F474112
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 670 | 317 | 647 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300048920|Ga0496117_0098238|Ga0496117_0098238_785_1468 |
| Length | 227 |
| Sequence | VLDYIRDAAEIYRQSFAAIRAEADLTRFPDDVARVVVRLIHTCGQVDVAEHVAYTDDVVARAGAALRRGAPVLCDSSMVAAGITTARLPAGNEVVSLVADPRAPELAARRRTTRSAAAVELWAERLAGAVLAIGNAPTALFRLLELIDEGVSPPAAVLGGPVGFVGSAQSKQELIERPRGMAYLVVRGRRGGSAMAAAALNAIASDSELPGAASYLGWGWGPAIRSW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 3 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 4 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 5 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 6 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 7 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 8 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 9 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 10 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 11 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 12 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 13 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 14 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 15 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 16 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 17 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 18 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 19 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 20 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 21 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 22 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 23 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 24 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 25 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 26 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 127 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 184 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 185 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 186 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 187 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 190 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 199 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 201 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 202 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 204 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 205 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 210 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 211 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 212 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 213 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 215 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 216 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 217 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 218 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 219 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 220 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 221 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 224 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 225 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 226 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 227 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 230 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 231 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 253 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 254 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 255 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 256 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 257 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 258 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 261 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 262 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 263 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 264 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 265 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 266 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 267 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 268 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 269 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 270 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 271 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 272 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 273 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 274 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 275 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 276 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 277 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 296 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 297 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 298 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 299 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 300 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 301 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 302 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 306 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 307 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 308 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 309 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 310 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 311 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 312 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 313 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 314 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 315 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 316 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 317 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.42 |
| Metatranscriptomes | 0.15 |
| Isolates | 3.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.15 |
| Bulb | 0 |
| Endosphere | 11.19 |
| Nodule | 0.15 |
| Rhizoplane | 12.69 |
| Rhizosphere | 65.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1001858 | 3300001977 | Bacteria | 3367 |
| 2 | JGI24739J22299_10130990 | 3300001989 | Bacteria | 746 |
| 3 | JGI24744J21845_10000510 | 3300002077 | Bacteria | 6920 |
| 4 | Ga0055540_1000003 | 3300003792 | Bacteria | 428375 |
| 5 | Ga0055540_1000883 | 3300003792 | Bacteria | 19852 |
| 6 | Ga0055540_1014578 | 3300003792 | Bacteria | 2332 |
| 7 | Ga0070676_10008262 | 3300005328 | Bacteria | 5604 |
| 8 | Ga0070676_10410933 | 3300005328 | Bacteria | 944 |
| 9 | Ga0070683_100231016 | 3300005329 | Bacteria | 1759 |
| 10 | Ga0070683_100364963 | 3300005329 | Bacteria | 1375 |
| 11 | Ga0070690_100035522 | 3300005330 | Bacteria | 3128 |
| 12 | Ga0070690_100505548 | 3300005330 | Bacteria | 905 |
| 13 | Ga0068869_100017057 | 3300005334 | Bacteria | 4913 |
| 14 | Ga0070666_10085278 | 3300005335 | Bacteria | 2163 |
| 15 | Ga0070666_10163932 | 3300005335 | Bacteria | 1554 |
| 16 | Ga0070680_100226992 | 3300005336 | Bacteria | 1577 |
| 17 | Ga0070682_100020291 | 3300005337 | Bacteria | 3909 |
| 18 | Ga0070682_100103520 | 3300005337 | Bacteria | 1884 |
| 19 | Ga0070682_100437656 | 3300005337 | Bacteria | 998 |
| 20 | Ga0068868_100000368 | 3300005338 | Bacteria | 30659 |
| 21 | Ga0068868_100691825 | 3300005338 | Bacteria | 911 |
| 22 | Ga0068868_100760211 | 3300005338 | Bacteria | 871 |
| 23 | Ga0070660_100078661 | 3300005339 | Bacteria | 2586 |
| 24 | Ga0070689_100007743 | 3300005340 | Bacteria | 7529 |
| 25 | Ga0070689_100063106 | 3300005340 | Bacteria | 2883 |
| 26 | Ga0070691_10000295 | 3300005341 | Bacteria | 17402 |
| 27 | Ga0070687_100142883 | 3300005343 | Bacteria | 1396 |
| 28 | Ga0070661_100957183 | 3300005344 | Bacteria | 709 |
| 29 | Ga0070692_10096628 | 3300005345 | Bacteria | 1614 |
| 30 | Ga0070668_100000317 | 3300005347 | Bacteria | 31873 |
| 31 | Ga0070668_100007746 | 3300005347 | Bacteria | 7972 |
| 32 | Ga0070668_100064891 | 3300005347 | Bacteria | 2832 |
| 33 | Ga0070668_100819976 | 3300005347 | Bacteria | 828 |
| 34 | Ga0070669_100000608 | 3300005353 | Bacteria | 26606 |
| 35 | Ga0070669_100001421 | 3300005353 | Bacteria | 17305 |
| 36 | Ga0070671_100000885 | 3300005355 | Bacteria | 21862 |
| 37 | Ga0070671_100112141 | 3300005355 | Bacteria | 2291 |
| 38 | Ga0070671_100164488 | 3300005355 | Bacteria | 1876 |
| 39 | Ga0070674_100000546 | 3300005356 | Bacteria | 18863 |
| 40 | Ga0070674_100889148 | 3300005356 | Bacteria | 775 |
| 41 | Ga0070659_100014528 | 3300005366 | Bacteria | 5884 |
| 42 | Ga0070659_100097283 | 3300005366 | Bacteria | 2365 |
| 43 | Ga0070667_100000449 | 3300005367 | Bacteria | 42699 |
| 44 | Ga0070667_100001275 | 3300005367 | Bacteria | 22797 |
| 45 | Ga0070667_100001922 | 3300005367 | Bacteria | 18430 |
| 46 | Ga0070667_100010892 | 3300005367 | Bacteria | 7522 |
| 47 | Ga0070667_100045599 | 3300005367 | Bacteria | 3686 |
| 48 | Ga0070667_100062358 | 3300005367 | Bacteria | 3158 |
| 49 | Ga0070667_100321273 | 3300005367 | Bacteria | 1397 |
| 50 | Ga0070709_10020423 | 3300005434 | Bacteria | 3842 |
| 51 | Ga0070709_10043149 | 3300005434 | Bacteria | 2788 |
| 52 | Ga0070714_100343671 | 3300005435 | Bacteria | 1400 |
| 53 | Ga0070710_10001273 | 3300005437 | Bacteria | 11973 |
| 54 | Ga0070701_10000553 | 3300005438 | Bacteria | 12945 |
| 55 | Ga0070711_100000373 | 3300005439 | Bacteria | 23196 |
| 56 | Ga0070711_100001530 | 3300005439 | Bacteria | 12732 |
| 57 | Ga0070705_100013036 | 3300005440 | Bacteria | 4242 |
| 58 | Ga0070705_100029378 | 3300005440 | Bacteria | 3023 |
| 59 | Ga0070705_100254699 | 3300005440 | Bacteria | 1234 |
| 60 | Ga0070700_100001198 | 3300005441 | Bacteria | 12851 |
| 61 | Ga0070700_100020109 | 3300005441 | Bacteria | 3861 |
| 62 | Ga0070700_100603127 | 3300005441 | Bacteria | 860 |
| 63 | Ga0070694_100405688 | 3300005444 | Bacteria | 1068 |
| 64 | Ga0070708_101074948 | 3300005445 | Bacteria | 754 |
| 65 | Ga0070663_100035641 | 3300005455 | Bacteria | 3453 |
| 66 | Ga0070663_100409456 | 3300005455 | Bacteria | 1110 |
| 67 | Ga0070678_100000037 | 3300005456 | Bacteria | 43961 |
| 68 | Ga0070678_100083646 | 3300005456 | Bacteria | 2426 |
| 69 | Ga0070678_100276816 | 3300005456 | Bacteria | 1417 |
| 70 | Ga0070678_100528260 | 3300005456 | Bacteria | 1045 |
| 71 | Ga0070662_100007600 | 3300005457 | Bacteria | 7036 |
| 72 | Ga0070662_100315991 | 3300005457 | Bacteria | 1273 |
| 73 | Ga0068867_100000663 | 3300005459 | Bacteria | 22813 |
| 74 | Ga0070685_10020288 | 3300005466 | Bacteria | 3597 |
| 75 | Ga0070697_100182750 | 3300005536 | Bacteria | 1778 |
| 76 | Ga0068853_100001014 | 3300005539 | Bacteria | 19779 |
| 77 | Ga0068853_100012220 | 3300005539 | Bacteria | 6982 |
| 78 | Ga0070686_100023920 | 3300005544 | Bacteria | 3657 |
| 79 | Ga0070686_100039417 | 3300005544 | Bacteria | 2944 |
| 80 | Ga0070695_100002297 | 3300005545 | Bacteria | 10958 |
| 81 | Ga0070696_100002252 | 3300005546 | Bacteria | 12720 |
| 82 | Ga0070696_100035906 | 3300005546 | Bacteria | 3415 |
| 83 | Ga0070665_100002725 | 3300005548 | Bacteria | 19146 |
| 84 | Ga0070665_100009036 | 3300005548 | Bacteria | 10095 |
| 85 | Ga0070665_100335011 | 3300005548 | Bacteria | 1518 |
| 86 | Ga0070704_100000167 | 3300005549 | Bacteria | 26061 |
| 87 | Ga0070704_100281754 | 3300005549 | Bacteria | 1377 |
| 88 | Ga0068854_100000837 | 3300005578 | Bacteria | 18405 |
| 89 | Ga0068854_100115768 | 3300005578 | Bacteria | 2028 |
| 90 | Ga0068854_100300934 | 3300005578 | Bacteria | 1297 |
| 91 | Ga0068854_100497279 | 3300005578 | Bacteria | 1026 |
| 92 | Ga0070702_100000221 | 3300005615 | Bacteria | 19181 |
| 93 | Ga0068852_100097272 | 3300005616 | Bacteria | 2648 |
| 94 | Ga0068859_100000115 | 3300005617 | Bacteria | 75584 |
| 95 | Ga0068859_100003512 | 3300005617 | Bacteria | 15966 |
| 96 | Ga0068859_100254287 | 3300005617 | Bacteria | 1847 |
| 97 | Ga0068859_100642288 | 3300005617 | Bacteria | 1153 |
| 98 | Ga0068864_100281608 | 3300005618 | Bacteria | 1552 |
| 99 | Ga0068864_100860380 | 3300005618 | Bacteria | 894 |
| 100 | Ga0068864_101429512 | 3300005618 | Bacteria | 694 |
| 101 | Ga0068866_10000433 | 3300005718 | Bacteria | 19396 |
| 102 | Ga0068866_10014818 | 3300005718 | Bacteria | 3451 |
| 103 | Ga0068861_100000054 | 3300005719 | Bacteria | 53529 |
| 104 | Ga0068861_100719351 | 3300005719 | Bacteria | 930 |
| 105 | Ga0068851_10130214 | 3300005834 | Bacteria | 1360 |
| 106 | Ga0068863_100001736 | 3300005841 | Bacteria | 21578 |
| 107 | Ga0068863_100004141 | 3300005841 | Bacteria | 14330 |
| 108 | Ga0068863_100170764 | 3300005841 | Bacteria | 2086 |
| 109 | Ga0068858_100000611 | 3300005842 | Bacteria | 37350 |
| 110 | Ga0068858_100009518 | 3300005842 | Bacteria | 9271 |
| 111 | Ga0068858_100243100 | 3300005842 | Bacteria | 1708 |
| 112 | Ga0068858_100298082 | 3300005842 | Bacteria | 1538 |
| 113 | Ga0068858_100716181 | 3300005842 | Bacteria | 974 |
| 114 | Ga0068860_100000044 | 3300005843 | Bacteria | 225595 |
| 115 | Ga0068860_100000518 | 3300005843 | Bacteria | 47295 |
| 116 | Ga0068860_100394944 | 3300005843 | Bacteria | 1367 |
| 117 | Ga0068860_100643541 | 3300005843 | Bacteria | 1068 |
| 118 | Ga0068862_100000003 | 3300005844 | Bacteria | 369793 |
| 119 | Ga0068862_100001262 | 3300005844 | Bacteria | 23799 |
| 120 | Ga0068862_100114122 | 3300005844 | Bacteria | 2374 |
| 121 | Ga0068862_100369474 | 3300005844 | Bacteria | 1335 |
| 122 | Ga0081455_10034334 | 3300005937 | Bacteria | 4546 |
| 123 | Ga0081455_10240099 | 3300005937 | Bacteria | 1332 |
| 124 | Ga0075365_10069277 | 3300006038 | Bacteria | 2371 |
| 125 | Ga0075365_10074156 | 3300006038 | Bacteria | 2295 |
| 126 | Ga0075365_10083796 | 3300006038 | Bacteria | 2163 |
| 127 | Ga0075365_10188425 | 3300006038 | Bacteria | 1443 |
| 128 | Ga0075365_10204154 | 3300006038 | Bacteria | 1385 |
| 129 | Ga0075368_10004196 | 3300006042 | Bacteria | 4855 |
| 130 | Ga0075363_100036625 | 3300006048 | Bacteria | 2574 |
| 131 | Ga0075363_100040520 | 3300006048 | Bacteria | 2455 |
| 132 | Ga0075363_100180696 | 3300006048 | Bacteria | 1200 |
| 133 | Ga0075363_100411439 | 3300006048 | Bacteria | 796 |
| 134 | Ga0075364_10001027 | 3300006051 | Bacteria | 14820 |
| 135 | Ga0075364_10006525 | 3300006051 | Bacteria | 6860 |
| 136 | Ga0075364_10044590 | 3300006051 | Bacteria | 2885 |
| 137 | Ga0075364_10128886 | 3300006051 | Bacteria | 1697 |
| 138 | Ga0070715_10000541 | 3300006163 | Bacteria | 9922 |
| 139 | Ga0070716_100004716 | 3300006173 | Bacteria | 6539 |
| 140 | Ga0070716_100020070 | 3300006173 | Bacteria | 3504 |
| 141 | Ga0070712_100000149 | 3300006175 | Bacteria | 37058 |
| 142 | Ga0070712_100006865 | 3300006175 | Bacteria | 7094 |
| 143 | Ga0075362_10015408 | 3300006177 | Bacteria | 3110 |
| 144 | Ga0075362_10034265 | 3300006177 | Bacteria | 2212 |
| 145 | Ga0075362_10154610 | 3300006177 | Bacteria | 1102 |
| 146 | Ga0075367_10000319 | 3300006178 | Bacteria | 16995 |
| 147 | Ga0075367_10364296 | 3300006178 | Bacteria | 913 |
| 148 | Ga0075369_10001372 | 3300006186 | Bacteria | 8291 |
| 149 | Ga0075369_10056795 | 3300006186 | Bacteria | 1701 |
| 150 | Ga0075369_10305168 | 3300006186 | Bacteria | 743 |
| 151 | Ga0075369_10312452 | 3300006186 | Bacteria | 735 |
| 152 | Ga0075366_10072722 | 3300006195 | Bacteria | 2049 |
| 153 | Ga0075370_10022798 | 3300006353 | Bacteria | 3442 |
| 154 | Ga0075370_10047521 | 3300006353 | Bacteria | 2430 |
| 155 | Ga0075370_10065067 | 3300006353 | Bacteria | 2079 |
| 156 | Ga0068871_100026059 | 3300006358 | Bacteria | 4558 |
| 157 | Ga0075428_100014509 | 3300006844 | Bacteria | 8751 |
| 158 | Ga0075430_100936032 | 3300006846 | Bacteria | 714 |
| 159 | Ga0075431_100024577 | 3300006847 | Bacteria | 6175 |
| 160 | Ga0068865_100000280 | 3300006881 | Bacteria | 28132 |
| 161 | Ga0068865_100059755 | 3300006881 | Bacteria | 2667 |
| 162 | Ga0097620_100000115 | 3300006931 | Bacteria | 75584 |
| 163 | Ga0097620_100003512 | 3300006931 | Bacteria | 15966 |
| 164 | Ga0097620_100254309 | 3300006931 | Bacteria | 1847 |
| 165 | Ga0097620_100642296 | 3300006931 | Bacteria | 1153 |
| 166 | Ga0111539_10098088 | 3300009094 | Bacteria | 3442 |
| 167 | Ga0105245_10000377 | 3300009098 | Bacteria | 41447 |
| 168 | Ga0105245_10664927 | 3300009098 | Bacteria | 1073 |
| 169 | Ga0105247_10000006 | 3300009101 | Bacteria | 416061 |
| 170 | Ga0105247_10001325 | 3300009101 | Bacteria | 18063 |
| 171 | Ga0105247_10088990 | 3300009101 | Bacteria | 1957 |
| 172 | Ga0114129_10015258 | 3300009147 | Bacteria | 10934 |
| 173 | Ga0105243_10000755 | 3300009148 | Bacteria | 31023 |
| 174 | Ga0105243_10054529 | 3300009148 | Bacteria | 3174 |
| 175 | Ga0105243_10500414 | 3300009148 | Bacteria | 1151 |
| 176 | Ga0105241_10439071 | 3300009174 | Bacteria | 1152 |
| 177 | Ga0105242_10000366 | 3300009176 | Bacteria | 36059 |
| 178 | Ga0105242_11353990 | 3300009176 | Bacteria | 737 |
| 179 | Ga0105248_10000062 | 3300009177 | Bacteria | 124366 |
| 180 | Ga0105248_10005684 | 3300009177 | Bacteria | 13701 |
| 181 | Ga0105248_10064178 | 3300009177 | Bacteria | 4123 |
| 182 | Ga0105248_10414615 | 3300009177 | Bacteria | 1517 |
| 183 | Ga0105237_10004702 | 3300009545 | Bacteria | 15713 |
| 184 | Ga0105237_10037459 | 3300009545 | Bacteria | 4903 |
| 185 | Ga0105238_10180343 | 3300009551 | Bacteria | 2089 |
| 186 | Ga0105249_10000008 | 3300009553 | Bacteria | 341271 |
| 187 | Ga0105249_10000641 | 3300009553 | Bacteria | 31931 |
| 188 | Ga0105249_10002622 | 3300009553 | Bacteria | 15574 |
| 189 | Ga0105239_10005099 | 3300010375 | Bacteria | 15506 |
| 190 | Ga0105239_10009692 | 3300010375 | Bacteria | 10829 |
| 191 | Ga0105239_10312017 | 3300010375 | Bacteria | 1773 |
| 192 | Ga0105239_11186457 | 3300010375 | Bacteria | 879 |
| 193 | Ga0105246_10025918 | 3300011119 | Bacteria | 3824 |
| 194 | Ga0157374_10024956 | 3300013296 | Bacteria | 5363 |
| 195 | Ga0157374_10058948 | 3300013296 | Bacteria | 3588 |
| 196 | Ga0157378_10001832 | 3300013297 | Bacteria | 19089 |
| 197 | Ga0163162_10002253 | 3300013306 | Bacteria | 18114 |
| 198 | Ga0163162_10248625 | 3300013306 | Bacteria | 1910 |
| 199 | Ga0163162_10719411 | 3300013306 | Bacteria | 1119 |
| 200 | Ga0157372_10038543 | 3300013307 | Bacteria | 5274 |
| 201 | Ga0157375_10002135 | 3300013308 | Bacteria | 17079 |
| 202 | Ga0157375_10133375 | 3300013308 | Bacteria | 2605 |
| 203 | Ga0163163_10162152 | 3300014325 | Bacteria | 2281 |
| 204 | Ga0163163_10854240 | 3300014325 | Bacteria | 973 |
| 205 | Ga0163163_10941852 | 3300014325 | Bacteria | 927 |
| 206 | Ga0157380_10000116 | 3300014326 | Bacteria | 44047 |
| 207 | Ga0157380_10022573 | 3300014326 | Bacteria | 4742 |
| 208 | Ga0182008_10238479 | 3300014497 | Bacteria | 935 |
| 209 | Ga0157377_10025833 | 3300014745 | Bacteria | 3136 |
| 210 | Ga0157377_10248067 | 3300014745 | Bacteria | 1152 |
| 211 | Ga0157379_10003618 | 3300014968 | Bacteria | 13115 |
| 212 | Ga0157379_10633006 | 3300014968 | Bacteria | 1000 |
| 213 | Ga0157376_11021086 | 3300014969 | Bacteria | 850 |
| 214 | Ga0163161_10001682 | 3300017792 | Bacteria | 16227 |
| 215 | Ga0163161_10420461 | 3300017792 | Bacteria | 1075 |
| 216 | Ga0213876_10005413 | 3300021384 | Bacteria | 7027 |
| 217 | Ga0213876_10015785 | 3300021384 | Bacteria | 3997 |
| 218 | Ga0213876_10015815 | 3300021384 | Bacteria | 3993 |
| 219 | Ga0213876_10059955 | 3300021384 | Bacteria | 2008 |
| 220 | Ga0213876_10210755 | 3300021384 | Bacteria | 1033 |
| 221 | Ga0213876_10297751 | 3300021384 | Bacteria | 857 |
| 222 | Ga0213875_10004015 | 3300021388 | Bacteria | 8201 |
| 223 | Ga0213875_10037620 | 3300021388 | Bacteria | 2280 |
| 224 | Ga0209673_1031988 | 3300025273 | Bacteria | 1627 |
| 225 | Ga0209673_1061471 | 3300025273 | Bacteria | 936 |
| 226 | Ga0209051_1000011 | 3300025303 | Bacteria | 610828 |
| 227 | Ga0209051_1001162 | 3300025303 | Bacteria | 23957 |
| 228 | Ga0209051_1001628 | 3300025303 | Bacteria | 18205 |
| 229 | Ga0207692_10003227 | 3300025898 | Bacteria | 6340 |
| 230 | Ga0207642_10000079 | 3300025899 | Bacteria | 25260 |
| 231 | Ga0207642_10093693 | 3300025899 | Bacteria | 1490 |
| 232 | Ga0207642_10250778 | 3300025899 | Bacteria | 1004 |
| 233 | Ga0207710_10000025 | 3300025900 | Bacteria | 314658 |
| 234 | Ga0207710_10002391 | 3300025900 | Bacteria | 8758 |
| 235 | Ga0207710_10029722 | 3300025900 | Bacteria | 2380 |
| 236 | Ga0207688_10001038 | 3300025901 | Bacteria | 14239 |
| 237 | Ga0207688_10004437 | 3300025901 | Bacteria | 7638 |
| 238 | Ga0207685_10005401 | 3300025905 | Bacteria | 3371 |
| 239 | Ga0207685_10143676 | 3300025905 | Bacteria | 1072 |
| 240 | Ga0207699_10017065 | 3300025906 | Bacteria | 3812 |
| 241 | Ga0207699_10135009 | 3300025906 | Bacteria | 1614 |
| 242 | Ga0207645_10011399 | 3300025907 | Bacteria | 6073 |
| 243 | Ga0207645_10146461 | 3300025907 | Bacteria | 1540 |
| 244 | Ga0207671_10014029 | 3300025914 | Bacteria | 6354 |
| 245 | Ga0207671_10147538 | 3300025914 | Bacteria | 1815 |
| 246 | Ga0207693_10002006 | 3300025915 | Bacteria | 17867 |
| 247 | Ga0207693_10004717 | 3300025915 | Bacteria | 11468 |
| 248 | Ga0207663_10000753 | 3300025916 | Bacteria | 14446 |
| 249 | Ga0207663_10004414 | 3300025916 | Bacteria | 6984 |
| 250 | Ga0207660_10204815 | 3300025917 | Bacteria | 1542 |
| 251 | Ga0207662_10098206 | 3300025918 | Bacteria | 1812 |
| 252 | Ga0207657_10419673 | 3300025919 | Bacteria | 1051 |
| 253 | Ga0207652_10226824 | 3300025921 | Bacteria | 1684 |
| 254 | Ga0207681_10004038 | 3300025923 | Bacteria | 9104 |
| 255 | Ga0207681_10019492 | 3300025923 | Bacteria | 4286 |
| 256 | Ga0207694_10101320 | 3300025924 | Bacteria | 2282 |
| 257 | Ga0207659_10323353 | 3300025926 | Bacteria | 1273 |
| 258 | Ga0207687_10011682 | 3300025927 | Bacteria | 5743 |
| 259 | Ga0207700_10252700 | 3300025928 | Bacteria | 1506 |
| 260 | Ga0207664_10464633 | 3300025929 | Bacteria | 1130 |
| 261 | Ga0207644_10015232 | 3300025931 | Bacteria | 5159 |
| 262 | Ga0207644_10039181 | 3300025931 | Bacteria | 3344 |
| 263 | Ga0207644_10078781 | 3300025931 | Bacteria | 2429 |
| 264 | Ga0207644_10160271 | 3300025931 | Bacteria | 1748 |
| 265 | Ga0207690_10004486 | 3300025932 | Bacteria | 8243 |
| 266 | Ga0207690_10143708 | 3300025932 | Bacteria | 1761 |
| 267 | Ga0207706_10002057 | 3300025933 | Bacteria | 19713 |
| 268 | Ga0207706_10088809 | 3300025933 | Bacteria | 2717 |
| 269 | Ga0207686_10012506 | 3300025934 | Bacteria | 4667 |
| 270 | Ga0207686_10556506 | 3300025934 | Bacteria | 897 |
| 271 | Ga0207709_10001983 | 3300025935 | Bacteria | 13354 |
| 272 | Ga0207670_10023492 | 3300025936 | Bacteria | 3839 |
| 273 | Ga0207669_10000369 | 3300025937 | Bacteria | 20182 |
| 274 | Ga0207704_10000212 | 3300025938 | Bacteria | 29411 |
| 275 | Ga0207665_10006390 | 3300025939 | Bacteria | 7818 |
| 276 | Ga0207665_10016697 | 3300025939 | Bacteria | 4821 |
| 277 | Ga0207711_10000358 | 3300025941 | Bacteria | 48462 |
| 278 | Ga0207711_10041132 | 3300025941 | Bacteria | 3935 |
| 279 | Ga0207711_10176485 | 3300025941 | Bacteria | 1941 |
| 280 | Ga0207689_10007708 | 3300025942 | Bacteria | 9422 |
| 281 | Ga0207661_10112191 | 3300025944 | Bacteria | 2308 |
| 282 | Ga0207661_10192211 | 3300025944 | Bacteria | 1790 |
| 283 | Ga0207667_10247433 | 3300025949 | Bacteria | 1824 |
| 284 | Ga0207651_10224301 | 3300025960 | Bacteria | 1521 |
| 285 | Ga0207712_10000011 | 3300025961 | Bacteria | 412321 |
| 286 | Ga0207712_10004542 | 3300025961 | Bacteria | 8759 |
| 287 | Ga0207668_10001402 | 3300025972 | Bacteria | 14196 |
| 288 | Ga0207668_10004333 | 3300025972 | Bacteria | 8331 |
| 289 | Ga0207668_10028012 | 3300025972 | Bacteria | 3678 |
| 290 | Ga0207668_10438541 | 3300025972 | Bacteria | 1112 |
| 291 | Ga0207640_10011223 | 3300025981 | Bacteria | 5068 |
| 292 | Ga0207640_10209008 | 3300025981 | Bacteria | 1485 |
| 293 | Ga0207640_10237538 | 3300025981 | Bacteria | 1406 |
| 294 | Ga0207640_10543522 | 3300025981 | Bacteria | 975 |
| 295 | Ga0207658_10000387 | 3300025986 | Bacteria | 42781 |
| 296 | Ga0207658_10001930 | 3300025986 | Bacteria | 15477 |
| 297 | Ga0207658_10011470 | 3300025986 | Bacteria | 6031 |
| 298 | Ga0207658_10041021 | 3300025986 | Bacteria | 3349 |
| 299 | Ga0207658_10050680 | 3300025986 | Bacteria | 3056 |
| 300 | Ga0207658_10104058 | 3300025986 | Bacteria | 2230 |
| 301 | Ga0207677_10009463 | 3300026023 | Bacteria | 5484 |
| 302 | Ga0207677_10159070 | 3300026023 | Bacteria | 1753 |
| 303 | Ga0207703_10007381 | 3300026035 | Bacteria | 8732 |
| 304 | Ga0207703_10044490 | 3300026035 | Bacteria | 3568 |
| 305 | Ga0207703_10217904 | 3300026035 | Bacteria | 1705 |
| 306 | Ga0207703_10717427 | 3300026035 | Bacteria | 951 |
| 307 | Ga0207639_10004955 | 3300026041 | Bacteria | 8968 |
| 308 | Ga0207639_10012602 | 3300026041 | Bacteria | 5892 |
| 309 | Ga0207678_10037419 | 3300026067 | Bacteria | 4220 |
| 310 | Ga0207678_10231975 | 3300026067 | Bacteria | 1580 |
| 311 | Ga0207678_10271153 | 3300026067 | Bacteria | 1455 |
| 312 | Ga0207708_10002240 | 3300026075 | Bacteria | 14255 |
| 313 | Ga0207708_10033635 | 3300026075 | Bacteria | 3896 |
| 314 | Ga0207702_10517303 | 3300026078 | Bacteria | 1165 |
| 315 | Ga0207641_10000450 | 3300026088 | Bacteria | 47057 |
| 316 | Ga0207641_10011586 | 3300026088 | Bacteria | 7237 |
| 317 | Ga0207641_10546189 | 3300026088 | Bacteria | 1129 |
| 318 | Ga0207648_10000231 | 3300026089 | Bacteria | 59662 |
| 319 | Ga0207648_10061408 | 3300026089 | Bacteria | 3277 |
| 320 | Ga0207676_10623168 | 3300026095 | Bacteria | 1038 |
| 321 | Ga0207676_10916504 | 3300026095 | Bacteria | 860 |
| 322 | Ga0207675_100000398 | 3300026118 | Bacteria | 41651 |
| 323 | Ga0207675_100047669 | 3300026118 | Bacteria | 4000 |
| 324 | Ga0207675_100077890 | 3300026118 | Bacteria | 3106 |
| 325 | Ga0207675_100355527 | 3300026118 | Bacteria | 1436 |
| 326 | Ga0207675_100392835 | 3300026118 | Bacteria | 1366 |
| 327 | Ga0207683_10000128 | 3300026121 | Bacteria | 62142 |
| 328 | Ga0207683_10018223 | 3300026121 | Bacteria | 5989 |
| 329 | Ga0207698_10060585 | 3300026142 | Bacteria | 2944 |
| 330 | Ga0268266_10005109 | 3300028379 | Bacteria | 12367 |
| 331 | Ga0268266_10005399 | 3300028379 | Bacteria | 11934 |
| 332 | Ga0268266_10181355 | 3300028379 | Bacteria | 1917 |
| 333 | Ga0268266_11150424 | 3300028379 | Bacteria | 751 |
| 334 | Ga0268265_10000010 | 3300028380 | Bacteria | 370129 |
| 335 | Ga0268265_10051370 | 3300028380 | Bacteria | 3111 |
| 336 | Ga0268264_10000007 | 3300028381 | Bacteria | 815790 |
| 337 | Ga0268264_10001462 | 3300028381 | Bacteria | 22074 |
| 338 | Ga0268264_10457573 | 3300028381 | Bacteria | 1237 |
| 339 | Ga0265338_10031399 | 3300028800 | Bacteria | 5209 |
| 340 | Ga0316177_1030021 | 3300030731 | Bacteria | 919 |
| 341 | Ga0316176_1108788 | 3300030732 | Bacteria | 2750 |
| 342 | Ga0314311_1004140 | 3300030733 | Bacteria | 3540 |
| 343 | Ga0316180_1058331 | 3300030736 | Bacteria | 1060 |
| 344 | Ga0265327_10000825 | 3300031251 | Bacteria | 46672 |
| 345 | Ga0265327_10001171 | 3300031251 | Bacteria | 35592 |
| 346 | Ga0265327_10028441 | 3300031251 | Bacteria | 3198 |
| 347 | Ga0265327_10043730 | 3300031251 | Bacteria | 2394 |
| 348 | Ga0307408_100838391 | 3300031548 | Bacteria | 837 |
| 349 | Ga0316578_10014326 | 3300031728 | Bacteria | 4233 |
| 350 | Ga0307413_10161914 | 3300031824 | Bacteria | 1573 |
| 351 | Ga0307406_10379966 | 3300031901 | Bacteria | 1113 |
| 352 | Ga0307406_10763107 | 3300031901 | Bacteria | 813 |
| 353 | Ga0307407_10156312 | 3300031903 | Bacteria | 1488 |
| 354 | Ga0307412_10414974 | 3300031911 | Bacteria | 1100 |
| 355 | Ga0307412_11227716 | 3300031911 | Bacteria | 672 |
| 356 | Ga0307409_100109405 | 3300031995 | Bacteria | 2314 |
| 357 | Ga0307416_100076630 | 3300032002 | Bacteria | 2804 |
| 358 | Ga0307416_101310867 | 3300032002 | Bacteria | 830 |
| 359 | Ga0307414_10839778 | 3300032004 | Bacteria | 839 |
| 360 | Ga0307415_100633615 | 3300032126 | Bacteria | 956 |
| 361 | Ga0373948_0018989 | 3300034817 | Bacteria | 1296 |
| 362 | Ga0373959_0036356 | 3300034820 | Bacteria | 1016 |
| 363 | Ga0373929_0074450 | 3300035085 | Bacteria | 817 |
| 364 | Ga0373952_0016452 | 3300035092 | Bacteria | 1504 |
| 365 | Ga0373931_0015952 | 3300035691 | Bacteria | 3692 |
| 366 | Ga0373947_0059509 | 3300035725 | Bacteria | 2316 |
| 367 | Ga0372808_000543 | 3300036459 | Bacteria | 3095 |
| 368 | Ga0316584_0149949 | 3300036712 | Bacteria | 1736 |
| 369 | Ga0395898_0463178 | 3300037466 | Bacteria | 1207 |
| 370 | Ga0436364_0185516 | 3300037853 | Bacteria | 19672 |
| 371 | Ga0436364_0793855 | 3300037853 | Bacteria | 3148 |
| 372 | Ga0436365_0434410 | 3300039437 | Bacteria | 16475 |
| 373 | Ga0436365_0674802 | 3300039437 | Bacteria | 19112 |
| 374 | Ga0436365_0708236 | 3300039437 | Bacteria | 25469 |
| 375 | Ga0436365_1329591 | 3300039437 | Bacteria | 10319 |
| 376 | Ga0436365_1931466 | 3300039437 | Bacteria | 2996 |
| 377 | Ga0436363_1277218 | 3300039450 | Bacteria | 923 |
| 378 | Ga0436363_1338388 | 3300039450 | Bacteria | 8210 |
| 379 | Ga0439461_0002376 | 3300041410 | Bacteria | 2998 |
| 380 | Ga0439466_0003950 | 3300041411 | Bacteria | 5717 |
| 381 | Ga0439466_0016027 | 3300041411 | Bacteria | 2714 |
| 382 | Ga0439466_0021631 | 3300041411 | Bacteria | 2276 |
| 383 | Ga0439466_0061425 | 3300041411 | Bacteria | 1209 |
| 384 | Ga0439465_0000487 | 3300041413 | Bacteria | 11799 |
| 385 | Ga0439465_0001464 | 3300041413 | Bacteria | 7651 |
| 386 | Ga0439465_0027949 | 3300041413 | Bacteria | 1787 |
| 387 | Ga0451791_1249914 | 3300041451 | Bacteria | 1032 |
| 388 | Ga0439431_0003360 | 3300041997 | Bacteria | 3518 |
| 389 | Ga0439442_022750 | 3300042002 | Bacteria | 1302 |
| 390 | Ga0439445_0001092 | 3300042004 | Bacteria | 5797 |
| 391 | Ga0439434_0007297 | 3300042435 | Bacteria | 3239 |
| 392 | Ga0466972_0002789 | 3300044658 | Bacteria | 8662 |
| 393 | Ga0466972_0019631 | 3300044658 | Bacteria | 3379 |
| 394 | Ga0466972_0031037 | 3300044658 | Bacteria | 2630 |
| 395 | Ga0466972_0052171 | 3300044658 | Bacteria | 1972 |
| 396 | Ga0466965_0020025 | 3300044683 | Bacteria | 3214 |
| 397 | Ga0466965_0020335 | 3300044683 | Bacteria | 3190 |
| 398 | Ga0466965_0023239 | 3300044683 | Bacteria | 2993 |
| 399 | Ga0466965_0026034 | 3300044683 | Bacteria | 2834 |
| 400 | Ga0466966_0045383 | 3300044684 | Bacteria | 2809 |
| 401 | Ga0466966_0445420 | 3300044684 | Bacteria | 778 |
| 402 | Ga0466961_0008283 | 3300044693 | Bacteria | 6619 |
| 403 | Ga0466963_0009064 | 3300044694 | Bacteria | 5980 |
| 404 | Ga0466963_0143369 | 3300044694 | Bacteria | 1656 |
| 405 | Ga0466971_0347592 | 3300044719 | Bacteria | 717 |
| 406 | Ga0466968_0012489 | 3300044735 | Bacteria | 3326 |
| 407 | Ga0466968_0026999 | 3300044735 | Bacteria | 2360 |
| 408 | Ga0466968_0035172 | 3300044735 | Bacteria | 2095 |
| 409 | Ga0466970_0014776 | 3300044765 | Bacteria | 4012 |
| 410 | Ga0466970_0048192 | 3300044765 | Bacteria | 2271 |
| 411 | Ga0466970_0127678 | 3300044765 | Bacteria | 1395 |
| 412 | Ga0466957_0029594 | 3300044842 | Bacteria | 3267 |
| 413 | Ga0466957_0055843 | 3300044842 | Bacteria | 2413 |
| 414 | Ga0466957_0110072 | 3300044842 | Bacteria | 1746 |
| 415 | Ga0466960_0000101 | 3300044901 | Bacteria | 28225 |
| 416 | Ga0466960_0000133 | 3300044901 | Bacteria | 25184 |
| 417 | Ga0466960_0000933 | 3300044901 | Bacteria | 10335 |
| 418 | Ga0466960_0020001 | 3300044901 | Bacteria | 2959 |
| 419 | Ga0466959_0015686 | 3300045049 | Bacteria | 5524 |
| 420 | Ga0466959_0057556 | 3300045049 | Bacteria | 2833 |
| 421 | Ga0466959_0068639 | 3300045049 | Bacteria | 2568 |
| 422 | Ga0466959_0162869 | 3300045049 | Bacteria | 1567 |
| 423 | Ga0466958_0001122 | 3300045836 | Bacteria | 12366 |
| 424 | Ga0466958_0111650 | 3300045836 | Bacteria | 1707 |
| 425 | Ga0466967_0005423 | 3300045976 | Bacteria | 8838 |
| 426 | Ga0466967_0032467 | 3300045976 | Bacteria | 4409 |
| 427 | Ga0466967_0034160 | 3300045976 | Bacteria | 4313 |
| 428 | Ga0466967_0071500 | 3300045976 | Bacteria | 3107 |
| 429 | Ga0466967_0274376 | 3300045976 | Bacteria | 1616 |
| 430 | Ga0466967_0310803 | 3300045976 | Bacteria | 1518 |
| 431 | Ga0466967_0350393 | 3300045976 | Bacteria | 1429 |
| 432 | Ga0466967_0362300 | 3300045976 | Bacteria | 1405 |
| 433 | Ga0466967_0872519 | 3300045976 | Bacteria | 894 |
| 434 | Ga0495603_0059116 | 3300046455 | Bacteria | 2266 |
| 435 | Ga0495638_0005329 | 3300046460 | Bacteria | 9591 |
| 436 | Ga0495638_0013236 | 3300046460 | Bacteria | 5626 |
| 437 | Ga0495641_0020991 | 3300046461 | Bacteria | 3296 |
| 438 | Ga0495582_0026802 | 3300046473 | Bacteria | 3159 |
| 439 | Ga0495630_0280023 | 3300046517 | Bacteria | 1274 |
| 440 | Ga0495644_0108466 | 3300046523 | Bacteria | 1053 |
| 441 | Ga0495648_0009272 | 3300046524 | Bacteria | 7649 |
| 442 | Ga0495666_0069975 | 3300046526 | Bacteria | 1669 |
| 443 | Ga0495652_0308664 | 3300046529 | Bacteria | 1147 |
| 444 | Ga0495640_0025396 | 3300046533 | Bacteria | 4298 |
| 445 | Ga0495622_0118289 | 3300046557 | Bacteria | 1211 |
| 446 | Ga0495625_0152503 | 3300046660 | Bacteria | 1553 |
| 447 | Ga0495658_0015674 | 3300046683 | Bacteria | 3891 |
| 448 | Ga0495674_0114660 | 3300047319 | Bacteria | 2281 |
| 449 | Ga0495672_0054223 | 3300047320 | Bacteria | 2345 |
| 450 | Ga0495676_0039056 | 3300047321 | Bacteria | 3936 |
| 451 | Ga0495673_0000862 | 3300047469 | Bacteria | 28098 |
| 452 | Ga0495686_0004602 | 3300047472 | Bacteria | 11244 |
| 453 | Ga0495626_0070877 | 3300048091 | Bacteria | 1567 |
| 454 | Ga0496100_0000041 | 3300048903 | Bacteria | 92857 |
| 455 | Ga0496100_0001769 | 3300048903 | Bacteria | 10785 |
| 456 | Ga0496100_0011177 | 3300048903 | Bacteria | 5102 |
| 457 | Ga0496100_0047118 | 3300048903 | Bacteria | 2776 |
| 458 | Ga0496100_0100852 | 3300048903 | Bacteria | 1989 |
| 459 | Ga0496100_0193381 | 3300048903 | Bacteria | 1478 |
| 460 | Ga0496100_0431194 | 3300048903 | Bacteria | 1008 |
| 461 | Ga0496101_0000019 | 3300048904 | Bacteria | 220382 |
| 462 | Ga0496101_0000281 | 3300048904 | Bacteria | 35945 |
| 463 | Ga0496101_0000628 | 3300048904 | Bacteria | 21425 |
| 464 | Ga0496101_0013388 | 3300048904 | Bacteria | 5492 |
| 465 | Ga0496101_0022858 | 3300048904 | Bacteria | 4311 |
| 466 | Ga0496101_0037722 | 3300048904 | Bacteria | 3430 |
| 467 | Ga0496101_0182725 | 3300048904 | Bacteria | 1615 |
| 468 | Ga0496101_0236044 | 3300048904 | Bacteria | 1422 |
| 469 | Ga0496102_0000007 | 3300048905 | Bacteria | 417224 |
| 470 | Ga0496102_0000060 | 3300048905 | Bacteria | 167774 |
| 471 | Ga0496102_0007600 | 3300048905 | Bacteria | 9261 |
| 472 | Ga0496102_0025906 | 3300048905 | Bacteria | 5224 |
| 473 | Ga0496102_0041638 | 3300048905 | Bacteria | 4160 |
| 474 | Ga0496102_0129681 | 3300048905 | Bacteria | 2359 |
| 475 | Ga0496102_0182657 | 3300048905 | Bacteria | 1976 |
| 476 | Ga0496102_0328879 | 3300048905 | Bacteria | 1440 |
| 477 | Ga0496103_0000013 | 3300048906 | Bacteria | 297928 |
| 478 | Ga0496103_0000350 | 3300048906 | Bacteria | 41942 |
| 479 | Ga0496103_0000704 | 3300048906 | Bacteria | 24748 |
| 480 | Ga0496103_0007629 | 3300048906 | Bacteria | 6436 |
| 481 | Ga0496103_0070718 | 3300048906 | Bacteria | 2183 |
| 482 | Ga0496103_0115753 | 3300048906 | Bacteria | 1705 |
| 483 | Ga0496103_0206325 | 3300048906 | Bacteria | 1264 |
| 484 | Ga0496103_0426278 | 3300048906 | Bacteria | 851 |
| 485 | Ga0496103_0548983 | 3300048906 | Bacteria | 738 |
| 486 | Ga0496104_0004319 | 3300048907 | Bacteria | 12367 |
| 487 | Ga0496104_0005624 | 3300048907 | Bacteria | 10978 |
| 488 | Ga0496104_0550376 | 3300048907 | Bacteria | 1065 |
| 489 | Ga0496105_0141317 | 3300048908 | Bacteria | 1981 |
| 490 | Ga0496105_0488685 | 3300048908 | Bacteria | 968 |
| 491 | Ga0496105_0710277 | 3300048908 | Bacteria | 771 |
| 492 | Ga0496106_0000167 | 3300048909 | Bacteria | 47656 |
| 493 | Ga0496106_0001593 | 3300048909 | Bacteria | 17059 |
| 494 | Ga0496106_0009916 | 3300048909 | Bacteria | 7033 |
| 495 | Ga0496106_0011697 | 3300048909 | Bacteria | 6481 |
| 496 | Ga0496107_0001007 | 3300048910 | Bacteria | 16826 |
| 497 | Ga0496107_0005371 | 3300048910 | Bacteria | 8766 |
| 498 | Ga0496107_0011959 | 3300048910 | Bacteria | 6058 |
| 499 | Ga0496107_0192189 | 3300048910 | Bacteria | 1517 |
| 500 | Ga0496107_0199668 | 3300048910 | Bacteria | 1487 |
| 501 | Ga0496107_0511308 | 3300048910 | Bacteria | 891 |
| 502 | Ga0496108_0000986 | 3300048911 | Bacteria | 22141 |
| 503 | Ga0496108_0012411 | 3300048911 | Bacteria | 6933 |
| 504 | Ga0496108_0031378 | 3300048911 | Bacteria | 4409 |
| 505 | Ga0496108_0205308 | 3300048911 | Bacteria | 1710 |
| 506 | Ga0496108_0441944 | 3300048911 | Bacteria | 1136 |
| 507 | Ga0496108_0973434 | 3300048911 | Bacteria | 726 |
| 508 | Ga0496109_0001228 | 3300048912 | Bacteria | 21283 |
| 509 | Ga0496109_0003917 | 3300048912 | Bacteria | 12437 |
| 510 | Ga0496109_0011898 | 3300048912 | Bacteria | 7491 |
| 511 | Ga0496109_0152434 | 3300048912 | Bacteria | 2164 |
| 512 | Ga0496109_0438551 | 3300048912 | Bacteria | 1234 |
| 513 | Ga0496110_0035065 | 3300048913 | Bacteria | 4350 |
| 514 | Ga0496110_0058739 | 3300048913 | Bacteria | 3388 |
| 515 | Ga0496110_0067413 | 3300048913 | Bacteria | 3167 |
| 516 | Ga0496110_0169635 | 3300048913 | Bacteria | 1980 |
| 517 | Ga0496110_0230661 | 3300048913 | Bacteria | 1684 |
| 518 | Ga0496111_0045510 | 3300048914 | Bacteria | 3158 |
| 519 | Ga0496111_0491727 | 3300048914 | Bacteria | 903 |
| 520 | Ga0496112_0001398 | 3300048915 | Bacteria | 18441 |
| 521 | Ga0496112_0012816 | 3300048915 | Bacteria | 7717 |
| 522 | Ga0496112_0016413 | 3300048915 | Bacteria | 6937 |
| 523 | Ga0496112_0018248 | 3300048915 | Bacteria | 6605 |
| 524 | Ga0496112_0054898 | 3300048915 | Bacteria | 3915 |
| 525 | Ga0496112_0363868 | 3300048915 | Bacteria | 1388 |
| 526 | Ga0496112_0595227 | 3300048915 | Bacteria | 1038 |
| 527 | Ga0496113_0018039 | 3300048916 | Bacteria | 4910 |
| 528 | Ga0496113_0040891 | 3300048916 | Bacteria | 3418 |
| 529 | Ga0496113_0083641 | 3300048916 | Bacteria | 2449 |
| 530 | Ga0496114_0000070 | 3300048917 | Bacteria | 73843 |
| 531 | Ga0496114_0001225 | 3300048917 | Bacteria | 19403 |
| 532 | Ga0496114_0020927 | 3300048917 | Bacteria | 5313 |
| 533 | Ga0496114_0159442 | 3300048917 | Bacteria | 1961 |
| 534 | Ga0496115_0010632 | 3300048918 | Bacteria | 6883 |
| 535 | Ga0496115_0016522 | 3300048918 | Bacteria | 5622 |
| 536 | Ga0496115_0174547 | 3300048918 | Bacteria | 1777 |
| 537 | Ga0496115_0176003 | 3300048918 | Bacteria | 1769 |
| 538 | Ga0496116_0000033 | 3300048919 | Bacteria | 418191 |
| 539 | Ga0496116_0022639 | 3300048919 | Bacteria | 4703 |
| 540 | Ga0496116_0250048 | 3300048919 | Bacteria | 883 |
| 541 | Ga0496117_0000025 | 3300048920 | Bacteria | 418106 |
| 542 | Ga0496117_0000190 | 3300048920 | Bacteria | 125026 |
| 543 | Ga0496117_0040290 | 3300048920 | Bacteria | 3436 |
| 544 | Ga0496117_0098238 | 3300048920 | Bacteria | 1862 |
| 545 | Ga0496118_0000023 | 3300048921 | Bacteria | 418106 |
| 546 | Ga0496118_0001595 | 3300048921 | Bacteria | 33571 |
| 547 | Ga0496118_0005068 | 3300048921 | Bacteria | 15168 |
| 548 | Ga0496118_0028003 | 3300048921 | Bacteria | 4756 |
| 549 | Ga0496119_0008733 | 3300048922 | Bacteria | 8841 |
| 550 | Ga0496119_0054476 | 3300048922 | Bacteria | 2434 |
| 551 | Ga0496119_0117736 | 3300048922 | Bacteria | 1464 |
| 552 | Ga0496119_0177848 | 3300048922 | Bacteria | 1118 |
| 553 | Ga0496120_0002095 | 3300048923 | Bacteria | 21379 |
| 554 | Ga0496120_0017876 | 3300048923 | Bacteria | 4582 |
| 555 | Ga0496121_0000016 | 3300048924 | Bacteria | 562911 |
| 556 | Ga0496121_0000039 | 3300048924 | Bacteria | 351444 |
| 557 | Ga0496121_0009738 | 3300048924 | Bacteria | 10992 |
| 558 | Ga0496121_0338008 | 3300048924 | Bacteria | 1007 |
| 559 | Ga0496122_0000470 | 3300048925 | Bacteria | 84015 |
| 560 | Ga0496122_0023716 | 3300048925 | Bacteria | 5394 |
| 561 | Ga0496123_0036255 | 3300048926 | Bacteria | 3500 |
| 562 | Ga0496123_0047376 | 3300048926 | Bacteria | 2905 |
| 563 | Ga0496124_0000015 | 3300048927 | Bacteria | 460700 |
| 564 | Ga0496125_0000021 | 3300048928 | Bacteria | 460688 |
| 565 | Ga0496125_0074773 | 3300048928 | Bacteria | 2625 |
| 566 | Ga0496125_0150313 | 3300048928 | Bacteria | 1601 |
| 567 | Ga0496126_0000015 | 3300048929 | Bacteria | 663212 |
| 568 | Ga0496126_0000405 | 3300048929 | Bacteria | 87676 |
| 569 | Ga0496126_0006611 | 3300048929 | Bacteria | 12907 |
| 570 | Ga0496126_0015890 | 3300048929 | Bacteria | 7557 |
| 571 | Ga0496126_0025402 | 3300048929 | Bacteria | 5699 |
| 572 | Ga0496126_0093220 | 3300048929 | Bacteria | 2644 |
| 573 | Ga0496126_0684288 | 3300048929 | Bacteria | 799 |
| 574 | Ga0501032_0004043 | 3300049569 | Bacteria | 11127 |
| 575 | Ga0501033_0130721 | 3300049570 | Bacteria | 1819 |
| 576 | Ga0501034_0003080 | 3300049571 | Bacteria | 19235 |
| 577 | Ga0501034_0004526 | 3300049571 | Bacteria | 15456 |
| 578 | Ga0501034_0175650 | 3300049571 | Bacteria | 2108 |
| 579 | Ga0501034_0669308 | 3300049571 | Bacteria | 938 |
| 580 | Ga0501036_0030070 | 3300049572 | Bacteria | 4588 |
| 581 | Ga0501036_0180311 | 3300049572 | Bacteria | 1778 |
| 582 | Ga0501037_0000490 | 3300049573 | Bacteria | 32020 |
| 583 | Ga0501037_0007789 | 3300049573 | Bacteria | 7842 |
| 584 | Ga0501038_0021102 | 3300049574 | Bacteria | 5850 |
| 585 | Ga0501039_0000886 | 3300049575 | Bacteria | 21754 |
| 586 | Ga0501043_0007980 | 3300049579 | Bacteria | 8361 |
| 587 | Ga0501043_0020547 | 3300049579 | Bacteria | 5180 |
| 588 | Ga0501046_0000749 | 3300049580 | Bacteria | 31320 |
| 589 | Ga0501047_0002869 | 3300049581 | Bacteria | 16359 |
| 590 | Ga0501047_0262069 | 3300049581 | Bacteria | 1576 |
| 591 | Ga0501047_0343161 | 3300049581 | Bacteria | 1331 |
| 592 | Ga0501048_0007940 | 3300049582 | Bacteria | 8039 |
| 593 | Ga0501067_0437485 | 3300049583 | Bacteria | 730 |
| 594 | Ga0501070_0006186 | 3300049586 | Bacteria | 10199 |
| 595 | Ga0501070_0012312 | 3300049586 | Bacteria | 7218 |
| 596 | Ga0501071_0062549 | 3300049587 | Bacteria | 2697 |
| 597 | Ga0501077_0154731 | 3300049593 | Bacteria | 1455 |
| 598 | Ga0501083_0142994 | 3300049744 | Bacteria | 1566 |
| 599 | Ga0501035_0015364 | 3300049822 | Bacteria | 7065 |
| 600 | Ga0501044_0007663 | 3300049823 | Bacteria | 11872 |
| 601 | Ga0501044_0007872 | 3300049823 | Bacteria | 11717 |
| 602 | nmdc:mga03683_118149_c1 | 3300050489 | Bacteria | 1177 |
| 603 | nmdc:mga03683_127903_c1 | 3300050489 | Bacteria | 1134 |
| 604 | nmdc:mga03683_151651_c1 | 3300050489 | Bacteria | 1046 |
| 605 | nmdc:mga03n38_215951_c1 | 3300050490 | Bacteria | 999 |
| 606 | nmdc:mga03n38_26854_c1 | 3300050490 | Bacteria | 898 |
| 607 | nmdc:mga03n38_37517_c1 | 3300050490 | Bacteria | 2091 |
| 608 | nmdc:mga03n38_86466_c1 | 3300050490 | Bacteria | 1484 |
| 609 | nmdc:mga00v17_142561_c1 | 3300050491 | Bacteria | 1537 |
| 610 | nmdc:mga00v17_143058_c1 | 3300050491 | Bacteria | 1534 |
| 611 | nmdc:mga00v17_226961_c1 | 3300050491 | Bacteria | 1210 |
| 612 | nmdc:mga00v17_426031_c1 | 3300050491 | Bacteria | 862 |
| 613 | nmdc:mga0yw44_249433_c1 | 3300050492 | Bacteria | 1181 |
| 614 | nmdc:mga0yw44_293541_c1 | 3300050492 | Bacteria | 1088 |
| 615 | nmdc:mga0yw44_599022_c1 | 3300050492 | Bacteria | 749 |
| 616 | nmdc:mga0yw44_66800_c1 | 3300050492 | Bacteria | 2220 |
| 617 | nmdc:mga0yw44_67531_c1 | 3300050492 | Bacteria | 1445 |
| 618 | nmdc:mga0yw44_773231_c1 | 3300050492 | Bacteria | 652 |
| 619 | nmdc:mga06z11_56244_c1 | 3300050494 | Bacteria | 2034 |
| 620 | nmdc:mga06z11_74831_c1 | 3300050494 | Bacteria | 1801 |
| 621 | nmdc:mga04h51_128420_c1 | 3300050495 | Bacteria | 951 |
| 622 | nmdc:mga07m45_21630_c1 | 3300050496 | Bacteria | 3504 |
| 623 | nmdc:mga07m45_314352_c1 | 3300050496 | Bacteria | 910 |
| 624 | nmdc:mga07m45_71226_c1 | 3300050496 | Bacteria | 1978 |
| 625 | nmdc:mga07m45_88910_c1 | 3300050496 | Bacteria | 1768 |
| 626 | nmdc:mga0qj67_45064_c1 | 3300050509 | Bacteria | 3479 |
| 627 | nmdc:mga06r32_19200_c1 | 3300050510 | Bacteria | 6273 |
| 628 | nmdc:mga08y16_960557_c1 | 3300050511 | Bacteria | 837 |
| 629 | nmdc:mga0sz30_17456_c2 | 3300050516 | Bacteria | 2332 |
| 630 | nmdc:mga0sz30_2497_c1 | 3300050516 | Bacteria | 6557 |
| 631 | nmdc:mga0sz30_32132_c2 | 3300050516 | Bacteria | 1874 |
| 632 | Ga0500610_0177427 | 3300053079 | Bacteria | 1046 |
| 633 | Ga0500635_0000964 | 3300053080 | Bacteria | 6924 |
| 634 | Ga0500643_008359 | 3300053087 | Bacteria | 4070 |
| 635 | Ga0500646_0039660 | 3300053090 | Bacteria | 1322 |
| 636 | Ga0500641_0083516 | 3300053096 | Bacteria | 1358 |
| 637 | Ga0500556_0123557 | 3300053104 | Bacteria | 1011 |
| 638 | Ga0500562_007263 | 3300053108 | Bacteria | 2797 |
| 639 | Ga0500652_014835 | 3300053131 | Bacteria | 2797 |
| 640 | Ga0500561_0035811 | 3300053137 | Bacteria | 1283 |
| 641 | Ga0500616_0107584 | 3300053153 | Bacteria | 1352 |
| 642 | Ga0500616_0157063 | 3300053153 | Bacteria | 1046 |
| 643 | Ga0500645_000054 | 3300053730 | Bacteria | 93914 |
| 644 | Ga0500645_005840 | 3300053730 | Bacteria | 4472 |
| 645 | Ga0466962_0058432 | 3300061719 | Bacteria | 1841 |
| 646 | Ga0466962_0058458 | 3300061719 | Bacteria | 1840 |
| 647 | Ga0466962_0206675 | 3300061719 | Bacteria | 960 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005344 | Ga0070661_100957183 | Ga0070661_1009571831 | 188 |
| 2 | 3300005578 | Ga0068854_100497279 | Ga0068854_1004972792 | 188 |
| 3 | 3300005618 | Ga0068864_101429512 | Ga0068864_1014295121 | 188 |
| 4 | 3300005834 | Ga0068851_10130214 | Ga0068851_101302141 | 188 |
| 5 | 3300014745 | Ga0157377_10248067 | Ga0157377_102480672 | 188 |
| 6 | 3300025981 | Ga0207640_10209008 | Ga0207640_102090082 | 188 |
| 7 | 3300026095 | Ga0207676_10916504 | Ga0207676_109165042 | 188 |
| 8 | 3300048913 | Ga0496110_0058739 | Ga0496110_0058739_1610_2236 | 188 |
| 9 | 3300048916 | Ga0496113_0018039 | Ga0496113_0018039_3099_3725 | 188 |
| 10 | 3300005329 | Ga0070683_100364963 | Ga0070683_1003649632 | 189 |
| 11 | 3300006048 | Ga0075363_100040520 | Ga0075363_1000405203 | 189 |
| 12 | 3300025944 | Ga0207661_10112191 | Ga0207661_101121913 | 189 |
| 13 | 3300048911 | Ga0496108_0031378 | Ga0496108_0031378_2014_2640 | 189 |
| 14 | 3300048912 | Ga0496109_0011898 | Ga0496109_0011898_5327_5953 | 189 |
| 15 | 3300048915 | Ga0496112_0018248 | Ga0496112_0018248_5772_6398 | 189 |
| 16 | 3300050490 | nmdc:mga03n38_215951_c1 | nmdc:mga03n38_215951_c1_200_826 | 189 |
| 17 | 3300044694 | Ga0466963_0143369 | Ga0466963_0143369_26_646 | 191 |
| 18 | 3300044735 | Ga0466968_0035172 | Ga0466968_0035172_124_744 | 191 |
| 19 | 3300044842 | Ga0466957_0110072 | Ga0466957_0110072_1098_1718 | 191 |
| 20 | 3300045049 | Ga0466959_0162869 | Ga0466959_0162869_22_642 | 191 |
| 21 | 3300006353 | Ga0075370_10065067 | Ga0075370_100650672 | 195 |
| 22 | 3300006038 | Ga0075365_10069277 | Ga0075365_100692773 | 201 |
| 23 | 3300006048 | Ga0075363_100180696 | Ga0075363_1001806962 | 201 |
| 24 | 3300006051 | Ga0075364_10001027 | Ga0075364_100010278 | 201 |
| 25 | 3300006186 | Ga0075369_10056795 | Ga0075369_100567952 | 201 |
| 26 | 3300006353 | Ga0075370_10022798 | Ga0075370_100227985 | 201 |
| 27 | 3300050490 | nmdc:mga03n38_86466_c1 | nmdc:mga03n38_86466_c1_430_1056 | 201 |
| 28 | 3300050491 | nmdc:mga00v17_226961_c1 | nmdc:mga00v17_226961_c1_265_891 | 201 |
| 29 | 3300050492 | nmdc:mga0yw44_293541_c1 | nmdc:mga0yw44_293541_c1_431_1057 | 201 |
| 30 | 3300050496 | nmdc:mga07m45_71226_c1 | nmdc:mga07m45_71226_c1_1287_1913 | 201 |
| 31 | iso_pu_bacteria | 2643221687 | 2644488722 | 204 |
| 32 | iso_pu_bacteria | 2643221715 | 2644633879 | 204 |
| 33 | iso_pu_bacteria | 2738541264 | 2738665157 | 204 |
| 34 | iso_pu_bacteria | 2738541274 | 2738704057 | 204 |
| 35 | iso_pu_bacteria | 2738541308 | 2738890309 | 204 |
| 36 | iso_pu_bacteria | 2738541356 | 2739144291 | 204 |
| 37 | iso_pu_bacteria | 2738543005 | 2739205016 | 204 |
| 38 | iso_pu_bacteria | 2738543028 | 2739334430 | 204 |
| 39 | iso_pu_bacteria | 2738543034 | 2739361751 | 204 |
| 40 | iso_pu_bacteria | 2842134933 | 2842137926 | 204 |
| 41 | iso_pu_bacteria | 2902792274 | 2902797685 | 204 |
| 42 | iso_pu_bacteria | 2902799365 | 2902800963 | 204 |
| 43 | iso_pu_bacteria | 2902810491 | 2902810796 | 204 |
| 44 | iso_pu_bacteria | 2902837492 | 2902838607 | 204 |
| 45 | iso_pu_bacteria | 2904765812 | 2904770881 | 204 |
| 46 | iso_pu_bacteria | 2904770941 | 2904771478 | 204 |
| 47 | iso_pu_bacteria | 2908811453 | 2908816289 | 204 |
| 48 | iso_pu_bacteria | 2919420072 | 2919423027 | 204 |
| 49 | iso_pu_bacteria | 2919432681 | 2919435635 | 204 |
| 50 | iso_pu_bacteria | 2929212328 | 2929216149 | 204 |
| 51 | iso_pu_bacteria | 2939582691 | 2939588242 | 204 |
| 52 | iso_pu_bacteria | 2974315732 | 2974317668 | 204 |
| 53 | iso_pu_bacteria | 2984523437 | 2984525879 | 204 |
| 54 | 3300005842 | Ga0068858_100716181 | Ga0068858_1007161812 | 205 |
| 55 | 3300025921 | Ga0207652_10226824 | Ga0207652_102268242 | 205 |
| 56 | 3300025928 | Ga0207700_10252700 | Ga0207700_102527002 | 205 |
| 57 | 3300028379 | Ga0268266_11150424 | Ga0268266_111504241 | 205 |
| 58 | 3300036459 | Ga0372808_000543 | Ga0372808_000543_1975_2601 | 205 |
| 59 | 3300037466 | Ga0395898_0463178 | Ga0395898_0463178_342_968 | 205 |
| 60 | 3300044842 | Ga0466957_0029594 | Ga0466957_0029594_2128_2748 | 205 |
| 61 | 3300045976 | Ga0466967_0005423 | Ga0466967_0005423_345_965 | 205 |
| 62 | 3300061719 | Ga0466962_0058432 | Ga0466962_0058432_497_1117 | 205 |
| 63 | 3300021384 | Ga0213876_10015785 | Ga0213876_100157852 | 206 |
| 64 | 3300021384 | Ga0213876_10059955 | Ga0213876_100599552 | 206 |
| 65 | 3300021388 | Ga0213875_10004015 | Ga0213875_1000401510 | 206 |
| 66 | 3300028800 | Ga0265338_10031399 | Ga0265338_100313993 | 206 |
| 67 | 3300030731 | Ga0316177_1030021 | Ga0316177_10300211 | 206 |
| 68 | 3300030732 | Ga0316176_1108788 | Ga0316176_11087881 | 206 |
| 69 | 3300030733 | Ga0314311_1004140 | Ga0314311_10041404 | 206 |
| 70 | 3300030736 | Ga0316180_1058331 | Ga0316180_10583312 | 206 |
| 71 | 3300037853 | Ga0436364_0185516 | Ga0436364_0185516_7393_8013 | 206 |
| 72 | 3300039437 | Ga0436365_1329591 | Ga0436365_1329591_3283_3903 | 206 |
| 73 | 3300039437 | Ga0436365_1931466 | Ga0436365_1931466_1908_2528 | 206 |
| 74 | 3300044658 | Ga0466972_0031037 | Ga0466972_0031037_1894_2514 | 206 |
| 75 | 3300044683 | Ga0466965_0020025 | Ga0466965_0020025_134_754 | 206 |
| 76 | 3300045836 | Ga0466958_0001122 | Ga0466958_0001122_9343_9963 | 206 |
| 77 | 3300021384 | Ga0213876_10210755 | Ga0213876_102107552 | 207 |
| 78 | 3300061719 | Ga0466962_0206675 | Ga0466962_0206675_208_831 | 207 |
| 79 | 3300001989 | JGI24739J22299_10130990 | JGI24739J22299_101309901 | 208 |
| 80 | 3300002077 | JGI24744J21845_10000510 | JGI24744J21845_100005103 | 208 |
| 81 | 3300003792 | Ga0055540_1000003 | Ga0055540_1000003419 | 208 |
| 82 | 3300003792 | Ga0055540_1000883 | Ga0055540_10008839 | 208 |
| 83 | 3300003792 | Ga0055540_1014578 | Ga0055540_10145782 | 208 |
| 84 | 3300005328 | Ga0070676_10008262 | Ga0070676_100082627 | 208 |
| 85 | 3300005329 | Ga0070683_100231016 | Ga0070683_1002310162 | 208 |
| 86 | 3300005330 | Ga0070690_100035522 | Ga0070690_1000355222 | 208 |
| 87 | 3300005335 | Ga0070666_10085278 | Ga0070666_100852782 | 208 |
| 88 | 3300005335 | Ga0070666_10163932 | Ga0070666_101639322 | 208 |
| 89 | 3300005336 | Ga0070680_100226992 | Ga0070680_1002269922 | 208 |
| 90 | 3300005337 | Ga0070682_100020291 | Ga0070682_1000202912 | 208 |
| 91 | 3300005337 | Ga0070682_100437656 | Ga0070682_1004376562 | 208 |
| 92 | 3300005338 | Ga0068868_100000368 | Ga0068868_10000036812 | 208 |
| 93 | 3300005339 | Ga0070660_100078661 | Ga0070660_1000786612 | 208 |
| 94 | 3300005340 | Ga0070689_100007743 | Ga0070689_1000077434 | 208 |
| 95 | 3300005341 | Ga0070691_10000295 | Ga0070691_100002954 | 208 |
| 96 | 3300005343 | Ga0070687_100142883 | Ga0070687_1001428832 | 208 |
| 97 | 3300005345 | Ga0070692_10096628 | Ga0070692_100966282 | 208 |
| 98 | 3300005347 | Ga0070668_100000317 | Ga0070668_1000003173 | 208 |
| 99 | 3300005347 | Ga0070668_100007746 | Ga0070668_1000077466 | 208 |
| 100 | 3300005347 | Ga0070668_100064891 | Ga0070668_1000648912 | 208 |
| 101 | 3300005353 | Ga0070669_100000608 | Ga0070669_10000060812 | 208 |
| 102 | 3300005353 | Ga0070669_100001421 | Ga0070669_1000014214 | 208 |
| 103 | 3300005355 | Ga0070671_100000885 | Ga0070671_10000088514 | 208 |
| 104 | 3300005355 | Ga0070671_100112141 | Ga0070671_1001121412 | 208 |
| 105 | 3300005356 | Ga0070674_100000546 | Ga0070674_1000005462 | 208 |
| 106 | 3300005356 | Ga0070674_100889148 | Ga0070674_1008891481 | 208 |
| 107 | 3300005366 | Ga0070659_100014528 | Ga0070659_1000145282 | 208 |
| 108 | 3300005367 | Ga0070667_100000449 | Ga0070667_10000044918 | 208 |
| 109 | 3300005367 | Ga0070667_100001275 | Ga0070667_10000127519 | 208 |
| 110 | 3300005367 | Ga0070667_100001922 | Ga0070667_10000192210 | 208 |
| 111 | 3300005367 | Ga0070667_100010892 | Ga0070667_1000108922 | 208 |
| 112 | 3300005367 | Ga0070667_100045599 | Ga0070667_1000455992 | 208 |
| 113 | 3300005367 | Ga0070667_100062358 | Ga0070667_1000623583 | 208 |
| 114 | 3300005434 | Ga0070709_10043149 | Ga0070709_100431492 | 208 |
| 115 | 3300005435 | Ga0070714_100343671 | Ga0070714_1003436711 | 208 |
| 116 | 3300005437 | Ga0070710_10001273 | Ga0070710_100012737 | 208 |
| 117 | 3300005438 | Ga0070701_10000553 | Ga0070701_100005535 | 208 |
| 118 | 3300005439 | Ga0070711_100000373 | Ga0070711_1000003735 | 208 |
| 119 | 3300005440 | Ga0070705_100013036 | Ga0070705_1000130362 | 208 |
| 120 | 3300005440 | Ga0070705_100254699 | Ga0070705_1002546992 | 208 |
| 121 | 3300005441 | Ga0070700_100001198 | Ga0070700_1000011989 | 208 |
| 122 | 3300005444 | Ga0070694_100405688 | Ga0070694_1004056881 | 208 |
| 123 | 3300005445 | Ga0070708_101074948 | Ga0070708_1010749481 | 208 |
| 124 | 3300005455 | Ga0070663_100035641 | Ga0070663_1000356413 | 208 |
| 125 | 3300005455 | Ga0070663_100409456 | Ga0070663_1004094562 | 208 |
| 126 | 3300005456 | Ga0070678_100000037 | Ga0070678_10000003717 | 208 |
| 127 | 3300005456 | Ga0070678_100528260 | Ga0070678_1005282602 | 208 |
| 128 | 3300005457 | Ga0070662_100007600 | Ga0070662_1000076005 | 208 |
| 129 | 3300005459 | Ga0068867_100000663 | Ga0068867_10000066310 | 208 |
| 130 | 3300005466 | Ga0070685_10020288 | Ga0070685_100202882 | 208 |
| 131 | 3300005536 | Ga0070697_100182750 | Ga0070697_1001827502 | 208 |
| 132 | 3300005539 | Ga0068853_100001014 | Ga0068853_10000101412 | 208 |
| 133 | 3300005539 | Ga0068853_100012220 | Ga0068853_1000122206 | 208 |
| 134 | 3300005544 | Ga0070686_100023920 | Ga0070686_1000239205 | 208 |
| 135 | 3300005544 | Ga0070686_100039417 | Ga0070686_1000394172 | 208 |
| 136 | 3300005545 | Ga0070695_100002297 | Ga0070695_1000022978 | 208 |
| 137 | 3300005546 | Ga0070696_100002252 | Ga0070696_1000022523 | 208 |
| 138 | 3300005548 | Ga0070665_100002725 | Ga0070665_10000272513 | 208 |
| 139 | 3300005548 | Ga0070665_100009036 | Ga0070665_1000090363 | 208 |
| 140 | 3300005548 | Ga0070665_100335011 | Ga0070665_1003350112 | 208 |
| 141 | 3300005549 | Ga0070704_100000167 | Ga0070704_10000016719 | 208 |
| 142 | 3300005578 | Ga0068854_100000837 | Ga0068854_10000083711 | 208 |
| 143 | 3300005615 | Ga0070702_100000221 | Ga0070702_1000002213 | 208 |
| 144 | 3300005616 | Ga0068852_100097272 | Ga0068852_1000972722 | 208 |
| 145 | 3300005617 | Ga0068859_100000115 | Ga0068859_1000001156 | 208 |
| 146 | 3300005617 | Ga0068859_100003512 | Ga0068859_10000351214 | 208 |
| 147 | 3300005618 | Ga0068864_100281608 | Ga0068864_1002816082 | 208 |
| 148 | 3300005618 | Ga0068864_100860380 | Ga0068864_1008603802 | 208 |
| 149 | 3300005718 | Ga0068866_10000433 | Ga0068866_100004336 | 208 |
| 150 | 3300005719 | Ga0068861_100000054 | Ga0068861_10000005422 | 208 |
| 151 | 3300005841 | Ga0068863_100001736 | Ga0068863_1000017362 | 208 |
| 152 | 3300005841 | Ga0068863_100004141 | Ga0068863_1000041416 | 208 |
| 153 | 3300005841 | Ga0068863_100170764 | Ga0068863_1001707642 | 208 |
| 154 | 3300005842 | Ga0068858_100000611 | Ga0068858_10000061129 | 208 |
| 155 | 3300005842 | Ga0068858_100009518 | Ga0068858_1000095182 | 208 |
| 156 | 3300005842 | Ga0068858_100298082 | Ga0068858_1002980822 | 208 |
| 157 | 3300005843 | Ga0068860_100000044 | Ga0068860_10000004492 | 208 |
| 158 | 3300005843 | Ga0068860_100000518 | Ga0068860_10000051829 | 208 |
| 159 | 3300005843 | Ga0068860_100643541 | Ga0068860_1006435412 | 208 |
| 160 | 3300005844 | Ga0068862_100000003 | Ga0068862_100000003140 | 208 |
| 161 | 3300005844 | Ga0068862_100001262 | Ga0068862_10000126218 | 208 |
| 162 | 3300005844 | Ga0068862_100369474 | Ga0068862_1003694742 | 208 |
| 163 | 3300005937 | Ga0081455_10034334 | Ga0081455_100343345 | 208 |
| 164 | 3300005937 | Ga0081455_10240099 | Ga0081455_102400992 | 208 |
| 165 | 3300006038 | Ga0075365_10074156 | Ga0075365_100741562 | 208 |
| 166 | 3300006038 | Ga0075365_10083796 | Ga0075365_100837962 | 208 |
| 167 | 3300006038 | Ga0075365_10188425 | Ga0075365_101884252 | 208 |
| 168 | 3300006038 | Ga0075365_10204154 | Ga0075365_102041542 | 208 |
| 169 | 3300006042 | Ga0075368_10004196 | Ga0075368_100041964 | 208 |
| 170 | 3300006048 | Ga0075363_100036625 | Ga0075363_1000366252 | 208 |
| 171 | 3300006048 | Ga0075363_100411439 | Ga0075363_1004114391 | 208 |
| 172 | 3300006051 | Ga0075364_10006525 | Ga0075364_100065254 | 208 |
| 173 | 3300006051 | Ga0075364_10044590 | Ga0075364_100445902 | 208 |
| 174 | 3300006051 | Ga0075364_10128886 | Ga0075364_101288862 | 208 |
| 175 | 3300006163 | Ga0070715_10000541 | Ga0070715_100005413 | 208 |
| 176 | 3300006173 | Ga0070716_100020070 | Ga0070716_1000200703 | 208 |
| 177 | 3300006175 | Ga0070712_100000149 | Ga0070712_10000014930 | 208 |
| 178 | 3300006177 | Ga0075362_10015408 | Ga0075362_100154082 | 208 |
| 179 | 3300006177 | Ga0075362_10034265 | Ga0075362_100342652 | 208 |
| 180 | 3300006177 | Ga0075362_10154610 | Ga0075362_101546102 | 208 |
| 181 | 3300006178 | Ga0075367_10000319 | Ga0075367_100003196 | 208 |
| 182 | 3300006178 | Ga0075367_10364296 | Ga0075367_103642962 | 208 |
| 183 | 3300006186 | Ga0075369_10001372 | Ga0075369_100013726 | 208 |
| 184 | 3300006186 | Ga0075369_10305168 | Ga0075369_103051681 | 208 |
| 185 | 3300006186 | Ga0075369_10312452 | Ga0075369_103124521 | 208 |
| 186 | 3300006195 | Ga0075366_10072722 | Ga0075366_100727222 | 208 |
| 187 | 3300006353 | Ga0075370_10047521 | Ga0075370_100475211 | 208 |
| 188 | 3300006358 | Ga0068871_100026059 | Ga0068871_1000260592 | 208 |
| 189 | 3300006844 | Ga0075428_100014509 | Ga0075428_1000145093 | 208 |
| 190 | 3300006846 | Ga0075430_100936032 | Ga0075430_1009360321 | 208 |
| 191 | 3300006847 | Ga0075431_100024577 | Ga0075431_1000245775 | 208 |
| 192 | 3300006881 | Ga0068865_100000280 | Ga0068865_10000028020 | 208 |
| 193 | 3300006931 | Ga0097620_100000115 | Ga0097620_1000001156 | 208 |
| 194 | 3300006931 | Ga0097620_100003512 | Ga0097620_1000035122 | 208 |
| 195 | 3300009094 | Ga0111539_10098088 | Ga0111539_100980883 | 208 |
| 196 | 3300009098 | Ga0105245_10000377 | Ga0105245_1000037737 | 208 |
| 197 | 3300009101 | Ga0105247_10000006 | Ga0105247_10000006181 | 208 |
| 198 | 3300009101 | Ga0105247_10001325 | Ga0105247_1000132514 | 208 |
| 199 | 3300009101 | Ga0105247_10088990 | Ga0105247_100889902 | 208 |
| 200 | 3300009147 | Ga0114129_10015258 | Ga0114129_100152583 | 208 |
| 201 | 3300009148 | Ga0105243_10000755 | Ga0105243_1000075529 | 208 |
| 202 | 3300009148 | Ga0105243_10500414 | Ga0105243_105004142 | 208 |
| 203 | 3300009176 | Ga0105242_10000366 | Ga0105242_1000036611 | 208 |
| 204 | 3300009176 | Ga0105242_11353990 | Ga0105242_113539901 | 208 |
| 205 | 3300009177 | Ga0105248_10000062 | Ga0105248_1000006289 | 208 |
| 206 | 3300009177 | Ga0105248_10005684 | Ga0105248_100056846 | 208 |
| 207 | 3300009177 | Ga0105248_10064178 | Ga0105248_100641782 | 208 |
| 208 | 3300009177 | Ga0105248_10414615 | Ga0105248_104146152 | 208 |
| 209 | 3300009545 | Ga0105237_10004702 | Ga0105237_100047026 | 208 |
| 210 | 3300009545 | Ga0105237_10037459 | Ga0105237_100374592 | 208 |
| 211 | 3300009551 | Ga0105238_10180343 | Ga0105238_101803432 | 208 |
| 212 | 3300009553 | Ga0105249_10000008 | Ga0105249_10000008232 | 208 |
| 213 | 3300009553 | Ga0105249_10000641 | Ga0105249_1000064127 | 208 |
| 214 | 3300009553 | Ga0105249_10002622 | Ga0105249_100026227 | 208 |
| 215 | 3300010375 | Ga0105239_10005099 | Ga0105239_100050999 | 208 |
| 216 | 3300010375 | Ga0105239_10009692 | Ga0105239_100096922 | 208 |
| 217 | 3300010375 | Ga0105239_11186457 | Ga0105239_111864572 | 208 |
| 218 | 3300013296 | Ga0157374_10024956 | Ga0157374_100249562 | 208 |
| 219 | 3300013297 | Ga0157378_10001832 | Ga0157378_100018323 | 208 |
| 220 | 3300013306 | Ga0163162_10002253 | Ga0163162_100022537 | 208 |
| 221 | 3300013306 | Ga0163162_10719411 | Ga0163162_107194112 | 208 |
| 222 | 3300013307 | Ga0157372_10038543 | Ga0157372_100385433 | 208 |
| 223 | 3300013308 | Ga0157375_10002135 | Ga0157375_100021356 | 208 |
| 224 | 3300013308 | Ga0157375_10133375 | Ga0157375_101333752 | 208 |
| 225 | 3300014325 | Ga0163163_10162152 | Ga0163163_101621522 | 208 |
| 226 | 3300014325 | Ga0163163_10854240 | Ga0163163_108542402 | 208 |
| 227 | 3300014325 | Ga0163163_10941852 | Ga0163163_109418522 | 208 |
| 228 | 3300014326 | Ga0157380_10000116 | Ga0157380_1000011614 | 208 |
| 229 | 3300014497 | Ga0182008_10238479 | Ga0182008_102384792 | 208 |
| 230 | 3300014968 | Ga0157379_10003618 | Ga0157379_100036185 | 208 |
| 231 | 3300014968 | Ga0157379_10633006 | Ga0157379_106330062 | 208 |
| 232 | 3300014969 | Ga0157376_11021086 | Ga0157376_110210862 | 208 |
| 233 | 3300017792 | Ga0163161_10001682 | Ga0163161_100016825 | 208 |
| 234 | 3300021384 | Ga0213876_10005413 | Ga0213876_100054131 | 208 |
| 235 | 3300021384 | Ga0213876_10015815 | Ga0213876_100158152 | 208 |
| 236 | 3300021384 | Ga0213876_10297751 | Ga0213876_102977512 | 208 |
| 237 | 3300021388 | Ga0213875_10037620 | Ga0213875_100376202 | 208 |
| 238 | 3300025273 | Ga0209673_1031988 | Ga0209673_10319882 | 208 |
| 239 | 3300025273 | Ga0209673_1061471 | Ga0209673_10614712 | 208 |
| 240 | 3300025303 | Ga0209051_1000011 | Ga0209051_1000011177 | 208 |
| 241 | 3300025303 | Ga0209051_1001162 | Ga0209051_10011625 | 208 |
| 242 | 3300025303 | Ga0209051_1001628 | Ga0209051_10016285 | 208 |
| 243 | 3300025898 | Ga0207692_10003227 | Ga0207692_100032275 | 208 |
| 244 | 3300025899 | Ga0207642_10000079 | Ga0207642_100000799 | 208 |
| 245 | 3300025900 | Ga0207710_10000025 | Ga0207710_10000025106 | 208 |
| 246 | 3300025900 | Ga0207710_10002391 | Ga0207710_100023917 | 208 |
| 247 | 3300025901 | Ga0207688_10001038 | Ga0207688_100010387 | 208 |
| 248 | 3300025905 | Ga0207685_10005401 | Ga0207685_100054012 | 208 |
| 249 | 3300025906 | Ga0207699_10017065 | Ga0207699_100170652 | 208 |
| 250 | 3300025907 | Ga0207645_10011399 | Ga0207645_100113996 | 208 |
| 251 | 3300025914 | Ga0207671_10014029 | Ga0207671_100140296 | 208 |
| 252 | 3300025914 | Ga0207671_10147538 | Ga0207671_101475382 | 208 |
| 253 | 3300025915 | Ga0207693_10002006 | Ga0207693_1000200612 | 208 |
| 254 | 3300025916 | Ga0207663_10000753 | Ga0207663_100007538 | 208 |
| 255 | 3300025919 | Ga0207657_10419673 | Ga0207657_104196732 | 208 |
| 256 | 3300025923 | Ga0207681_10004038 | Ga0207681_100040383 | 208 |
| 257 | 3300025923 | Ga0207681_10019492 | Ga0207681_100194922 | 208 |
| 258 | 3300025924 | Ga0207694_10101320 | Ga0207694_101013202 | 208 |
| 259 | 3300025927 | Ga0207687_10011682 | Ga0207687_100116825 | 208 |
| 260 | 3300025929 | Ga0207664_10464633 | Ga0207664_104646332 | 208 |
| 261 | 3300025931 | Ga0207644_10015232 | Ga0207644_100152321 | 208 |
| 262 | 3300025931 | Ga0207644_10078781 | Ga0207644_100787812 | 208 |
| 263 | 3300025931 | Ga0207644_10160271 | Ga0207644_101602712 | 208 |
| 264 | 3300025932 | Ga0207690_10004486 | Ga0207690_100044862 | 208 |
| 265 | 3300025933 | Ga0207706_10002057 | Ga0207706_100020578 | 208 |
| 266 | 3300025934 | Ga0207686_10012506 | Ga0207686_100125065 | 208 |
| 267 | 3300025934 | Ga0207686_10556506 | Ga0207686_105565062 | 208 |
| 268 | 3300025935 | Ga0207709_10001983 | Ga0207709_1000198310 | 208 |
| 269 | 3300025936 | Ga0207670_10023492 | Ga0207670_100234922 | 208 |
| 270 | 3300025937 | Ga0207669_10000369 | Ga0207669_1000036919 | 208 |
| 271 | 3300025938 | Ga0207704_10000212 | Ga0207704_1000021228 | 208 |
| 272 | 3300025939 | Ga0207665_10016697 | Ga0207665_100166975 | 208 |
| 273 | 3300025941 | Ga0207711_10000358 | Ga0207711_1000035824 | 208 |
| 274 | 3300025941 | Ga0207711_10041132 | Ga0207711_100411322 | 208 |
| 275 | 3300025941 | Ga0207711_10176485 | Ga0207711_101764852 | 208 |
| 276 | 3300025944 | Ga0207661_10192211 | Ga0207661_101922111 | 208 |
| 277 | 3300025961 | Ga0207712_10000011 | Ga0207712_1000001189 | 208 |
| 278 | 3300025961 | Ga0207712_10004542 | Ga0207712_100045428 | 208 |
| 279 | 3300025972 | Ga0207668_10001402 | Ga0207668_1000140212 | 208 |
| 280 | 3300025972 | Ga0207668_10004333 | Ga0207668_100043339 | 208 |
| 281 | 3300025972 | Ga0207668_10438541 | Ga0207668_104385412 | 208 |
| 282 | 3300025981 | Ga0207640_10011223 | Ga0207640_100112235 | 208 |
| 283 | 3300025986 | Ga0207658_10000387 | Ga0207658_1000038718 | 208 |
| 284 | 3300025986 | Ga0207658_10001930 | Ga0207658_1000193011 | 208 |
| 285 | 3300025986 | Ga0207658_10011470 | Ga0207658_100114707 | 208 |
| 286 | 3300025986 | Ga0207658_10041021 | Ga0207658_100410212 | 208 |
| 287 | 3300025986 | Ga0207658_10050680 | Ga0207658_100506803 | 208 |
| 288 | 3300025986 | Ga0207658_10104058 | Ga0207658_101040582 | 208 |
| 289 | 3300026023 | Ga0207677_10009463 | Ga0207677_100094635 | 208 |
| 290 | 3300026035 | Ga0207703_10007381 | Ga0207703_100073812 | 208 |
| 291 | 3300026035 | Ga0207703_10217904 | Ga0207703_102179042 | 208 |
| 292 | 3300026035 | Ga0207703_10717427 | Ga0207703_107174272 | 208 |
| 293 | 3300026041 | Ga0207639_10004955 | Ga0207639_100049553 | 208 |
| 294 | 3300026041 | Ga0207639_10012602 | Ga0207639_100126026 | 208 |
| 295 | 3300026067 | Ga0207678_10037419 | Ga0207678_100374192 | 208 |
| 296 | 3300026067 | Ga0207678_10231975 | Ga0207678_102319752 | 208 |
| 297 | 3300026067 | Ga0207678_10271153 | Ga0207678_102711532 | 208 |
| 298 | 3300026075 | Ga0207708_10002240 | Ga0207708_1000224015 | 208 |
| 299 | 3300026078 | Ga0207702_10517303 | Ga0207702_105173032 | 208 |
| 300 | 3300026088 | Ga0207641_10000450 | Ga0207641_100004505 | 208 |
| 301 | 3300026088 | Ga0207641_10011586 | Ga0207641_100115862 | 208 |
| 302 | 3300026088 | Ga0207641_10546189 | Ga0207641_105461892 | 208 |
| 303 | 3300026089 | Ga0207648_10000231 | Ga0207648_1000023164 | 208 |
| 304 | 3300026095 | Ga0207676_10623168 | Ga0207676_106231682 | 208 |
| 305 | 3300026118 | Ga0207675_100000398 | Ga0207675_1000003989 | 208 |
| 306 | 3300026118 | Ga0207675_100392835 | Ga0207675_1003928352 | 208 |
| 307 | 3300026121 | Ga0207683_10000128 | Ga0207683_1000012838 | 208 |
| 308 | 3300026142 | Ga0207698_10060585 | Ga0207698_100605852 | 208 |
| 309 | 3300028379 | Ga0268266_10005109 | Ga0268266_1000510910 | 208 |
| 310 | 3300028379 | Ga0268266_10005399 | Ga0268266_100053996 | 208 |
| 311 | 3300028380 | Ga0268265_10000010 | Ga0268265_10000010140 | 208 |
| 312 | 3300028380 | Ga0268265_10051370 | Ga0268265_100513703 | 208 |
| 313 | 3300028381 | Ga0268264_10000007 | Ga0268264_10000007673 | 208 |
| 314 | 3300028381 | Ga0268264_10001462 | Ga0268264_1000146210 | 208 |
| 315 | 3300028381 | Ga0268264_10457573 | Ga0268264_104575732 | 208 |
| 316 | 3300031251 | Ga0265327_10000825 | Ga0265327_1000082511 | 208 |
| 317 | 3300031251 | Ga0265327_10001171 | Ga0265327_100011716 | 208 |
| 318 | 3300031251 | Ga0265327_10028441 | Ga0265327_100284412 | 208 |
| 319 | 3300031251 | Ga0265327_10043730 | Ga0265327_100437302 | 208 |
| 320 | 3300031548 | Ga0307408_100838391 | Ga0307408_1008383912 | 208 |
| 321 | 3300031728 | Ga0316578_10014326 | Ga0316578_100143263 | 208 |
| 322 | 3300031824 | Ga0307413_10161914 | Ga0307413_101619142 | 208 |
| 323 | 3300031901 | Ga0307406_10379966 | Ga0307406_103799661 | 208 |
| 324 | 3300031901 | Ga0307406_10763107 | Ga0307406_107631072 | 208 |
| 325 | 3300031903 | Ga0307407_10156312 | Ga0307407_101563122 | 208 |
| 326 | 3300031911 | Ga0307412_10414974 | Ga0307412_104149742 | 208 |
| 327 | 3300031911 | Ga0307412_11227716 | Ga0307412_112277161 | 208 |
| 328 | 3300031995 | Ga0307409_100109405 | Ga0307409_1001094052 | 208 |
| 329 | 3300032002 | Ga0307416_100076630 | Ga0307416_1000766302 | 208 |
| 330 | 3300032002 | Ga0307416_101310867 | Ga0307416_1013108672 | 208 |
| 331 | 3300032004 | Ga0307414_10839778 | Ga0307414_108397781 | 208 |
| 332 | 3300032126 | Ga0307415_100633615 | Ga0307415_1006336151 | 208 |
| 333 | 3300034817 | Ga0373948_0018989 | Ga0373948_0018989_397_1023 | 208 |
| 334 | 3300035092 | Ga0373952_0016452 | Ga0373952_0016452_530_1156 | 208 |
| 335 | 3300035725 | Ga0373947_0059509 | Ga0373947_0059509_807_1433 | 208 |
| 336 | 3300036712 | Ga0316584_0149949 | Ga0316584_0149949_516_1142 | 208 |
| 337 | 3300037853 | Ga0436364_0793855 | Ga0436364_0793855_379_1005 | 208 |
| 338 | 3300039437 | Ga0436365_0434410 | Ga0436365_0434410_8338_8964 | 208 |
| 339 | 3300039437 | Ga0436365_0674802 | Ga0436365_0674802_7912_8538 | 208 |
| 340 | 3300039437 | Ga0436365_0708236 | Ga0436365_0708236_2426_3052 | 208 |
| 341 | 3300039450 | Ga0436363_1277218 | Ga0436363_1277218_56_682 | 208 |
| 342 | 3300039450 | Ga0436363_1338388 | Ga0436363_1338388_7229_7855 | 208 |
| 343 | 3300041410 | Ga0439461_0002376 | Ga0439461_0002376_126_752 | 208 |
| 344 | 3300041411 | Ga0439466_0003950 | Ga0439466_0003950_1349_1975 | 208 |
| 345 | 3300041411 | Ga0439466_0016027 | Ga0439466_0016027_53_679 | 208 |
| 346 | 3300041411 | Ga0439466_0021631 | Ga0439466_0021631_1348_1974 | 208 |
| 347 | 3300041411 | Ga0439466_0061425 | Ga0439466_0061425_547_1173 | 208 |
| 348 | 3300041413 | Ga0439465_0000487 | Ga0439465_0000487_10344_10970 | 208 |
| 349 | 3300041413 | Ga0439465_0001464 | Ga0439465_0001464_6568_7194 | 208 |
| 350 | 3300041413 | Ga0439465_0027949 | Ga0439465_0027949_53_679 | 208 |
| 351 | 3300041451 | Ga0451791_1249914 | Ga0451791_1249914_326_952 | 208 |
| 352 | 3300041997 | Ga0439431_0003360 | Ga0439431_0003360_912_1538 | 208 |
| 353 | 3300042002 | Ga0439442_022750 | Ga0439442_022750_363_989 | 208 |
| 354 | 3300042004 | Ga0439445_0001092 | Ga0439445_0001092_2524_3150 | 208 |
| 355 | 3300042435 | Ga0439434_0007297 | Ga0439434_0007297_1765_2391 | 208 |
| 356 | 3300044658 | Ga0466972_0002789 | Ga0466972_0002789_554_1180 | 208 |
| 357 | 3300044658 | Ga0466972_0019631 | Ga0466972_0019631_1087_1713 | 208 |
| 358 | 3300044658 | Ga0466972_0052171 | Ga0466972_0052171_810_1436 | 208 |
| 359 | 3300044683 | Ga0466965_0020335 | Ga0466965_0020335_1718_2344 | 208 |
| 360 | 3300044683 | Ga0466965_0023239 | Ga0466965_0023239_339_965 | 208 |
| 361 | 3300044683 | Ga0466965_0026034 | Ga0466965_0026034_1497_2123 | 208 |
| 362 | 3300044684 | Ga0466966_0045383 | Ga0466966_0045383_540_1166 | 208 |
| 363 | 3300044684 | Ga0466966_0445420 | Ga0466966_0445420_119_745 | 208 |
| 364 | 3300044693 | Ga0466961_0008283 | Ga0466961_0008283_2671_3297 | 208 |
| 365 | 3300044694 | Ga0466963_0009064 | Ga0466963_0009064_3834_4460 | 208 |
| 366 | 3300044719 | Ga0466971_0347592 | Ga0466971_0347592_26_652 | 208 |
| 367 | 3300044735 | Ga0466968_0012489 | Ga0466968_0012489_2485_3111 | 208 |
| 368 | 3300044735 | Ga0466968_0026999 | Ga0466968_0026999_58_684 | 208 |
| 369 | 3300044765 | Ga0466970_0014776 | Ga0466970_0014776_705_1331 | 208 |
| 370 | 3300044765 | Ga0466970_0048192 | Ga0466970_0048192_837_1463 | 208 |
| 371 | 3300044765 | Ga0466970_0127678 | Ga0466970_0127678_39_665 | 208 |
| 372 | 3300044842 | Ga0466957_0055843 | Ga0466957_0055843_407_1033 | 208 |
| 373 | 3300044901 | Ga0466960_0000101 | Ga0466960_0000101_5815_6441 | 208 |
| 374 | 3300044901 | Ga0466960_0000133 | Ga0466960_0000133_21297_21923 | 208 |
| 375 | 3300044901 | Ga0466960_0000933 | Ga0466960_0000933_7253_7879 | 208 |
| 376 | 3300044901 | Ga0466960_0020001 | Ga0466960_0020001_1053_1679 | 208 |
| 377 | 3300045049 | Ga0466959_0015686 | Ga0466959_0015686_4035_4661 | 208 |
| 378 | 3300045049 | Ga0466959_0057556 | Ga0466959_0057556_905_1531 | 208 |
| 379 | 3300045049 | Ga0466959_0068639 | Ga0466959_0068639_219_845 | 208 |
| 380 | 3300045836 | Ga0466958_0111650 | Ga0466958_0111650_536_1162 | 208 |
| 381 | 3300045976 | Ga0466967_0032467 | Ga0466967_0032467_2611_3237 | 208 |
| 382 | 3300045976 | Ga0466967_0034160 | Ga0466967_0034160_2208_2834 | 208 |
| 383 | 3300045976 | Ga0466967_0071500 | Ga0466967_0071500_1505_2131 | 208 |
| 384 | 3300045976 | Ga0466967_0274376 | Ga0466967_0274376_323_949 | 208 |
| 385 | 3300045976 | Ga0466967_0310803 | Ga0466967_0310803_377_1003 | 208 |
| 386 | 3300045976 | Ga0466967_0350393 | Ga0466967_0350393_405_1031 | 208 |
| 387 | 3300045976 | Ga0466967_0362300 | Ga0466967_0362300_174_800 | 208 |
| 388 | 3300045976 | Ga0466967_0872519 | Ga0466967_0872519_23_649 | 208 |
| 389 | 3300046455 | Ga0495603_0059116 | Ga0495603_0059116_1135_1761 | 208 |
| 390 | 3300046460 | Ga0495638_0005329 | Ga0495638_0005329_8421_9047 | 208 |
| 391 | 3300046460 | Ga0495638_0013236 | Ga0495638_0013236_1861_2487 | 208 |
| 392 | 3300046461 | Ga0495641_0020991 | Ga0495641_0020991_2035_2661 | 208 |
| 393 | 3300046473 | Ga0495582_0026802 | Ga0495582_0026802_2403_3029 | 208 |
| 394 | 3300046517 | Ga0495630_0280023 | Ga0495630_0280023_519_1145 | 208 |
| 395 | 3300046524 | Ga0495648_0009272 | Ga0495648_0009272_5710_6336 | 208 |
| 396 | 3300046526 | Ga0495666_0069975 | Ga0495666_0069975_609_1235 | 208 |
| 397 | 3300046529 | Ga0495652_0308664 | Ga0495652_0308664_364_990 | 208 |
| 398 | 3300046533 | Ga0495640_0025396 | Ga0495640_0025396_2463_3089 | 208 |
| 399 | 3300046557 | Ga0495622_0118289 | Ga0495622_0118289_210_836 | 208 |
| 400 | 3300046660 | Ga0495625_0152503 | Ga0495625_0152503_110_736 | 208 |
| 401 | 3300046683 | Ga0495658_0015674 | Ga0495658_0015674_1627_2253 | 208 |
| 402 | 3300047319 | Ga0495674_0114660 | Ga0495674_0114660_654_1280 | 208 |
| 403 | 3300047320 | Ga0495672_0054223 | Ga0495672_0054223_1568_2194 | 208 |
| 404 | 3300047321 | Ga0495676_0039056 | Ga0495676_0039056_2356_2982 | 208 |
| 405 | 3300047469 | Ga0495673_0000862 | Ga0495673_0000862_26345_26971 | 208 |
| 406 | 3300047472 | Ga0495686_0004602 | Ga0495686_0004602_2182_2808 | 208 |
| 407 | 3300048091 | Ga0495626_0070877 | Ga0495626_0070877_365_991 | 208 |
| 408 | 3300048903 | Ga0496100_0000041 | Ga0496100_0000041_48567_49193 | 208 |
| 409 | 3300048903 | Ga0496100_0001769 | Ga0496100_0001769_4845_5471 | 208 |
| 410 | 3300048903 | Ga0496100_0011177 | Ga0496100_0011177_4195_4821 | 208 |
| 411 | 3300048903 | Ga0496100_0047118 | Ga0496100_0047118_1302_1928 | 208 |
| 412 | 3300048903 | Ga0496100_0100852 | Ga0496100_0100852_528_1154 | 208 |
| 413 | 3300048904 | Ga0496101_0000019 | Ga0496101_0000019_165422_166048 | 208 |
| 414 | 3300048904 | Ga0496101_0000281 | Ga0496101_0000281_10714_11340 | 208 |
| 415 | 3300048904 | Ga0496101_0000628 | Ga0496101_0000628_9114_9740 | 208 |
| 416 | 3300048904 | Ga0496101_0013388 | Ga0496101_0013388_656_1282 | 208 |
| 417 | 3300048904 | Ga0496101_0022858 | Ga0496101_0022858_2788_3414 | 208 |
| 418 | 3300048904 | Ga0496101_0037722 | Ga0496101_0037722_366_992 | 208 |
| 419 | 3300048904 | Ga0496101_0182725 | Ga0496101_0182725_205_831 | 208 |
| 420 | 3300048904 | Ga0496101_0236044 | Ga0496101_0236044_539_1165 | 208 |
| 421 | 3300048905 | Ga0496102_0000007 | Ga0496102_0000007_313446_314072 | 208 |
| 422 | 3300048905 | Ga0496102_0000060 | Ga0496102_0000060_21937_22563 | 208 |
| 423 | 3300048905 | Ga0496102_0007600 | Ga0496102_0007600_6535_7161 | 208 |
| 424 | 3300048905 | Ga0496102_0025906 | Ga0496102_0025906_3117_3743 | 208 |
| 425 | 3300048905 | Ga0496102_0182657 | Ga0496102_0182657_850_1476 | 208 |
| 426 | 3300048905 | Ga0496102_0328879 | Ga0496102_0328879_434_1060 | 208 |
| 427 | 3300048906 | Ga0496103_0000013 | Ga0496103_0000013_194303_194929 | 208 |
| 428 | 3300048906 | Ga0496103_0000350 | Ga0496103_0000350_38876_39502 | 208 |
| 429 | 3300048906 | Ga0496103_0000704 | Ga0496103_0000704_22804_23430 | 208 |
| 430 | 3300048906 | Ga0496103_0007629 | Ga0496103_0007629_3121_3747 | 208 |
| 431 | 3300048906 | Ga0496103_0115753 | Ga0496103_0115753_336_962 | 208 |
| 432 | 3300048906 | Ga0496103_0206325 | Ga0496103_0206325_619_1245 | 208 |
| 433 | 3300048906 | Ga0496103_0548983 | Ga0496103_0548983_75_701 | 208 |
| 434 | 3300048907 | Ga0496104_0004319 | Ga0496104_0004319_7179_7805 | 208 |
| 435 | 3300048907 | Ga0496104_0005624 | Ga0496104_0005624_8986_9612 | 208 |
| 436 | 3300048907 | Ga0496104_0550376 | Ga0496104_0550376_312_938 | 208 |
| 437 | 3300048908 | Ga0496105_0141317 | Ga0496105_0141317_1022_1648 | 208 |
| 438 | 3300048908 | Ga0496105_0488685 | Ga0496105_0488685_200_826 | 208 |
| 439 | 3300048908 | Ga0496105_0710277 | Ga0496105_0710277_135_761 | 208 |
| 440 | 3300048909 | Ga0496106_0000167 | Ga0496106_0000167_1647_2273 | 208 |
| 441 | 3300048909 | Ga0496106_0001593 | Ga0496106_0001593_15180_15806 | 208 |
| 442 | 3300048909 | Ga0496106_0009916 | Ga0496106_0009916_925_1551 | 208 |
| 443 | 3300048909 | Ga0496106_0011697 | Ga0496106_0011697_4848_5474 | 208 |
| 444 | 3300048910 | Ga0496107_0001007 | Ga0496107_0001007_9322_9948 | 208 |
| 445 | 3300048910 | Ga0496107_0005371 | Ga0496107_0005371_6660_7286 | 208 |
| 446 | 3300048910 | Ga0496107_0011959 | Ga0496107_0011959_4459_5085 | 208 |
| 447 | 3300048910 | Ga0496107_0192189 | Ga0496107_0192189_550_1176 | 208 |
| 448 | 3300048910 | Ga0496107_0199668 | Ga0496107_0199668_584_1210 | 208 |
| 449 | 3300048910 | Ga0496107_0511308 | Ga0496107_0511308_59_685 | 208 |
| 450 | 3300048911 | Ga0496108_0012411 | Ga0496108_0012411_3886_4512 | 208 |
| 451 | 3300048911 | Ga0496108_0205308 | Ga0496108_0205308_881_1507 | 208 |
| 452 | 3300048911 | Ga0496108_0441944 | Ga0496108_0441944_94_720 | 208 |
| 453 | 3300048911 | Ga0496108_0973434 | Ga0496108_0973434_30_656 | 208 |
| 454 | 3300048912 | Ga0496109_0001228 | Ga0496109_0001228_6483_7109 | 208 |
| 455 | 3300048912 | Ga0496109_0152434 | Ga0496109_0152434_542_1168 | 208 |
| 456 | 3300048912 | Ga0496109_0438551 | Ga0496109_0438551_229_855 | 208 |
| 457 | 3300048913 | Ga0496110_0035065 | Ga0496110_0035065_396_1022 | 208 |
| 458 | 3300048913 | Ga0496110_0067413 | Ga0496110_0067413_1341_1967 | 208 |
| 459 | 3300048913 | Ga0496110_0169635 | Ga0496110_0169635_950_1576 | 208 |
| 460 | 3300048913 | Ga0496110_0230661 | Ga0496110_0230661_866_1492 | 208 |
| 461 | 3300048914 | Ga0496111_0045510 | Ga0496111_0045510_1462_2088 | 208 |
| 462 | 3300048915 | Ga0496112_0001398 | Ga0496112_0001398_12514_13140 | 208 |
| 463 | 3300048915 | Ga0496112_0012816 | Ga0496112_0012816_6487_7113 | 208 |
| 464 | 3300048915 | Ga0496112_0054898 | Ga0496112_0054898_441_1067 | 208 |
| 465 | 3300048915 | Ga0496112_0363868 | Ga0496112_0363868_633_1259 | 208 |
| 466 | 3300048915 | Ga0496112_0595227 | Ga0496112_0595227_141_767 | 208 |
| 467 | 3300048916 | Ga0496113_0040891 | Ga0496113_0040891_786_1412 | 208 |
| 468 | 3300048917 | Ga0496114_0000070 | Ga0496114_0000070_67946_68572 | 208 |
| 469 | 3300048917 | Ga0496114_0001225 | Ga0496114_0001225_9355_9981 | 208 |
| 470 | 3300048917 | Ga0496114_0020927 | Ga0496114_0020927_4043_4669 | 208 |
| 471 | 3300048918 | Ga0496115_0010632 | Ga0496115_0010632_3010_3636 | 208 |
| 472 | 3300048918 | Ga0496115_0016522 | Ga0496115_0016522_4596_5222 | 208 |
| 473 | 3300048918 | Ga0496115_0176003 | Ga0496115_0176003_1031_1657 | 208 |
| 474 | 3300048919 | Ga0496116_0000033 | Ga0496116_0000033_104099_104725 | 208 |
| 475 | 3300048919 | Ga0496116_0022639 | Ga0496116_0022639_3821_4447 | 208 |
| 476 | 3300048919 | Ga0496116_0250048 | Ga0496116_0250048_103_729 | 208 |
| 477 | 3300048920 | Ga0496117_0000025 | Ga0496117_0000025_104029_104655 | 208 |
| 478 | 3300048920 | Ga0496117_0000190 | Ga0496117_0000190_71521_72147 | 208 |
| 479 | 3300048920 | Ga0496117_0040290 | Ga0496117_0040290_1934_2560 | 208 |
| 480 | 3300048920 | Ga0496117_0098238 | Ga0496117_0098238_785_1468 | 208 |
| 481 | 3300048921 | Ga0496118_0000023 | Ga0496118_0000023_313452_314078 | 208 |
| 482 | 3300048921 | Ga0496118_0001595 | Ga0496118_0001595_14312_14938 | 208 |
| 483 | 3300048921 | Ga0496118_0005068 | Ga0496118_0005068_8956_9582 | 208 |
| 484 | 3300048921 | Ga0496118_0028003 | Ga0496118_0028003_529_1155 | 208 |
| 485 | 3300048922 | Ga0496119_0008733 | Ga0496119_0008733_7109_7735 | 208 |
| 486 | 3300048922 | Ga0496119_0054476 | Ga0496119_0054476_518_1144 | 208 |
| 487 | 3300048922 | Ga0496119_0117736 | Ga0496119_0117736_336_962 | 208 |
| 488 | 3300048922 | Ga0496119_0177848 | Ga0496119_0177848_325_951 | 208 |
| 489 | 3300048923 | Ga0496120_0002095 | Ga0496120_0002095_20236_20862 | 208 |
| 490 | 3300048923 | Ga0496120_0017876 | Ga0496120_0017876_3421_4047 | 208 |
| 491 | 3300048924 | Ga0496121_0000016 | Ga0496121_0000016_111276_111902 | 208 |
| 492 | 3300048924 | Ga0496121_0000039 | Ga0496121_0000039_148365_148991 | 208 |
| 493 | 3300048924 | Ga0496121_0009738 | Ga0496121_0009738_1840_2466 | 208 |
| 494 | 3300048924 | Ga0496121_0338008 | Ga0496121_0338008_74_700 | 208 |
| 495 | 3300048925 | Ga0496122_0000470 | Ga0496122_0000470_14196_14822 | 208 |
| 496 | 3300048925 | Ga0496122_0023716 | Ga0496122_0023716_994_1620 | 208 |
| 497 | 3300048926 | Ga0496123_0036255 | Ga0496123_0036255_2217_2843 | 208 |
| 498 | 3300048926 | Ga0496123_0047376 | Ga0496123_0047376_1493_2119 | 208 |
| 499 | 3300048927 | Ga0496124_0000015 | Ga0496124_0000015_266488_267114 | 208 |
| 500 | 3300048928 | Ga0496125_0000021 | Ga0496125_0000021_193587_194213 | 208 |
| 501 | 3300048928 | Ga0496125_0074773 | Ga0496125_0074773_1691_2317 | 208 |
| 502 | 3300048928 | Ga0496125_0150313 | Ga0496125_0150313_343_969 | 208 |
| 503 | 3300048929 | Ga0496126_0000015 | Ga0496126_0000015_193587_194213 | 208 |
| 504 | 3300048929 | Ga0496126_0000405 | Ga0496126_0000405_35062_35688 | 208 |
| 505 | 3300048929 | Ga0496126_0006611 | Ga0496126_0006611_484_1110 | 208 |
| 506 | 3300048929 | Ga0496126_0015890 | Ga0496126_0015890_2078_2704 | 208 |
| 507 | 3300048929 | Ga0496126_0025402 | Ga0496126_0025402_805_1431 | 208 |
| 508 | 3300048929 | Ga0496126_0093220 | Ga0496126_0093220_399_1025 | 208 |
| 509 | 3300048929 | Ga0496126_0684288 | Ga0496126_0684288_11_637 | 208 |
| 510 | 3300049569 | Ga0501032_0004043 | Ga0501032_0004043_1499_2125 | 208 |
| 511 | 3300049570 | Ga0501033_0130721 | Ga0501033_0130721_91_717 | 208 |
| 512 | 3300049571 | Ga0501034_0003080 | Ga0501034_0003080_10204_10830 | 208 |
| 513 | 3300049571 | Ga0501034_0004526 | Ga0501034_0004526_3543_4169 | 208 |
| 514 | 3300049571 | Ga0501034_0175650 | Ga0501034_0175650_687_1313 | 208 |
| 515 | 3300049571 | Ga0501034_0669308 | Ga0501034_0669308_147_773 | 208 |
| 516 | 3300049572 | Ga0501036_0030070 | Ga0501036_0030070_944_1570 | 208 |
| 517 | 3300049572 | Ga0501036_0180311 | Ga0501036_0180311_820_1446 | 208 |
| 518 | 3300049573 | Ga0501037_0000490 | Ga0501037_0000490_4184_4810 | 208 |
| 519 | 3300049573 | Ga0501037_0007789 | Ga0501037_0007789_5909_6535 | 208 |
| 520 | 3300049574 | Ga0501038_0021102 | Ga0501038_0021102_1055_1681 | 208 |
| 521 | 3300049575 | Ga0501039_0000886 | Ga0501039_0000886_13815_14441 | 208 |
| 522 | 3300049579 | Ga0501043_0007980 | Ga0501043_0007980_3404_4030 | 208 |
| 523 | 3300049579 | Ga0501043_0020547 | Ga0501043_0020547_3059_3685 | 208 |
| 524 | 3300049580 | Ga0501046_0000749 | Ga0501046_0000749_6917_7543 | 208 |
| 525 | 3300049581 | Ga0501047_0002869 | Ga0501047_0002869_6251_6877 | 208 |
| 526 | 3300049581 | Ga0501047_0262069 | Ga0501047_0262069_803_1429 | 208 |
| 527 | 3300049581 | Ga0501047_0343161 | Ga0501047_0343161_611_1237 | 208 |
| 528 | 3300049582 | Ga0501048_0007940 | Ga0501048_0007940_2663_3289 | 208 |
| 529 | 3300049583 | Ga0501067_0437485 | Ga0501067_0437485_48_674 | 208 |
| 530 | 3300049586 | Ga0501070_0006186 | Ga0501070_0006186_8747_9373 | 208 |
| 531 | 3300049586 | Ga0501070_0012312 | Ga0501070_0012312_6568_7194 | 208 |
| 532 | 3300049587 | Ga0501071_0062549 | Ga0501071_0062549_1265_1891 | 208 |
| 533 | 3300049593 | Ga0501077_0154731 | Ga0501077_0154731_535_1161 | 208 |
| 534 | 3300049744 | Ga0501083_0142994 | Ga0501083_0142994_705_1331 | 208 |
| 535 | 3300049822 | Ga0501035_0015364 | Ga0501035_0015364_2015_2641 | 208 |
| 536 | 3300049823 | Ga0501044_0007663 | Ga0501044_0007663_11206_11832 | 208 |
| 537 | 3300049823 | Ga0501044_0007872 | Ga0501044_0007872_10121_10747 | 208 |
| 538 | 3300050489 | nmdc:mga03683_118149_c1 | nmdc:mga03683_118149_c1_78_704 | 208 |
| 539 | 3300050489 | nmdc:mga03683_127903_c1 | nmdc:mga03683_127903_c1_265_891 | 208 |
| 540 | 3300050489 | nmdc:mga03683_151651_c1 | nmdc:mga03683_151651_c1_288_914 | 208 |
| 541 | 3300050490 | nmdc:mga03n38_26854_c1 | nmdc:mga03n38_26854_c1_123_749 | 208 |
| 542 | 3300050490 | nmdc:mga03n38_37517_c1 | nmdc:mga03n38_37517_c1_318_944 | 208 |
| 543 | 3300050491 | nmdc:mga00v17_142561_c1 | nmdc:mga00v17_142561_c1_229_855 | 208 |
| 544 | 3300050491 | nmdc:mga00v17_143058_c1 | nmdc:mga00v17_143058_c1_384_1010 | 208 |
| 545 | 3300050491 | nmdc:mga00v17_426031_c1 | nmdc:mga00v17_426031_c1_17_643 | 208 |
| 546 | 3300050492 | nmdc:mga0yw44_249433_c1 | nmdc:mga0yw44_249433_c1_406_1032 | 208 |
| 547 | 3300050492 | nmdc:mga0yw44_599022_c1 | nmdc:mga0yw44_599022_c1_64_690 | 208 |
| 548 | 3300050492 | nmdc:mga0yw44_66800_c1 | nmdc:mga0yw44_66800_c1_621_1247 | 208 |
| 549 | 3300050492 | nmdc:mga0yw44_67531_c1 | nmdc:mga0yw44_67531_c1_774_1409 | 208 |
| 550 | 3300050492 | nmdc:mga0yw44_773231_c1 | nmdc:mga0yw44_773231_c1_10_636 | 208 |
| 551 | 3300050494 | nmdc:mga06z11_56244_c1 | nmdc:mga06z11_56244_c1_393_1019 | 208 |
| 552 | 3300050494 | nmdc:mga06z11_74831_c1 | nmdc:mga06z11_74831_c1_340_966 | 208 |
| 553 | 3300050495 | nmdc:mga04h51_128420_c1 | nmdc:mga04h51_128420_c1_194_820 | 208 |
| 554 | 3300050496 | nmdc:mga07m45_21630_c1 | nmdc:mga07m45_21630_c1_61_687 | 208 |
| 555 | 3300050496 | nmdc:mga07m45_314352_c1 | nmdc:mga07m45_314352_c1_29_655 | 208 |
| 556 | 3300050496 | nmdc:mga07m45_88910_c1 | nmdc:mga07m45_88910_c1_1036_1662 | 208 |
| 557 | 3300050509 | nmdc:mga0qj67_45064_c1 | nmdc:mga0qj67_45064_c1_1443_2069 | 208 |
| 558 | 3300050510 | nmdc:mga06r32_19200_c1 | nmdc:mga06r32_19200_c1_2751_3377 | 208 |
| 559 | 3300050511 | nmdc:mga08y16_960557_c1 | nmdc:mga08y16_960557_c1_191_817 | 208 |
| 560 | 3300050516 | nmdc:mga0sz30_17456_c2 | nmdc:mga0sz30_17456_c2_912_1538 | 208 |
| 561 | 3300050516 | nmdc:mga0sz30_2497_c1 | nmdc:mga0sz30_2497_c1_1235_1861 | 208 |
| 562 | 3300050516 | nmdc:mga0sz30_32132_c2 | nmdc:mga0sz30_32132_c2_480_1106 | 208 |
| 563 | 3300053079 | Ga0500610_0177427 | Ga0500610_0177427_282_908 | 208 |
| 564 | 3300053080 | Ga0500635_0000964 | Ga0500635_0000964_3342_3968 | 208 |
| 565 | 3300053087 | Ga0500643_008359 | Ga0500643_008359_2545_3171 | 208 |
| 566 | 3300053090 | Ga0500646_0039660 | Ga0500646_0039660_468_1094 | 208 |
| 567 | 3300053096 | Ga0500641_0083516 | Ga0500641_0083516_125_751 | 208 |
| 568 | 3300053104 | Ga0500556_0123557 | Ga0500556_0123557_33_659 | 208 |
| 569 | 3300053108 | Ga0500562_007263 | Ga0500562_007263_251_877 | 208 |
| 570 | 3300053131 | Ga0500652_014835 | Ga0500652_014835_173_799 | 208 |
| 571 | 3300053137 | Ga0500561_0035811 | Ga0500561_0035811_31_657 | 208 |
| 572 | 3300053153 | Ga0500616_0107584 | Ga0500616_0107584_77_709 | 208 |
| 573 | 3300053153 | Ga0500616_0157063 | Ga0500616_0157063_185_811 | 208 |
| 574 | 3300053730 | Ga0500645_000054 | Ga0500645_000054_2934_3560 | 208 |
| 575 | 3300053730 | Ga0500645_005840 | Ga0500645_005840_3031_3657 | 208 |
| 576 | 3300061719 | Ga0466962_0058458 | Ga0466962_0058458_159_785 | 208 |
| 577 | 3300046523 | Ga0495644_0108466 | Ga0495644_0108466_352_1008 | 218 |
| 578 | 3300048905 | Ga0496102_0129681 | Ga0496102_0129681_274_930 | 218 |
| 579 | 3300001977 | JGI24746J21847_1001858 | JGI24746J21847_10018584 | 225 |
| 580 | 3300005328 | Ga0070676_10410933 | Ga0070676_104109331 | 225 |
| 581 | 3300005330 | Ga0070690_100505548 | Ga0070690_1005055482 | 225 |
| 582 | 3300005334 | Ga0068869_100017057 | Ga0068869_1000170574 | 225 |
| 583 | 3300005337 | Ga0070682_100103520 | Ga0070682_1001035202 | 225 |
| 584 | 3300005338 | Ga0068868_100691825 | Ga0068868_1006918252 | 225 |
| 585 | 3300005338 | Ga0068868_100760211 | Ga0068868_1007602111 | 225 |
| 586 | 3300005340 | Ga0070689_100063106 | Ga0070689_1000631062 | 225 |
| 587 | 3300005347 | Ga0070668_100819976 | Ga0070668_1008199761 | 225 |
| 588 | 3300005355 | Ga0070671_100164488 | Ga0070671_1001644882 | 225 |
| 589 | 3300005366 | Ga0070659_100097283 | Ga0070659_1000972832 | 225 |
| 590 | 3300005367 | Ga0070667_100321273 | Ga0070667_1003212732 | 225 |
| 591 | 3300005434 | Ga0070709_10020423 | Ga0070709_100204233 | 225 |
| 592 | 3300005439 | Ga0070711_100001530 | Ga0070711_10000153011 | 225 |
| 593 | 3300005440 | Ga0070705_100029378 | Ga0070705_1000293783 | 225 |
| 594 | 3300005441 | Ga0070700_100020109 | Ga0070700_1000201092 | 225 |
| 595 | 3300005441 | Ga0070700_100603127 | Ga0070700_1006031271 | 225 |
| 596 | 3300005456 | Ga0070678_100083646 | Ga0070678_1000836462 | 225 |
| 597 | 3300005456 | Ga0070678_100276816 | Ga0070678_1002768162 | 225 |
| 598 | 3300005457 | Ga0070662_100315991 | Ga0070662_1003159912 | 225 |
| 599 | 3300005546 | Ga0070696_100035906 | Ga0070696_1000359063 | 225 |
| 600 | 3300005549 | Ga0070704_100281754 | Ga0070704_1002817541 | 225 |
| 601 | 3300005578 | Ga0068854_100115768 | Ga0068854_1001157682 | 225 |
| 602 | 3300005578 | Ga0068854_100300934 | Ga0068854_1003009342 | 225 |
| 603 | 3300005617 | Ga0068859_100254287 | Ga0068859_1002542872 | 225 |
| 604 | 3300005617 | Ga0068859_100642288 | Ga0068859_1006422882 | 225 |
| 605 | 3300005718 | Ga0068866_10014818 | Ga0068866_100148182 | 225 |
| 606 | 3300005719 | Ga0068861_100719351 | Ga0068861_1007193512 | 225 |
| 607 | 3300005842 | Ga0068858_100243100 | Ga0068858_1002431002 | 225 |
| 608 | 3300005843 | Ga0068860_100394944 | Ga0068860_1003949443 | 225 |
| 609 | 3300005844 | Ga0068862_100114122 | Ga0068862_1001141222 | 225 |
| 610 | 3300006173 | Ga0070716_100004716 | Ga0070716_1000047165 | 225 |
| 611 | 3300006175 | Ga0070712_100006865 | Ga0070712_1000068652 | 225 |
| 612 | 3300006881 | Ga0068865_100059755 | Ga0068865_1000597552 | 225 |
| 613 | 3300006931 | Ga0097620_100254309 | Ga0097620_1002543092 | 225 |
| 614 | 3300006931 | Ga0097620_100642296 | Ga0097620_1006422962 | 225 |
| 615 | 3300009098 | Ga0105245_10664927 | Ga0105245_106649272 | 225 |
| 616 | 3300009148 | Ga0105243_10054529 | Ga0105243_100545293 | 225 |
| 617 | 3300009174 | Ga0105241_10439071 | Ga0105241_104390712 | 225 |
| 618 | 3300010375 | Ga0105239_10312017 | Ga0105239_103120172 | 225 |
| 619 | 3300011119 | Ga0105246_10025918 | Ga0105246_100259183 | 225 |
| 620 | 3300013296 | Ga0157374_10058948 | Ga0157374_100589484 | 225 |
| 621 | 3300013306 | Ga0163162_10248625 | Ga0163162_102486253 | 225 |
| 622 | 3300014326 | Ga0157380_10022573 | Ga0157380_100225736 | 225 |
| 623 | 3300014745 | Ga0157377_10025833 | Ga0157377_100258332 | 225 |
| 624 | 3300017792 | Ga0163161_10420461 | Ga0163161_104204611 | 225 |
| 625 | 3300025899 | Ga0207642_10093693 | Ga0207642_100936932 | 225 |
| 626 | 3300025899 | Ga0207642_10250778 | Ga0207642_102507782 | 225 |
| 627 | 3300025900 | Ga0207710_10029722 | Ga0207710_100297222 | 225 |
| 628 | 3300025901 | Ga0207688_10004437 | Ga0207688_1000443710 | 225 |
| 629 | 3300025905 | Ga0207685_10143676 | Ga0207685_101436762 | 225 |
| 630 | 3300025906 | Ga0207699_10135009 | Ga0207699_101350092 | 225 |
| 631 | 3300025907 | Ga0207645_10146461 | Ga0207645_101464611 | 225 |
| 632 | 3300025915 | Ga0207693_10004717 | Ga0207693_100047178 | 225 |
| 633 | 3300025916 | Ga0207663_10004414 | Ga0207663_100044142 | 225 |
| 634 | 3300025917 | Ga0207660_10204815 | Ga0207660_102048151 | 225 |
| 635 | 3300025918 | Ga0207662_10098206 | Ga0207662_100982062 | 225 |
| 636 | 3300025926 | Ga0207659_10323353 | Ga0207659_103233532 | 225 |
| 637 | 3300025931 | Ga0207644_10039181 | Ga0207644_100391812 | 225 |
| 638 | 3300025932 | Ga0207690_10143708 | Ga0207690_101437082 | 225 |
| 639 | 3300025933 | Ga0207706_10088809 | Ga0207706_100888093 | 225 |
| 640 | 3300025939 | Ga0207665_10006390 | Ga0207665_100063905 | 225 |
| 641 | 3300025942 | Ga0207689_10007708 | Ga0207689_100077089 | 225 |
| 642 | 3300025949 | Ga0207667_10247433 | Ga0207667_102474332 | 225 |
| 643 | 3300025960 | Ga0207651_10224301 | Ga0207651_102243012 | 225 |
| 644 | 3300025972 | Ga0207668_10028012 | Ga0207668_100280122 | 225 |
| 645 | 3300025981 | Ga0207640_10237538 | Ga0207640_102375382 | 225 |
| 646 | 3300025981 | Ga0207640_10543522 | Ga0207640_105435222 | 225 |
| 647 | 3300026023 | Ga0207677_10159070 | Ga0207677_101590701 | 225 |
| 648 | 3300026035 | Ga0207703_10044490 | Ga0207703_100444903 | 225 |
| 649 | 3300026075 | Ga0207708_10033635 | Ga0207708_100336353 | 225 |
| 650 | 3300026089 | Ga0207648_10061408 | Ga0207648_100614083 | 225 |
| 651 | 3300026118 | Ga0207675_100047669 | Ga0207675_1000476692 | 225 |
| 652 | 3300026118 | Ga0207675_100077890 | Ga0207675_1000778902 | 225 |
| 653 | 3300026118 | Ga0207675_100355527 | Ga0207675_1003555272 | 225 |
| 654 | 3300026121 | Ga0207683_10018223 | Ga0207683_100182231 | 225 |
| 655 | 3300028379 | Ga0268266_10181355 | Ga0268266_101813553 | 225 |
| 656 | 3300034820 | Ga0373959_0036356 | Ga0373959_0036356_277_954 | 225 |
| 657 | 3300035085 | Ga0373929_0074450 | Ga0373929_0074450_13_690 | 225 |
| 658 | 3300035691 | Ga0373931_0015952 | Ga0373931_0015952_317_994 | 225 |
| 659 | 3300048903 | Ga0496100_0193381 | Ga0496100_0193381_621_1298 | 225 |
| 660 | 3300048903 | Ga0496100_0431194 | Ga0496100_0431194_130_807 | 225 |
| 661 | 3300048905 | Ga0496102_0041638 | Ga0496102_0041638_1438_2115 | 225 |
| 662 | 3300048906 | Ga0496103_0070718 | Ga0496103_0070718_888_1565 | 225 |
| 663 | 3300048906 | Ga0496103_0426278 | Ga0496103_0426278_80_757 | 225 |
| 664 | 3300048911 | Ga0496108_0000986 | Ga0496108_0000986_9235_9912 | 225 |
| 665 | 3300048912 | Ga0496109_0003917 | Ga0496109_0003917_2391_3068 | 225 |
| 666 | 3300048914 | Ga0496111_0491727 | Ga0496111_0491727_110_787 | 225 |
| 667 | 3300048915 | Ga0496112_0016413 | Ga0496112_0016413_97_774 | 225 |
| 668 | 3300048916 | Ga0496113_0083641 | Ga0496113_0083641_312_989 | 225 |
| 669 | 3300048917 | Ga0496114_0159442 | Ga0496114_0159442_135_812 | 225 |
| 670 | 3300048918 | Ga0496115_0174547 | Ga0496115_0174547_553_1230 | 225 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1f2v-assembly1.cif.gz_A | crystal structure analysis of precorrin-8x methylmutase of aerobic vitamin b12 synthesis | 0.9765 | 1 | 204 |
| 3e7d-assembly1.cif.gz_A | crystal structure of precorrin-8x methyl mutase cbic/cobh from brucella melitensis | 0.9711 | 4 | 204 |
| 3e7d-assembly1.cif.gz_A | crystal structure of precorrin-8x methyl mutase cbic/cobh from brucella melitensis | 0.9617 | 4 | 204 |
| 4au1-assembly1.cif.gz_A | crystal structure of cobh (precorrin-8x methyl mutase) complexed with c5 desmethyl-hba | 0.9574 | 1 | 204 |
| 5n0g-assembly1.cif.gz_A-2 | crystal structure of cobh t85a (precorrin-8x methyl mutase) complexed with c5 allyl-hba | 0.9571 | 1 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3e7dD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase | 0.9691 | 4 | 204 | 3.40.50.10230 |
| 3e7dD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase | 0.9506 | 4 | 204 | 3.40.50.10230 |
| 2afvB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase | 0.9318 | 1 | 205 | 3.40.50.10230 |
| af_Q58340_4_210_3.40.50.10230 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase | 0.9172 | 4 | 203 | 3.40.50.10230 |
| 1v9cA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase | 0.9093 | 11 | 203 | 3.40.50.10230 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7I9X611-F1-model_v4 | deleted | 0.9881 | 1 | 84 |
|
| AF-A0A2S8M4Z7-F1-model_v4 | deleted | 0.9878 | 1 | 71 |
|
| AF-A0A1N0PY12-F1-model_v4 | deleted | 0.9864 | 95 | 204 |
|
| AF-A0A4Q7CIR0-F1-model_v4 | Precorrin-8X methylmutase | 0.9849 | 53 | 208 |
GO:0009236
GO:0016993 |
| AF-A0A259BLV4-F1-model_v4 | Cobalamin biosynthesis precorrin-8X methylmutase CobH/CbiC domain-containing protein | 0.9848 | 1 | 50 |
GO:0009236
GO:0016993 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar