga03683_118149_c1 3300050489 Bacteria 1177
603 nmdc:mga03683_127903_c1 3300050489 Bacteria 1134
604 nmdc:mga03683_151651_c1 3300050489 Bacteria 1046
605 nmdc:mga03n38_215951_c1 3300050490 Bacteria 999
606 nmdc:mga03n38_26854_c1 3300050490 Bacteria 898
607 nmdc:mga03n38_37517_c1 3300050490 Bacteria 2091
608 nmdc:mga03n38_86466_c1 3300050490 Bacteria 1484
609 nmdc:mga00v17_142561_c1 3300050491 Bacteria 1537
610 nmdc:mga00v17_143058_c1 3300050491 Bacteria 1534
611 nmdc:mga00v17_226961_c1 3300050491 Bacteria 1210
612 nmdc:mga00v17_426031_c1 3300050491 Bacteria 862
613 nmdc:mga0yw44_249433_c1 3300050492 Bacteria 1181
614 nmdc:mga0yw44_293541_c1 3300050492 Bacteria 1088
615 nmdc:mga0yw44_599022_c1 3300050492 Bacteria 749
616 nmdc:mga0yw44_66800_c1 3300050492 Bacteria 2220
617 nmdc:mga0yw44_67531_c1 3300050492 Bacteria 1445
618 nmdc:mga0yw44_773231_c1 3300050492 Bacteria 652
619 nmdc:mga06z11_56244_c1 3300050494 Bacteria 2034
620 nmdc:mga06z11_74831_c1 3300050494 Bacteria 1801
621 nmdc:mga04h51_128420_c1 3300050495 Bacteria 951
622 nmdc:mga07m45_21630_c1 3300050496 Bacteria 3504
623 nmdc:mga07m45_314352_c1 3300050496 Bacteria 910
624 nmdc:mga07m45_71226_c1 3300050496 Bacteria 1978
625 nmdc:mga07m45_88910_c1 3300050496 Bacteria 1768
626 nmdc:mga0qj67_45064_c1 3300050509 Bacteria 3479
627 nmdc:mga06r32_19200_c1 3300050510 Bacteria 6273
628 nmdc:mga08y16_960557_c1 3300050511 Bacteria 837
629 nmdc:mga0sz30_17456_c2 3300050516 Bacteria 2332
630 nmdc:mga0sz30_2497_c1 3300050516 Bacteria 6557
631 nmdc:mga0sz30_32132_c2 3300050516 Bacteria 1874
632 Ga0500610_0177427 3300053079 Bacteria 1046
633 Ga0500635_0000964 3300053080 Bacteria 6924
634 Ga0500643_008359 3300053087 Bacteria 4070
635 Ga0500646_0039660 3300053090 Bacteria 1322
636 Ga0500641_0083516 3300053096 Bacteria 1358
637 Ga0500556_0123557 3300053104 Bacteria 1011
638 Ga0500562_007263 3300053108 Bacteria 2797
639 Ga0500652_014835 3300053131 Bacteria 2797
640 Ga0500561_0035811 3300053137 Bacteria 1283
641 Ga0500616_0107584 3300053153 Bacteria 1352
642 Ga0500616_0157063 3300053153 Bacteria 1046
643 Ga0500645_000054 3300053730 Bacteria 93914
644 Ga0500645_005840 3300053730 Bacteria 4472
645 Ga0466962_0058432 3300061719 Bacteria 1841
646 Ga0466962_0058458 3300061719 Bacteria 1840
647 Ga0466962_0206675 3300061719 Bacteria 960

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005344 Ga0070661_100957183 Ga0070661_1009571831 188
2 3300005578 Ga0068854_100497279 Ga0068854_1004972792 188
3 3300005618 Ga0068864_101429512 Ga0068864_1014295121 188
4 3300005834 Ga0068851_10130214 Ga0068851_101302141 188
5 3300014745 Ga0157377_10248067 Ga0157377_102480672 188
6 3300025981 Ga0207640_10209008 Ga0207640_102090082 188
7 3300026095 Ga0207676_10916504 Ga0207676_109165042 188
8 3300048913 Ga0496110_0058739 Ga0496110_0058739_1610_2236 188
9 3300048916 Ga0496113_0018039 Ga0496113_0018039_3099_3725 188
10 3300005329 Ga0070683_100364963 Ga0070683_1003649632 189
11 3300006048 Ga0075363_100040520 Ga0075363_1000405203 189
12 3300025944 Ga0207661_10112191 Ga0207661_101121913 189
13 3300048911 Ga0496108_0031378 Ga0496108_0031378_2014_2640 189
14 3300048912 Ga0496109_0011898 Ga0496109_0011898_5327_5953 189
15 3300048915 Ga0496112_0018248 Ga0496112_0018248_5772_6398 189
16 3300050490 nmdc:mga03n38_215951_c1 nmdc:mga03n38_215951_c1_200_826 189
17 3300044694 Ga0466963_0143369 Ga0466963_0143369_26_646 191
18 3300044735 Ga0466968_0035172 Ga0466968_0035172_124_744 191
19 3300044842 Ga0466957_0110072 Ga0466957_0110072_1098_1718 191
20 3300045049 Ga0466959_0162869 Ga0466959_0162869_22_642 191
21 3300006353 Ga0075370_10065067 Ga0075370_100650672 195
22 3300006038 Ga0075365_10069277 Ga0075365_100692773 201
23 3300006048 Ga0075363_100180696 Ga0075363_1001806962 201
24 3300006051 Ga0075364_10001027 Ga0075364_100010278 201
25 3300006186 Ga0075369_10056795 Ga0075369_100567952 201
26 3300006353 Ga0075370_10022798 Ga0075370_100227985 201
27 3300050490 nmdc:mga03n38_86466_c1 nmdc:mga03n38_86466_c1_430_1056 201
28 3300050491 nmdc:mga00v17_226961_c1 nmdc:mga00v17_226961_c1_265_891 201
29 3300050492 nmdc:mga0yw44_293541_c1 nmdc:mga0yw44_293541_c1_431_1057 201
30 3300050496 nmdc:mga07m45_71226_c1 nmdc:mga07m45_71226_c1_1287_1913 201
31 iso_pu_bacteria 2643221687 2644488722 204
32 iso_pu_bacteria 2643221715 2644633879 204
33 iso_pu_bacteria 2738541264 2738665157 204
34 iso_pu_bacteria 2738541274 2738704057 204
35 iso_pu_bacteria 2738541308 2738890309 204
36 iso_pu_bacteria 2738541356 2739144291 204
37 iso_pu_bacteria 2738543005 2739205016 204
38 iso_pu_bacteria 2738543028 2739334430 204
39 iso_pu_bacteria 2738543034 2739361751 204
40 iso_pu_bacteria 2842134933 2842137926 204
41 iso_pu_bacteria 2902792274 2902797685 204
42 iso_pu_bacteria 2902799365 2902800963 204
43 iso_pu_bacteria 2902810491 2902810796 204
44 iso_pu_bacteria 2902837492 2902838607 204
45 iso_pu_bacteria 2904765812 2904770881 204
46 iso_pu_bacteria 2904770941 2904771478 204
47 iso_pu_bacteria 2908811453 2908816289 204
48 iso_pu_bacteria 2919420072 2919423027 204
49 iso_pu_bacteria 2919432681 2919435635 204
50 iso_pu_bacteria 2929212328 2929216149 204
51 iso_pu_bacteria 2939582691 2939588242 204
52 iso_pu_bacteria 2974315732 2974317668 204
53 iso_pu_bacteria 2984523437 2984525879 204
54 3300005842 Ga0068858_100716181 Ga0068858_1007161812 205
55 3300025921 Ga0207652_10226824 Ga0207652_102268242 205
56 3300025928 Ga0207700_10252700 Ga0207700_102527002 205
57 3300028379 Ga0268266_11150424 Ga0268266_111504241 205
58 3300036459 Ga0372808_000543 Ga0372808_000543_1975_2601 205
59 3300037466 Ga0395898_0463178 Ga0395898_0463178_342_968 205
60 3300044842 Ga0466957_0029594 Ga0466957_0029594_2128_2748 205
61 3300045976 Ga0466967_0005423 Ga0466967_0005423_345_965 205
62 3300061719 Ga0466962_0058432 Ga0466962_0058432_497_1117 205
63 3300021384 Ga0213876_10015785 Ga0213876_100157852 206
64 3300021384 Ga0213876_10059955 Ga0213876_100599552 206
65 3300021388 Ga0213875_10004015 Ga0213875_1000401510 206
66 3300028800 Ga0265338_10031399 Ga0265338_100313993 206
67 3300030731 Ga0316177_1030021 Ga0316177_10300211 206
68 3300030732 Ga0316176_1108788 Ga0316176_11087881 206
69 3300030733 Ga0314311_1004140 Ga0314311_10041404 206
70 3300030736 Ga0316180_1058331 Ga0316180_10583312 206
71 3300037853 Ga0436364_0185516 Ga0436364_0185516_7393_8013 206
72 3300039437 Ga0436365_1329591 Ga0436365_1329591_3283_3903 206
73 3300039437 Ga0436365_1931466 Ga0436365_1931466_1908_2528 206
74 3300044658 Ga0466972_0031037 Ga0466972_0031037_1894_2514 206
75 3300044683 Ga0466965_0020025 Ga0466965_0020025_134_754 206
76 3300045836 Ga0466958_0001122 Ga0466958_0001122_9343_9963 206
77 3300021384 Ga0213876_10210755 Ga0213876_102107552 207
78 3300061719 Ga0466962_0206675 Ga0466962_0206675_208_831 207
79 3300001989 JGI24739J22299_10130990 JGI24739J22299_101309901 208
80 3300002077 JGI24744J21845_10000510 JGI24744J21845_100005103 208
81 3300003792 Ga0055540_1000003 Ga0055540_1000003419 208
82 3300003792 Ga0055540_1000883 Ga0055540_10008839 208
83 3300003792 Ga0055540_1014578 Ga0055540_10145782 208
84 3300005328 Ga0070676_10008262 Ga0070676_100082627 208
85 3300005329 Ga0070683_100231016 Ga0070683_1002310162 208
86 3300005330 Ga0070690_100035522 Ga0070690_1000355222 208
87 3300005335 Ga0070666_10085278 Ga0070666_100852782 208
88 3300005335 Ga0070666_10163932 Ga0070666_101639322 208
89 3300005336 Ga0070680_100226992 Ga0070680_1002269922 208
90 3300005337 Ga0070682_100020291 Ga0070682_1000202912 208
91 3300005337 Ga0070682_100437656 Ga0070682_1004376562 208
92 3300005338 Ga0068868_100000368 Ga0068868_10000036812 208
93 3300005339 Ga0070660_100078661 Ga0070660_1000786612 208
94 3300005340 Ga0070689_100007743 Ga0070689_1000077434 208
95 3300005341 Ga0070691_10000295 Ga0070691_100002954 208
96 3300005343 Ga0070687_100142883 Ga0070687_1001428832 208
97 3300005345 Ga0070692_10096628 Ga0070692_100966282 208
98 3300005347 Ga0070668_100000317 Ga0070668_1000003173 208
99 3300005347 Ga0070668_100007746 Ga0070668_1000077466 208
100 3300005347 Ga0070668_100064891 Ga0070668_1000648912 208
101 3300005353 Ga0070669_100000608 Ga0070669_10000060812 208
102 3300005353 Ga0070669_100001421 Ga0070669_1000014214 208
103 3300005355 Ga0070671_100000885 Ga0070671_10000088514 208
104 3300005355 Ga0070671_100112141 Ga0070671_1001121412 208
105 3300005356 Ga0070674_100000546 Ga0070674_1000005462 208
106 3300005356 Ga0070674_100889148 Ga0070674_1008891481 208
107 3300005366 Ga0070659_100014528 Ga0070659_1000145282 208
108 3300005367 Ga0070667_100000449 Ga0070667_10000044918 208
109 3300005367 Ga0070667_100001275 Ga0070667_10000127519 208
110 3300005367 Ga0070667_100001922 Ga0070667_10000192210 208
111 3300005367 Ga0070667_100010892 Ga0070667_1000108922 208
112 3300005367 Ga0070667_100045599 Ga0070667_1000455992 208
113 3300005367 Ga0070667_100062358 Ga0070667_1000623583 208
114 3300005434 Ga0070709_10043149 Ga0070709_100431492 208
115 3300005435 Ga0070714_100343671 Ga0070714_1003436711 208
116 3300005437 Ga0070710_10001273 Ga0070710_100012737 208
117 3300005438 Ga0070701_10000553 Ga0070701_100005535 208
118 3300005439 Ga0070711_100000373 Ga0070711_1000003735 208
119 3300005440 Ga0070705_100013036 Ga0070705_1000130362 208
120 3300005440 Ga0070705_100254699 Ga0070705_1002546992 208
121 3300005441 Ga0070700_100001198 Ga0070700_1000011989 208
122 3300005444 Ga0070694_100405688 Ga0070694_1004056881 208
123 3300005445 Ga0070708_101074948 Ga0070708_1010749481 208
124 3300005455 Ga0070663_100035641 Ga0070663_1000356413 208
125 3300005455 Ga0070663_100409456 Ga0070663_1004094562 208
126 3300005456 Ga0070678_100000037 Ga0070678_10000003717 208
127 3300005456 Ga0070678_100528260 Ga0070678_1005282602 208
128 3300005457 Ga0070662_100007600 Ga0070662_1000076005 208
129 3300005459 Ga0068867_100000663 Ga0068867_10000066310 208
130 3300005466 Ga0070685_10020288 Ga0070685_100202882 208
131 3300005536 Ga0070697_100182750 Ga0070697_1001827502 208
132 3300005539 Ga0068853_100001014 Ga0068853_10000101412 208
133 3300005539 Ga0068853_100012220 Ga0068853_1000122206 208
134 3300005544 Ga0070686_100023920 Ga0070686_1000239205 208
135 3300005544 Ga0070686_100039417 Ga0070686_1000394172 208
136 3300005545 Ga0070695_100002297 Ga0070695_1000022978 208
137 3300005546 Ga0070696_100002252 Ga0070696_1000022523 208
138 3300005548 Ga0070665_100002725 Ga0070665_10000272513 208
139 3300005548 Ga0070665_100009036 Ga0070665_1000090363 208
140 3300005548 Ga0070665_100335011 Ga0070665_1003350112 208
141 3300005549 Ga0070704_100000167 Ga0070704_10000016719 208
142 3300005578 Ga0068854_100000837 Ga0068854_10000083711 208
143 3300005615 Ga0070702_100000221 Ga0070702_1000002213 208
144 3300005616 Ga0068852_100097272 Ga0068852_1000972722 208
145 3300005617 Ga0068859_100000115 Ga0068859_1000001156 208
146 3300005617 Ga0068859_100003512 Ga0068859_10000351214 208
147 3300005618 Ga0068864_100281608 Ga0068864_1002816082 208
148 3300005618 Ga0068864_100860380 Ga0068864_1008603802 208
149 3300005718 Ga0068866_10000433 Ga0068866_100004336 208
150 3300005719 Ga0068861_100000054 Ga0068861_10000005422 208
151 3300005841 Ga0068863_100001736 Ga0068863_1000017362 208
152 3300005841 Ga0068863_100004141 Ga0068863_1000041416 208
153 3300005841 Ga0068863_100170764 Ga0068863_1001707642 208
154 3300005842 Ga0068858_100000611 Ga0068858_10000061129 208
155 3300005842 Ga0068858_100009518 Ga0068858_1000095182 208
156 3300005842 Ga0068858_100298082 Ga0068858_1002980822 208
157 3300005843 Ga0068860_100000044 Ga0068860_10000004492 208
158 3300005843 Ga0068860_100000518 Ga0068860_10000051829 208
159 3300005843 Ga0068860_100643541 Ga0068860_1006435412 208
160 3300005844 Ga0068862_100000003 Ga0068862_100000003140 208
161 3300005844 Ga0068862_100001262 Ga0068862_10000126218 208
162 3300005844 Ga0068862_100369474 Ga0068862_1003694742 208
163 3300005937 Ga0081455_10034334 Ga0081455_100343345 208
164 3300005937 Ga0081455_10240099 Ga0081455_102400992 208
165 3300006038 Ga0075365_10074156 Ga0075365_100741562 208
166 3300006038 Ga0075365_10083796 Ga0075365_100837962 208
167 3300006038 Ga0075365_10188425 Ga0075365_101884252 208
168 3300006038 Ga0075365_10204154 Ga0075365_102041542 208
169 3300006042 Ga0075368_10004196 Ga0075368_100041964 208
170 3300006048 Ga0075363_100036625 Ga0075363_1000366252 208
171 3300006048 Ga0075363_100411439 Ga0075363_1004114391 208
172 3300006051 Ga0075364_10006525 Ga0075364_100065254 208
173 3300006051 Ga0075364_10044590 Ga0075364_100445902 208
174 3300006051 Ga0075364_10128886 Ga0075364_101288862 208
175 3300006163 Ga0070715_10000541 Ga0070715_100005413 208
176 3300006173 Ga0070716_100020070 Ga0070716_1000200703 208
177 3300006175 Ga0070712_100000149 Ga0070712_10000014930 208
178 3300006177 Ga0075362_10015408 Ga0075362_100154082 208
179 3300006177 Ga0075362_10034265 Ga0075362_100342652 208
180 3300006177 Ga0075362_10154610 Ga0075362_101546102 208
181 3300006178 Ga0075367_10000319 Ga0075367_100003196 208
182 3300006178 Ga0075367_10364296 Ga0075367_103642962 208
183 3300006186 Ga0075369_10001372 Ga0075369_100013726 208
184 3300006186 Ga0075369_10305168 Ga0075369_103051681 208
185 3300006186 Ga0075369_10312452 Ga0075369_103124521 208
186 3300006195 Ga0075366_10072722 Ga0075366_100727222 208
187 3300006353 Ga0075370_10047521 Ga0075370_100475211 208
188 3300006358 Ga0068871_100026059 Ga0068871_1000260592 208
189 3300006844 Ga0075428_100014509 Ga0075428_1000145093 208
190 3300006846 Ga0075430_100936032 Ga0075430_1009360321 208
191 3300006847 Ga0075431_100024577 Ga0075431_1000245775 208
192 3300006881 Ga0068865_100000280 Ga0068865_10000028020 208
193 3300006931 Ga0097620_100000115 Ga0097620_1000001156 208
194 3300006931 Ga0097620_100003512 Ga0097620_1000035122 208
195 3300009094 Ga0111539_10098088 Ga0111539_100980883 208
196 3300009098 Ga0105245_10000377 Ga0105245_1000037737 208
197 3300009101 Ga0105247_10000006 Ga0105247_10000006181 208
198 3300009101 Ga0105247_10001325 Ga0105247_1000132514 208
199 3300009101 Ga0105247_10088990 Ga0105247_100889902 208
200 3300009147 Ga0114129_10015258 Ga0114129_100152583 208
201 3300009148 Ga0105243_10000755 Ga0105243_1000075529 208
202 3300009148 Ga0105243_10500414 Ga0105243_105004142 208
203 3300009176 Ga0105242_10000366 Ga0105242_1000036611 208
204 3300009176 Ga0105242_11353990 Ga0105242_113539901 208
205 3300009177 Ga0105248_10000062 Ga0105248_1000006289 208
206 3300009177 Ga0105248_10005684 Ga0105248_100056846 208
207 3300009177 Ga0105248_10064178 Ga0105248_100641782 208
208 3300009177 Ga0105248_10414615 Ga0105248_104146152 208
209 3300009545 Ga0105237_10004702 Ga0105237_100047026 208
210 3300009545 Ga0105237_10037459 Ga0105237_100374592 208
211 3300009551 Ga0105238_10180343 Ga0105238_101803432 208
212 3300009553 Ga0105249_10000008 Ga0105249_10000008232 208
213 3300009553 Ga0105249_10000641 Ga0105249_1000064127 208
214 3300009553 Ga0105249_10002622 Ga0105249_100026227 208
215 3300010375 Ga0105239_10005099 Ga0105239_100050999 208
216 3300010375 Ga0105239_10009692 Ga0105239_100096922 208
217 3300010375 Ga0105239_11186457 Ga0105239_111864572 208
218 3300013296 Ga0157374_10024956 Ga0157374_100249562 208
219 3300013297 Ga0157378_10001832 Ga0157378_100018323 208
220 3300013306 Ga0163162_10002253 Ga0163162_100022537 208
221 3300013306 Ga0163162_10719411 Ga0163162_107194112 208
222 3300013307 Ga0157372_10038543 Ga0157372_100385433 208
223 3300013308 Ga0157375_10002135 Ga0157375_100021356 208
224 3300013308 Ga0157375_10133375 Ga0157375_101333752 208
225 3300014325 Ga0163163_10162152 Ga0163163_101621522 208
226 3300014325 Ga0163163_10854240 Ga0163163_108542402 208
227 3300014325 Ga0163163_10941852 Ga0163163_109418522 208
228 3300014326 Ga0157380_10000116 Ga0157380_1000011614 208
229 3300014497 Ga0182008_10238479 Ga0182008_102384792 208
230 3300014968 Ga0157379_10003618 Ga0157379_100036185 208
231 3300014968 Ga0157379_10633006 Ga0157379_106330062 208
232 3300014969 Ga0157376_11021086 Ga0157376_110210862 208
233 3300017792 Ga0163161_10001682 Ga0163161_100016825 208
234 3300021384 Ga0213876_10005413 Ga0213876_100054131 208
235 3300021384 Ga0213876_10015815 Ga0213876_100158152 208
236 3300021384 Ga0213876_10297751 Ga0213876_102977512 208
237 3300021388 Ga0213875_10037620 Ga0213875_100376202 208
238 3300025273 Ga0209673_1031988 Ga0209673_10319882 208
239 3300025273 Ga0209673_1061471 Ga0209673_10614712 208
240 3300025303 Ga0209051_1000011 Ga0209051_1000011177 208
241 3300025303 Ga0209051_1001162 Ga0209051_10011625 208
242 3300025303 Ga0209051_1001628 Ga0209051_10016285 208
243 3300025898 Ga0207692_10003227 Ga0207692_100032275 208
244 3300025899 Ga0207642_10000079 Ga0207642_100000799 208
245 3300025900 Ga0207710_10000025 Ga0207710_10000025106 208
246 3300025900 Ga0207710_10002391 Ga0207710_100023917 208
247 3300025901 Ga0207688_10001038 Ga0207688_100010387 208
248 3300025905 Ga0207685_10005401 Ga0207685_100054012 208
249 3300025906 Ga0207699_10017065 Ga0207699_100170652 208
250 3300025907 Ga0207645_10011399 Ga0207645_100113996 208
251 3300025914 Ga0207671_10014029 Ga0207671_100140296 208
252 3300025914 Ga0207671_10147538 Ga0207671_101475382 208
253 3300025915 Ga0207693_10002006 Ga0207693_1000200612 208
254 3300025916 Ga0207663_10000753 Ga0207663_100007538 208
255 3300025919 Ga0207657_10419673 Ga0207657_104196732 208
256 3300025923 Ga0207681_10004038 Ga0207681_100040383 208
257 3300025923 Ga0207681_10019492 Ga0207681_100194922 208
258 3300025924 Ga0207694_10101320 Ga0207694_101013202 208
259 3300025927 Ga0207687_10011682 Ga0207687_100116825 208
260 3300025929 Ga0207664_10464633 Ga0207664_104646332 208
261 3300025931 Ga0207644_10015232 Ga0207644_100152321 208
262 3300025931 Ga0207644_10078781 Ga0207644_100787812 208
263 3300025931 Ga0207644_10160271 Ga0207644_101602712 208
264 3300025932 Ga0207690_10004486 Ga0207690_100044862 208
265 3300025933 Ga0207706_10002057 Ga0207706_100020578 208
266 3300025934 Ga0207686_10012506 Ga0207686_100125065 208
267 3300025934 Ga0207686_10556506 Ga0207686_105565062 208
268 3300025935 Ga0207709_10001983 Ga0207709_1000198310 208
269 3300025936 Ga0207670_10023492 Ga0207670_100234922 208
270 3300025937 Ga0207669_10000369 Ga0207669_1000036919 208
271 3300025938 Ga0207704_10000212 Ga0207704_1000021228 208
272 3300025939 Ga0207665_10016697 Ga0207665_100166975 208
273 3300025941 Ga0207711_10000358 Ga0207711_1000035824 208
274 3300025941 Ga0207711_10041132 Ga0207711_100411322 208
275 3300025941 Ga0207711_10176485 Ga0207711_101764852 208
276 3300025944 Ga0207661_10192211 Ga0207661_101922111 208
277 3300025961 Ga0207712_10000011 Ga0207712_1000001189 208
278 3300025961 Ga0207712_10004542 Ga0207712_100045428 208
279 3300025972 Ga0207668_10001402 Ga0207668_1000140212 208
280 3300025972 Ga0207668_10004333 Ga0207668_100043339 208
281 3300025972 Ga0207668_10438541 Ga0207668_104385412 208
282 3300025981 Ga0207640_10011223 Ga0207640_100112235 208
283 3300025986 Ga0207658_10000387 Ga0207658_1000038718 208
284 3300025986 Ga0207658_10001930 Ga0207658_1000193011 208
285 3300025986 Ga0207658_10011470 Ga0207658_100114707 208
286 3300025986 Ga0207658_10041021 Ga0207658_100410212 208
287 3300025986 Ga0207658_10050680 Ga0207658_100506803 208
288 3300025986 Ga0207658_10104058 Ga0207658_101040582 208
289 3300026023 Ga0207677_10009463 Ga0207677_100094635 208
290 3300026035 Ga0207703_10007381 Ga0207703_100073812 208
291 3300026035 Ga0207703_10217904 Ga0207703_102179042 208
292 3300026035 Ga0207703_10717427 Ga0207703_107174272 208
293 3300026041 Ga0207639_10004955 Ga0207639_100049553 208
294 3300026041 Ga0207639_10012602 Ga0207639_100126026 208
295 3300026067 Ga0207678_10037419 Ga0207678_100374192 208
296 3300026067 Ga0207678_10231975 Ga0207678_102319752 208
297 3300026067 Ga0207678_10271153 Ga0207678_102711532 208
298 3300026075 Ga0207708_10002240 Ga0207708_1000224015 208
299 3300026078 Ga0207702_10517303 Ga0207702_105173032 208
300 3300026088 Ga0207641_10000450 Ga0207641_100004505 208
301 3300026088 Ga0207641_10011586 Ga0207641_100115862 208
302 3300026088 Ga0207641_10546189 Ga0207641_105461892 208
303 3300026089 Ga0207648_10000231 Ga0207648_1000023164 208
304 3300026095 Ga0207676_10623168 Ga0207676_106231682 208
305 3300026118 Ga0207675_100000398 Ga0207675_1000003989 208
306 3300026118 Ga0207675_100392835 Ga0207675_1003928352 208
307 3300026121 Ga0207683_10000128 Ga0207683_1000012838 208
308 3300026142 Ga0207698_10060585 Ga0207698_100605852 208
309 3300028379 Ga0268266_10005109 Ga0268266_1000510910 208
310 3300028379 Ga0268266_10005399 Ga0268266_100053996 208
311 3300028380 Ga0268265_10000010 Ga0268265_10000010140 208
312 3300028380 Ga0268265_10051370 Ga0268265_100513703 208
313 3300028381 Ga0268264_10000007 Ga0268264_10000007673 208
314 3300028381 Ga0268264_10001462 Ga0268264_1000146210 208
315 3300028381 Ga0268264_10457573 Ga0268264_104575732 208
316 3300031251 Ga0265327_10000825 Ga0265327_1000082511 208
317 3300031251 Ga0265327_10001171 Ga0265327_100011716 208
318 3300031251 Ga0265327_10028441 Ga0265327_100284412 208
319 3300031251 Ga0265327_10043730 Ga0265327_100437302 208
320 3300031548 Ga0307408_100838391 Ga0307408_1008383912 208
321 3300031728 Ga0316578_10014326 Ga0316578_100143263 208
322 3300031824 Ga0307413_10161914 Ga0307413_101619142 208
323 3300031901 Ga0307406_10379966 Ga0307406_103799661 208
324 3300031901 Ga0307406_10763107 Ga0307406_107631072 208
325 3300031903 Ga0307407_10156312 Ga0307407_101563122 208
326 3300031911 Ga0307412_10414974 Ga0307412_104149742 208
327 3300031911 Ga0307412_11227716 Ga0307412_112277161 208
328 3300031995 Ga0307409_100109405 Ga0307409_1001094052 208
329 3300032002 Ga0307416_100076630 Ga0307416_1000766302 208
330 3300032002 Ga0307416_101310867 Ga0307416_1013108672 208
331 3300032004 Ga0307414_10839778 Ga0307414_108397781 208
332 3300032126 Ga0307415_100633615 Ga0307415_1006336151 208
333 3300034817 Ga0373948_0018989 Ga0373948_0018989_397_1023 208
334 3300035092 Ga0373952_0016452 Ga0373952_0016452_530_1156 208
335 3300035725 Ga0373947_0059509 Ga0373947_0059509_807_1433 208
336 3300036712 Ga0316584_0149949 Ga0316584_0149949_516_1142 208
337 3300037853 Ga0436364_0793855 Ga0436364_0793855_379_1005 208
338 3300039437 Ga0436365_0434410 Ga0436365_0434410_8338_8964 208
339 3300039437 Ga0436365_0674802 Ga0436365_0674802_7912_8538 208
340 3300039437 Ga0436365_0708236 Ga0436365_0708236_2426_3052 208
341 3300039450 Ga0436363_1277218 Ga0436363_1277218_56_682 208
342 3300039450 Ga0436363_1338388 Ga0436363_1338388_7229_7855 208
343 3300041410 Ga0439461_0002376 Ga0439461_0002376_126_752 208
344 3300041411 Ga0439466_0003950 Ga0439466_0003950_1349_1975 208
345 3300041411 Ga0439466_0016027 Ga0439466_0016027_53_679 208
346 3300041411 Ga0439466_0021631 Ga0439466_0021631_1348_1974 208
347 3300041411 Ga0439466_0061425 Ga0439466_0061425_547_1173 208
348 3300041413 Ga0439465_0000487 Ga0439465_0000487_10344_10970 208
349 3300041413 Ga0439465_0001464 Ga0439465_0001464_6568_7194 208
350 3300041413 Ga0439465_0027949 Ga0439465_0027949_53_679 208
351 3300041451 Ga0451791_1249914 Ga0451791_1249914_326_952 208
352 3300041997 Ga0439431_0003360 Ga0439431_0003360_912_1538 208
353 3300042002 Ga0439442_022750 Ga0439442_022750_363_989 208
354 3300042004 Ga0439445_0001092 Ga0439445_0001092_2524_3150 208
355 3300042435 Ga0439434_0007297 Ga0439434_0007297_1765_2391 208
356 3300044658 Ga0466972_0002789 Ga0466972_0002789_554_1180 208
357 3300044658 Ga0466972_0019631 Ga0466972_0019631_1087_1713 208
358 3300044658 Ga0466972_0052171 Ga0466972_0052171_810_1436 208
359 3300044683 Ga0466965_0020335 Ga0466965_0020335_1718_2344 208
360 3300044683 Ga0466965_0023239 Ga0466965_0023239_339_965 208
361 3300044683 Ga0466965_0026034 Ga0466965_0026034_1497_2123 208
362 3300044684 Ga0466966_0045383 Ga0466966_0045383_540_1166 208
363 3300044684 Ga0466966_0445420 Ga0466966_0445420_119_745 208
364 3300044693 Ga0466961_0008283 Ga0466961_0008283_2671_3297 208
365 3300044694 Ga0466963_0009064 Ga0466963_0009064_3834_4460 208
366 3300044719 Ga0466971_0347592 Ga0466971_0347592_26_652 208
367 3300044735 Ga0466968_0012489 Ga0466968_0012489_2485_3111 208
368 3300044735 Ga0466968_0026999 Ga0466968_0026999_58_684 208
369 3300044765 Ga0466970_0014776 Ga0466970_0014776_705_1331 208
370 3300044765 Ga0466970_0048192 Ga0466970_0048192_837_1463 208
371 3300044765 Ga0466970_0127678 Ga0466970_0127678_39_665 208
372 3300044842 Ga0466957_0055843 Ga0466957_0055843_407_1033 208
373 3300044901 Ga0466960_0000101 Ga0466960_0000101_5815_6441 208
374 3300044901 Ga0466960_0000133 Ga0466960_0000133_21297_21923 208
375 3300044901 Ga0466960_0000933 Ga0466960_0000933_7253_7879 208
376 3300044901 Ga0466960_0020001 Ga0466960_0020001_1053_1679 208
377 3300045049 Ga0466959_0015686 Ga0466959_0015686_4035_4661 208
378 3300045049 Ga0466959_0057556 Ga0466959_0057556_905_1531 208
379 3300045049 Ga0466959_0068639 Ga0466959_0068639_219_845 208
380 3300045836 Ga0466958_0111650 Ga0466958_0111650_536_1162 208
381 3300045976 Ga0466967_0032467 Ga0466967_0032467_2611_3237 208
382 3300045976 Ga0466967_0034160 Ga0466967_0034160_2208_2834 208
383 3300045976 Ga0466967_0071500 Ga0466967_0071500_1505_2131 208
384 3300045976 Ga0466967_0274376 Ga0466967_0274376_323_949 208
385 3300045976 Ga0466967_0310803 Ga0466967_0310803_377_1003 208
386 3300045976 Ga0466967_0350393 Ga0466967_0350393_405_1031 208
387 3300045976 Ga0466967_0362300 Ga0466967_0362300_174_800 208
388 3300045976 Ga0466967_0872519 Ga0466967_0872519_23_649 208
389 3300046455 Ga0495603_0059116 Ga0495603_0059116_1135_1761 208
390 3300046460 Ga0495638_0005329 Ga0495638_0005329_8421_9047 208
391 3300046460 Ga0495638_0013236 Ga0495638_0013236_1861_2487 208
392 3300046461 Ga0495641_0020991 Ga0495641_0020991_2035_2661 208
393 3300046473 Ga0495582_0026802 Ga0495582_0026802_2403_3029 208
394 3300046517 Ga0495630_0280023 Ga0495630_0280023_519_1145 208
395 3300046524 Ga0495648_0009272 Ga0495648_0009272_5710_6336 208
396 3300046526 Ga0495666_0069975 Ga0495666_0069975_609_1235 208
397 3300046529 Ga0495652_0308664 Ga0495652_0308664_364_990 208
398 3300046533 Ga0495640_0025396 Ga0495640_0025396_2463_3089 208
399 3300046557 Ga0495622_0118289 Ga0495622_0118289_210_836 208
400 3300046660 Ga0495625_0152503 Ga0495625_0152503_110_736 208
401 3300046683 Ga0495658_0015674 Ga0495658_0015674_1627_2253 208
402 3300047319 Ga0495674_0114660 Ga0495674_0114660_654_1280 208
403 3300047320 Ga0495672_0054223 Ga0495672_0054223_1568_2194 208
404 3300047321 Ga0495676_0039056 Ga0495676_0039056_2356_2982 208
405 3300047469 Ga0495673_0000862 Ga0495673_0000862_26345_26971 208
406 3300047472 Ga0495686_0004602 Ga0495686_0004602_2182_2808 208
407 3300048091 Ga0495626_0070877 Ga0495626_0070877_365_991 208
408 3300048903 Ga0496100_0000041 Ga0496100_0000041_48567_49193 208
409 3300048903 Ga0496100_0001769 Ga0496100_0001769_4845_5471 208
410 3300048903 Ga0496100_0011177 Ga0496100_0011177_4195_4821 208
411 3300048903 Ga0496100_0047118 Ga0496100_0047118_1302_1928 208
412 3300048903 Ga0496100_0100852 Ga0496100_0100852_528_1154 208
413 3300048904 Ga0496101_0000019 Ga0496101_0000019_165422_166048 208
414 3300048904 Ga0496101_0000281 Ga0496101_0000281_10714_11340 208
415 3300048904 Ga0496101_0000628 Ga0496101_0000628_9114_9740 208
416 3300048904 Ga0496101_0013388 Ga0496101_0013388_656_1282 208
417 3300048904 Ga0496101_0022858 Ga0496101_0022858_2788_3414 208
418 3300048904 Ga0496101_0037722 Ga0496101_0037722_366_992 208
419 3300048904 Ga0496101_0182725 Ga0496101_0182725_205_831 208
420 3300048904 Ga0496101_0236044 Ga0496101_0236044_539_1165 208
421 3300048905 Ga0496102_0000007 Ga0496102_0000007_313446_314072 208
422 3300048905 Ga0496102_0000060 Ga0496102_0000060_21937_22563 208
423 3300048905 Ga0496102_0007600 Ga0496102_0007600_6535_7161 208
424 3300048905 Ga0496102_0025906 Ga0496102_0025906_3117_3743 208
425 3300048905 Ga0496102_0182657 Ga0496102_0182657_850_1476 208
426 3300048905 Ga0496102_0328879 Ga0496102_0328879_434_1060 208
427 3300048906 Ga0496103_0000013 Ga0496103_0000013_194303_194929 208
428 3300048906 Ga0496103_0000350 Ga0496103_0000350_38876_39502 208
429 3300048906 Ga0496103_0000704 Ga0496103_0000704_22804_23430 208
430 3300048906 Ga0496103_0007629 Ga0496103_0007629_3121_3747 208
431 3300048906 Ga0496103_0115753 Ga0496103_0115753_336_962 208
432 3300048906 Ga0496103_0206325 Ga0496103_0206325_619_1245 208
433 3300048906 Ga0496103_0548983 Ga0496103_0548983_75_701 208
434 3300048907 Ga0496104_0004319 Ga0496104_0004319_7179_7805 208
435 3300048907 Ga0496104_0005624 Ga0496104_0005624_8986_9612 208
436 3300048907 Ga0496104_0550376 Ga0496104_0550376_312_938 208
437 3300048908 Ga0496105_0141317 Ga0496105_0141317_1022_1648 208
438 3300048908 Ga0496105_0488685 Ga0496105_0488685_200_826 208
439 3300048908 Ga0496105_0710277 Ga0496105_0710277_135_761 208
440 3300048909 Ga0496106_0000167 Ga0496106_0000167_1647_2273 208
441 3300048909 Ga0496106_0001593 Ga0496106_0001593_15180_15806 208
442 3300048909 Ga0496106_0009916 Ga0496106_0009916_925_1551 208
443 3300048909 Ga0496106_0011697 Ga0496106_0011697_4848_5474 208
444 3300048910 Ga0496107_0001007 Ga0496107_0001007_9322_9948 208
445 3300048910 Ga0496107_0005371 Ga0496107_0005371_6660_7286 208
446 3300048910 Ga0496107_0011959 Ga0496107_0011959_4459_5085 208
447 3300048910 Ga0496107_0192189 Ga0496107_0192189_550_1176 208
448 3300048910 Ga0496107_0199668 Ga0496107_0199668_584_1210 208
449 3300048910 Ga0496107_0511308 Ga0496107_0511308_59_685 208
450 3300048911 Ga0496108_0012411 Ga0496108_0012411_3886_4512 208
451 3300048911 Ga0496108_0205308 Ga0496108_0205308_881_1507 208
452 3300048911 Ga0496108_0441944 Ga0496108_0441944_94_720 208
453 3300048911 Ga0496108_0973434 Ga0496108_0973434_30_656 208
454 3300048912 Ga0496109_0001228 Ga0496109_0001228_6483_7109 208
455 3300048912 Ga0496109_0152434 Ga0496109_0152434_542_1168 208
456 3300048912 Ga0496109_0438551 Ga0496109_0438551_229_855 208
457 3300048913 Ga0496110_0035065 Ga0496110_0035065_396_1022 208
458 3300048913 Ga0496110_0067413 Ga0496110_0067413_1341_1967 208
459 3300048913 Ga0496110_0169635 Ga0496110_0169635_950_1576 208
460 3300048913 Ga0496110_0230661 Ga0496110_0230661_866_1492 208
461 3300048914 Ga0496111_0045510 Ga0496111_0045510_1462_2088 208
462 3300048915 Ga0496112_0001398 Ga0496112_0001398_12514_13140 208
463 3300048915 Ga0496112_0012816 Ga0496112_0012816_6487_7113 208
464 3300048915 Ga0496112_0054898 Ga0496112_0054898_441_1067 208
465 3300048915 Ga0496112_0363868 Ga0496112_0363868_633_1259 208
466 3300048915 Ga0496112_0595227 Ga0496112_0595227_141_767 208
467 3300048916 Ga0496113_0040891 Ga0496113_0040891_786_1412 208
468 3300048917 Ga0496114_0000070 Ga0496114_0000070_67946_68572 208
469 3300048917 Ga0496114_0001225 Ga0496114_0001225_9355_9981 208
470 3300048917 Ga0496114_0020927 Ga0496114_0020927_4043_4669 208
471 3300048918 Ga0496115_0010632 Ga0496115_0010632_3010_3636 208
472 3300048918 Ga0496115_0016522 Ga0496115_0016522_4596_5222 208
473 3300048918 Ga0496115_0176003 Ga0496115_0176003_1031_1657 208
474 3300048919 Ga0496116_0000033 Ga0496116_0000033_104099_104725 208
475 3300048919 Ga0496116_0022639 Ga0496116_0022639_3821_4447 208
476 3300048919 Ga0496116_0250048 Ga0496116_0250048_103_729 208
477 3300048920 Ga0496117_0000025 Ga0496117_0000025_104029_104655 208
478 3300048920 Ga0496117_0000190 Ga0496117_0000190_71521_72147 208
479 3300048920 Ga0496117_0040290 Ga0496117_0040290_1934_2560 208
480 3300048920 Ga0496117_0098238 Ga0496117_0098238_785_1468 208
481 3300048921 Ga0496118_0000023 Ga0496118_0000023_313452_314078 208
482 3300048921 Ga0496118_0001595 Ga0496118_0001595_14312_14938 208
483 3300048921 Ga0496118_0005068 Ga0496118_0005068_8956_9582 208
484 3300048921 Ga0496118_0028003 Ga0496118_0028003_529_1155 208
485 3300048922 Ga0496119_0008733 Ga0496119_0008733_7109_7735 208
486 3300048922 Ga0496119_0054476 Ga0496119_0054476_518_1144 208
487 3300048922 Ga0496119_0117736 Ga0496119_0117736_336_962 208
488 3300048922 Ga0496119_0177848 Ga0496119_0177848_325_951 208
489 3300048923 Ga0496120_0002095 Ga0496120_0002095_20236_20862 208
490 3300048923 Ga0496120_0017876 Ga0496120_0017876_3421_4047 208
491 3300048924 Ga0496121_0000016 Ga0496121_0000016_111276_111902 208
492 3300048924 Ga0496121_0000039 Ga0496121_0000039_148365_148991 208
493 3300048924 Ga0496121_0009738 Ga0496121_0009738_1840_2466 208
494 3300048924 Ga0496121_0338008 Ga0496121_0338008_74_700 208
495 3300048925 Ga0496122_0000470 Ga0496122_0000470_14196_14822 208
496 3300048925 Ga0496122_0023716 Ga0496122_0023716_994_1620 208
497 3300048926 Ga0496123_0036255 Ga0496123_0036255_2217_2843 208
498 3300048926 Ga0496123_0047376 Ga0496123_0047376_1493_2119 208
499 3300048927 Ga0496124_0000015 Ga0496124_0000015_266488_267114 208
500 3300048928 Ga0496125_0000021 Ga0496125_0000021_193587_194213 208
501 3300048928 Ga0496125_0074773 Ga0496125_0074773_1691_2317 208
502 3300048928 Ga0496125_0150313 Ga0496125_0150313_343_969 208
503 3300048929 Ga0496126_0000015 Ga0496126_0000015_193587_194213 208
504 3300048929 Ga0496126_0000405 Ga0496126_0000405_35062_35688 208
505 3300048929 Ga0496126_0006611 Ga0496126_0006611_484_1110 208
506 3300048929 Ga0496126_0015890 Ga0496126_0015890_2078_2704 208
507 3300048929 Ga0496126_0025402 Ga0496126_0025402_805_1431 208
508 3300048929 Ga0496126_0093220 Ga0496126_0093220_399_1025 208
509 3300048929 Ga0496126_0684288 Ga0496126_0684288_11_637 208
510 3300049569 Ga0501032_0004043 Ga0501032_0004043_1499_2125 208
511 3300049570 Ga0501033_0130721 Ga0501033_0130721_91_717 208
512 3300049571 Ga0501034_0003080 Ga0501034_0003080_10204_10830 208
513 3300049571 Ga0501034_0004526 Ga0501034_0004526_3543_4169 208
514 3300049571 Ga0501034_0175650 Ga0501034_0175650_687_1313 208
515 3300049571 Ga0501034_0669308 Ga0501034_0669308_147_773 208
516 3300049572 Ga0501036_0030070 Ga0501036_0030070_944_1570 208
517 3300049572 Ga0501036_0180311 Ga0501036_0180311_820_1446 208
518 3300049573 Ga0501037_0000490 Ga0501037_0000490_4184_4810 208
519 3300049573 Ga0501037_0007789 Ga0501037_0007789_5909_6535 208
520 3300049574 Ga0501038_0021102 Ga0501038_0021102_1055_1681 208
521 3300049575 Ga0501039_0000886 Ga0501039_0000886_13815_14441 208
522 3300049579 Ga0501043_0007980 Ga0501043_0007980_3404_4030 208
523 3300049579 Ga0501043_0020547 Ga0501043_0020547_3059_3685 208
524 3300049580 Ga0501046_0000749 Ga0501046_0000749_6917_7543 208
525 3300049581 Ga0501047_0002869 Ga0501047_0002869_6251_6877 208
526 3300049581 Ga0501047_0262069 Ga0501047_0262069_803_1429 208
527 3300049581 Ga0501047_0343161 Ga0501047_0343161_611_1237 208
528 3300049582 Ga0501048_0007940 Ga0501048_0007940_2663_3289 208
529 3300049583 Ga0501067_0437485 Ga0501067_0437485_48_674 208
530 3300049586 Ga0501070_0006186 Ga0501070_0006186_8747_9373 208
531 3300049586 Ga0501070_0012312 Ga0501070_0012312_6568_7194 208
532 3300049587 Ga0501071_0062549 Ga0501071_0062549_1265_1891 208
533 3300049593 Ga0501077_0154731 Ga0501077_0154731_535_1161 208
534 3300049744 Ga0501083_0142994 Ga0501083_0142994_705_1331 208
535 3300049822 Ga0501035_0015364 Ga0501035_0015364_2015_2641 208
536 3300049823 Ga0501044_0007663 Ga0501044_0007663_11206_11832 208
537 3300049823 Ga0501044_0007872 Ga0501044_0007872_10121_10747 208
538 3300050489 nmdc:mga03683_118149_c1 nmdc:mga03683_118149_c1_78_704 208
539 3300050489 nmdc:mga03683_127903_c1 nmdc:mga03683_127903_c1_265_891 208
540 3300050489 nmdc:mga03683_151651_c1 nmdc:mga03683_151651_c1_288_914 208
541 3300050490 nmdc:mga03n38_26854_c1 nmdc:mga03n38_26854_c1_123_749 208
542 3300050490 nmdc:mga03n38_37517_c1 nmdc:mga03n38_37517_c1_318_944 208
543 3300050491 nmdc:mga00v17_142561_c1 nmdc:mga00v17_142561_c1_229_855 208
544 3300050491 nmdc:mga00v17_143058_c1 nmdc:mga00v17_143058_c1_384_1010 208
545 3300050491 nmdc:mga00v17_426031_c1 nmdc:mga00v17_426031_c1_17_643 208
546 3300050492 nmdc:mga0yw44_249433_c1 nmdc:mga0yw44_249433_c1_406_1032 208
547 3300050492 nmdc:mga0yw44_599022_c1 nmdc:mga0yw44_599022_c1_64_690 208
548 3300050492 nmdc:mga0yw44_66800_c1 nmdc:mga0yw44_66800_c1_621_1247 208
549 3300050492 nmdc:mga0yw44_67531_c1 nmdc:mga0yw44_67531_c1_774_1409 208
550 3300050492 nmdc:mga0yw44_773231_c1 nmdc:mga0yw44_773231_c1_10_636 208
551 3300050494 nmdc:mga06z11_56244_c1 nmdc:mga06z11_56244_c1_393_1019 208
552 3300050494 nmdc:mga06z11_74831_c1 nmdc:mga06z11_74831_c1_340_966 208
553 3300050495 nmdc:mga04h51_128420_c1 nmdc:mga04h51_128420_c1_194_820 208
554 3300050496 nmdc:mga07m45_21630_c1 nmdc:mga07m45_21630_c1_61_687 208
555 3300050496 nmdc:mga07m45_314352_c1 nmdc:mga07m45_314352_c1_29_655 208
556 3300050496 nmdc:mga07m45_88910_c1 nmdc:mga07m45_88910_c1_1036_1662 208
557 3300050509 nmdc:mga0qj67_45064_c1 nmdc:mga0qj67_45064_c1_1443_2069 208
558 3300050510 nmdc:mga06r32_19200_c1 nmdc:mga06r32_19200_c1_2751_3377 208
559 3300050511 nmdc:mga08y16_960557_c1 nmdc:mga08y16_960557_c1_191_817 208
560 3300050516 nmdc:mga0sz30_17456_c2 nmdc:mga0sz30_17456_c2_912_1538 208
561 3300050516 nmdc:mga0sz30_2497_c1 nmdc:mga0sz30_2497_c1_1235_1861 208
562 3300050516 nmdc:mga0sz30_32132_c2 nmdc:mga0sz30_32132_c2_480_1106 208
563 3300053079 Ga0500610_0177427 Ga0500610_0177427_282_908 208
564 3300053080 Ga0500635_0000964 Ga0500635_0000964_3342_3968 208
565 3300053087 Ga0500643_008359 Ga0500643_008359_2545_3171 208
566 3300053090 Ga0500646_0039660 Ga0500646_0039660_468_1094 208
567 3300053096 Ga0500641_0083516 Ga0500641_0083516_125_751 208
568 3300053104 Ga0500556_0123557 Ga0500556_0123557_33_659 208
569 3300053108 Ga0500562_007263 Ga0500562_007263_251_877 208
570 3300053131 Ga0500652_014835 Ga0500652_014835_173_799 208
571 3300053137 Ga0500561_0035811 Ga0500561_0035811_31_657 208
572 3300053153 Ga0500616_0107584 Ga0500616_0107584_77_709 208
573 3300053153 Ga0500616_0157063 Ga0500616_0157063_185_811 208
574 3300053730 Ga0500645_000054 Ga0500645_000054_2934_3560 208
575 3300053730 Ga0500645_005840 Ga0500645_005840_3031_3657 208
576 3300061719 Ga0466962_0058458 Ga0466962_0058458_159_785 208
577 3300046523 Ga0495644_0108466 Ga0495644_0108466_352_1008 218
578 3300048905 Ga0496102_0129681 Ga0496102_0129681_274_930 218
579 3300001977 JGI24746J21847_1001858 JGI24746J21847_10018584 225
580 3300005328 Ga0070676_10410933 Ga0070676_104109331 225
581 3300005330 Ga0070690_100505548 Ga0070690_1005055482 225
582 3300005334 Ga0068869_100017057 Ga0068869_1000170574 225
583 3300005337 Ga0070682_100103520 Ga0070682_1001035202 225
584 3300005338 Ga0068868_100691825 Ga0068868_1006918252 225
585 3300005338 Ga0068868_100760211 Ga0068868_1007602111 225
586 3300005340 Ga0070689_100063106 Ga0070689_1000631062 225
587 3300005347 Ga0070668_100819976 Ga0070668_1008199761 225
588 3300005355 Ga0070671_100164488 Ga0070671_1001644882 225
589 3300005366 Ga0070659_100097283 Ga0070659_1000972832 225
590 3300005367 Ga0070667_100321273 Ga0070667_1003212732 225
591 3300005434 Ga0070709_10020423 Ga0070709_100204233 225
592 3300005439 Ga0070711_100001530 Ga0070711_10000153011 225
593 3300005440 Ga0070705_100029378 Ga0070705_1000293783 225
594 3300005441 Ga0070700_100020109 Ga0070700_1000201092 225
595 3300005441 Ga0070700_100603127 Ga0070700_1006031271 225
596 3300005456 Ga0070678_100083646 Ga0070678_1000836462 225
597 3300005456 Ga0070678_100276816 Ga0070678_1002768162 225
598 3300005457 Ga0070662_100315991 Ga0070662_1003159912 225
599 3300005546 Ga0070696_100035906 Ga0070696_1000359063 225
600 3300005549 Ga0070704_100281754 Ga0070704_1002817541 225
601 3300005578 Ga0068854_100115768 Ga0068854_1001157682 225
602 3300005578 Ga0068854_100300934 Ga0068854_1003009342 225
603 3300005617 Ga0068859_100254287 Ga0068859_1002542872 225
604 3300005617 Ga0068859_100642288 Ga0068859_1006422882 225
605 3300005718 Ga0068866_10014818 Ga0068866_100148182 225
606 3300005719 Ga0068861_100719351 Ga0068861_1007193512 225
607 3300005842 Ga0068858_100243100 Ga0068858_1002431002 225
608 3300005843 Ga0068860_100394944 Ga0068860_1003949443 225
609 3300005844 Ga0068862_100114122 Ga0068862_1001141222 225
610 3300006173 Ga0070716_100004716 Ga0070716_1000047165 225
611 3300006175 Ga0070712_100006865 Ga0070712_1000068652 225
612 3300006881 Ga0068865_100059755 Ga0068865_1000597552 225
613 3300006931 Ga0097620_100254309 Ga0097620_1002543092 225
614 3300006931 Ga0097620_100642296 Ga0097620_1006422962 225
615 3300009098 Ga0105245_10664927 Ga0105245_106649272 225
616 3300009148 Ga0105243_10054529 Ga0105243_100545293 225
617 3300009174 Ga0105241_10439071 Ga0105241_104390712 225
618 3300010375 Ga0105239_10312017 Ga0105239_103120172 225
619 3300011119 Ga0105246_10025918 Ga0105246_100259183 225
620 3300013296 Ga0157374_10058948 Ga0157374_100589484 225
621 3300013306 Ga0163162_10248625 Ga0163162_102486253 225
622 3300014326 Ga0157380_10022573 Ga0157380_100225736 225
623 3300014745 Ga0157377_10025833 Ga0157377_100258332 225
624 3300017792 Ga0163161_10420461 Ga0163161_104204611 225
625 3300025899 Ga0207642_10093693 Ga0207642_100936932 225
626 3300025899 Ga0207642_10250778 Ga0207642_102507782 225
627 3300025900 Ga0207710_10029722 Ga0207710_100297222 225
628 3300025901 Ga0207688_10004437 Ga0207688_1000443710 225
629 3300025905 Ga0207685_10143676 Ga0207685_101436762 225
630 3300025906 Ga0207699_10135009 Ga0207699_101350092 225
631 3300025907 Ga0207645_10146461 Ga0207645_101464611 225
632 3300025915 Ga0207693_10004717 Ga0207693_100047178 225
633 3300025916 Ga0207663_10004414 Ga0207663_100044142 225
634 3300025917 Ga0207660_10204815 Ga0207660_102048151 225
635 3300025918 Ga0207662_10098206 Ga0207662_100982062 225
636 3300025926 Ga0207659_10323353 Ga0207659_103233532 225
637 3300025931 Ga0207644_10039181 Ga0207644_100391812 225
638 3300025932 Ga0207690_10143708 Ga0207690_101437082 225
639 3300025933 Ga0207706_10088809 Ga0207706_100888093 225
640 3300025939 Ga0207665_10006390 Ga0207665_100063905 225
641 3300025942 Ga0207689_10007708 Ga0207689_100077089 225
642 3300025949 Ga0207667_10247433 Ga0207667_102474332 225
643 3300025960 Ga0207651_10224301 Ga0207651_102243012 225
644 3300025972 Ga0207668_10028012 Ga0207668_100280122 225
645 3300025981 Ga0207640_10237538 Ga0207640_102375382 225
646 3300025981 Ga0207640_10543522 Ga0207640_105435222 225
647 3300026023 Ga0207677_10159070 Ga0207677_101590701 225
648 3300026035 Ga0207703_10044490 Ga0207703_100444903 225
649 3300026075 Ga0207708_10033635 Ga0207708_100336353 225
650 3300026089 Ga0207648_10061408 Ga0207648_100614083 225
651 3300026118 Ga0207675_100047669 Ga0207675_1000476692 225
652 3300026118 Ga0207675_100077890 Ga0207675_1000778902 225
653 3300026118 Ga0207675_100355527 Ga0207675_1003555272 225
654 3300026121 Ga0207683_10018223 Ga0207683_100182231 225
655 3300028379 Ga0268266_10181355 Ga0268266_101813553 225
656 3300034820 Ga0373959_0036356 Ga0373959_0036356_277_954 225
657 3300035085 Ga0373929_0074450 Ga0373929_0074450_13_690 225
658 3300035691 Ga0373931_0015952 Ga0373931_0015952_317_994 225
659 3300048903 Ga0496100_0193381 Ga0496100_0193381_621_1298 225
660 3300048903 Ga0496100_0431194 Ga0496100_0431194_130_807 225
661 3300048905 Ga0496102_0041638 Ga0496102_0041638_1438_2115 225
662 3300048906 Ga0496103_0070718 Ga0496103_0070718_888_1565 225
663 3300048906 Ga0496103_0426278 Ga0496103_0426278_80_757 225
664 3300048911 Ga0496108_0000986 Ga0496108_0000986_9235_9912 225
665 3300048912 Ga0496109_0003917 Ga0496109_0003917_2391_3068 225
666 3300048914 Ga0496111_0491727 Ga0496111_0491727_110_787 225
667 3300048915 Ga0496112_0016413 Ga0496112_0016413_97_774 225
668 3300048916 Ga0496113_0083641 Ga0496113_0083641_312_989 225
669 3300048917 Ga0496114_0159442 Ga0496114_0159442_135_812 225
670 3300048918 Ga0496115_0174547 Ga0496115_0174547_553_1230 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02570

CbiC

Precorrin-8X methylmutase

10

206

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f2v-assembly1.cif.gz_A crystal structure analysis of precorrin-8x methylmutase of aerobic vitamin b12 synthesis 0.9765 1 204
3e7d-assembly1.cif.gz_A crystal structure of precorrin-8x methyl mutase cbic/cobh from brucella melitensis 0.9711 4 204
3e7d-assembly1.cif.gz_A crystal structure of precorrin-8x methyl mutase cbic/cobh from brucella melitensis 0.9617 4 204
4au1-assembly1.cif.gz_A crystal structure of cobh (precorrin-8x methyl mutase) complexed with c5 desmethyl-hba 0.9574 1 204
5n0g-assembly1.cif.gz_A-2 crystal structure of cobh t85a (precorrin-8x methyl mutase) complexed with c5 allyl-hba 0.9571 1 204
ID Description Score Start End Superfamily
3e7dD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9691 4 204 3.40.50.10230
3e7dD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9506 4 204 3.40.50.10230
2afvB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9318 1 205 3.40.50.10230
af_Q58340_4_210_3.40.50.10230 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9172 4 203 3.40.50.10230
1v9cA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9093 11 203 3.40.50.10230
ID Description Score Start End GO Terms
AF-A0A7I9X611-F1-model_v4 deleted 0.9881 1 84
AF-A0A2S8M4Z7-F1-model_v4 deleted 0.9878 1 71
AF-A0A1N0PY12-F1-model_v4 deleted 0.9864 95 204
AF-A0A4Q7CIR0-F1-model_v4 Precorrin-8X methylmutase 0.9849 53 208 GO:0009236
GO:0016993
AF-A0A259BLV4-F1-model_v4 Cobalamin biosynthesis precorrin-8X methylmutase CobH/CbiC domain-containing protein 0.9848 1 50 GO:0009236
GO:0016993

Feature Viewer

pLDDT pTM Quality
90.98 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map