F474015

General Info

Members Datasets Scaffolds Average Seq Length
669 295 1338 286

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10199094|Ga0207678_101990942
Length 328
Sequence MHTTISSPAKTVTIGHDQPFAIIGERINPTGRAKFQRQLRDGDLSRIEIDVAQQVAGGAMLLDVNMGAPLADEAELMVRAVTLIQGLTDLPLVIDSSIPAVLEAGLAAYQGKALVNSVTAEDERLHAILPLVKRYGAAVIGLPNDEEQIPDAPEERLALARKLIRTATDTYQIPIEDIVIDPLAMPVGADTGNTMRTLETLALVRDEFGVNTTLGASNLSFGMPDRHALTAAFLPLAAAHGLTSAIMDTRTPQVVTAARAADLLLGRDDWGAAWIAAFRAAKAAEQLSPAGTTLRTPRGMPALPDRRRGAGWRTEDAPQSPRHANRDR

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
83 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
142 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
143 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
146 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
147 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
148 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
151 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
158 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
163 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
164 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
165 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
176 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
177 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
190 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
265 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
266 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
281 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
285 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
288 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
294 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
295 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0.9
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 5.23
Rhizosphere 92.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10199094 3300026067 Bacteria 1712
2 JGI25404J52841_10000398 3300003659 Bacteria 6005
3 Ga0070658_10006727 3300005327 Bacteria 9314
4 Ga0070658_10007493 3300005327 Bacteria 8806
5 Ga0070676_10351239 3300005328 Bacteria 1014
6 Ga0070683_100095482 3300005329 Bacteria 2795
7 Ga0070683_100284399 3300005329 Bacteria 1573
8 Ga0070690_100022486 3300005330 Bacteria 3857
9 Ga0070680_100098443 3300005336 Bacteria 2426
10 Ga0070680_100110586 3300005336 Bacteria 2287
11 Ga0070682_100037868 3300005337 Bacteria 2955
12 Ga0070682_100308805 3300005337 Bacteria 1163
13 Ga0068868_100147018 3300005338 Bacteria 1939
14 Ga0068868_100378941 3300005338 Bacteria 1217
15 Ga0070689_100047404 3300005340 Bacteria 3314
16 Ga0070691_10034550 3300005341 Bacteria 2380
17 Ga0070691_10084260 3300005341 Bacteria 1560
18 Ga0070687_100153364 3300005343 Bacteria 1354
19 Ga0070661_100238413 3300005344 Bacteria 1400
20 Ga0070692_10055715 3300005345 Bacteria 2068
21 Ga0070668_100114738 3300005347 Bacteria 2147
22 Ga0070675_100033222 3300005354 Bacteria 4181
23 Ga0070671_100244779 3300005355 Bacteria 1522
24 Ga0070673_100098201 3300005364 Bacteria 2406
25 Ga0070667_100112253 3300005367 Bacteria 2364
26 Ga0070709_10006011 3300005434 Bacteria 6598
27 Ga0070709_10035182 3300005434 Bacteria 3042
28 Ga0070709_10041597 3300005434 Bacteria 2832
29 Ga0070709_10335440 3300005434 Bacteria 1113
30 Ga0070714_100022125 3300005435 Bacteria 5210
31 Ga0070714_100068074 3300005435 Bacteria 3071
32 Ga0070714_100105493 3300005435 Bacteria 2488
33 Ga0070714_100180930 3300005435 Bacteria 1918
34 Ga0070714_100183072 3300005435 Bacteria 1907
35 Ga0070714_100443169 3300005435 Bacteria 1233
36 Ga0070713_100018274 3300005436 Bacteria 5329
37 Ga0070713_100130271 3300005436 Bacteria 2217
38 Ga0070713_100273965 3300005436 Bacteria 1546
39 Ga0070713_100328778 3300005436 Bacteria 1413
40 Ga0070710_10002884 3300005437 Bacteria 8191
41 Ga0070711_100063942 3300005439 Bacteria 2569
42 Ga0070711_100097676 3300005439 Bacteria 2130
43 Ga0070705_100215403 3300005440 Bacteria 1326
44 Ga0070708_100028053 3300005445 Bacteria 4840
45 Ga0070708_100052879 3300005445 Bacteria 3602
46 Ga0070708_100353281 3300005445 Bacteria 1385
47 Ga0070708_100594662 3300005445 Bacteria 1043
48 Ga0070663_100242030 3300005455 Bacteria 1424
49 Ga0070663_100339395 3300005455 Bacteria 1213
50 Ga0070678_100252806 3300005456 Bacteria 1478
51 Ga0070681_10210639 3300005458 Bacteria 1860
52 Ga0070681_10370948 3300005458 Bacteria 1342
53 Ga0068867_100061590 3300005459 Bacteria 2786
54 Ga0070685_10012773 3300005466 Bacteria 4417
55 Ga0070706_100003827 3300005467 Bacteria 14708
56 Ga0070706_100006264 3300005467 Bacteria 11256
57 Ga0070706_100008346 3300005467 Bacteria 9648
58 Ga0070706_100130554 3300005467 Bacteria 2344
59 Ga0070706_100147969 3300005467 Bacteria 2193
60 Ga0070707_100000596 3300005468 Bacteria 36368
61 Ga0070707_100011189 3300005468 Bacteria 8363
62 Ga0070707_100021466 3300005468 Bacteria 6103
63 Ga0070707_100025539 3300005468 Bacteria 5605
64 Ga0070707_100056960 3300005468 Bacteria 3749
65 Ga0070707_100067523 3300005468 Bacteria 3440
66 Ga0070707_100155466 3300005468 Bacteria 2228
67 Ga0070707_100295190 3300005468 Bacteria 1575
68 Ga0070698_100000272 3300005471 Bacteria 52507
69 Ga0070698_100000415 3300005471 Bacteria 45479
70 Ga0070698_100000997 3300005471 Bacteria 31180
71 Ga0070698_100003605 3300005471 Bacteria 17018
72 Ga0070698_100013860 3300005471 Bacteria 8524
73 Ga0070698_100028331 3300005471 Bacteria 5819
74 Ga0070698_100035486 3300005471 Bacteria 5156
75 Ga0070698_100093920 3300005471 Bacteria 2979
76 Ga0070698_100318580 3300005471 Bacteria 1486
77 Ga0070699_100088729 3300005518 Bacteria 2701
78 Ga0070679_100086043 3300005530 Bacteria 3130
79 Ga0070679_100579644 3300005530 Bacteria 1065
80 Ga0070684_100008234 3300005535 Bacteria 8146
81 Ga0070684_100026234 3300005535 Bacteria 4906
82 Ga0070684_100096180 3300005535 Bacteria 2640
83 Ga0070684_100229345 3300005535 Bacteria 1695
84 Ga0070697_100074348 3300005536 Bacteria 2792
85 Ga0070697_100201039 3300005536 Bacteria 1694
86 Ga0068853_100084552 3300005539 Bacteria 2780
87 Ga0068853_100270850 3300005539 Bacteria 1563
88 Ga0070672_100015514 3300005543 Bacteria 5427
89 Ga0070672_100430052 3300005543 Bacteria 1135
90 Ga0070696_100057788 3300005546 Bacteria 2708
91 Ga0070665_100174594 3300005548 Bacteria 2150
92 Ga0070665_100221691 3300005548 Bacteria 1891
93 Ga0070665_100422668 3300005548 Bacteria 1341
94 Ga0068855_100137800 3300005563 Bacteria 2783
95 Ga0070664_100126825 3300005564 Bacteria 2239
96 Ga0068857_100072535 3300005577 Bacteria 3068
97 Ga0068857_100326583 3300005577 Bacteria 1417
98 Ga0068854_100052623 3300005578 Bacteria 2921
99 Ga0068856_100121353 3300005614 Bacteria 2615
100 Ga0068856_100411945 3300005614 Bacteria 1371
101 Ga0070702_100121017 3300005615 Bacteria 1639
102 Ga0068864_100106489 3300005618 Bacteria 2493
103 Ga0068864_100270829 3300005618 Bacteria 1582
104 Ga0068864_100468157 3300005618 Bacteria 1208
105 Ga0068861_100246366 3300005719 Bacteria 1522
106 Ga0068870_10003577 3300005840 Bacteria 6589
107 Ga0068870_10006656 3300005840 Bacteria 5107
108 Ga0068863_100130514 3300005841 Bacteria 2399
109 Ga0068863_100145498 3300005841 Bacteria 2266
110 Ga0068858_100066920 3300005842 Bacteria 3326
111 Ga0068860_100115826 3300005843 Bacteria 2563
112 Ga0081455_10001397 3300005937 Bacteria 29816
113 Ga0081540_1000070 3300005983 Bacteria 111392
114 Ga0081540_1000255 3300005983 Bacteria 56347
115 Ga0070717_10011880 3300006028 Bacteria 6627
116 Ga0070717_10030716 3300006028 Bacteria 4316
117 Ga0070717_10040696 3300006028 Bacteria 3787
118 Ga0070717_10357081 3300006028 Bacteria 1307
119 Ga0070717_10469510 3300006028 Bacteria 1135
120 Ga0075363_100112466 3300006048 Bacteria 1514
121 Ga0070715_10003563 3300006163 Bacteria 4985
122 Ga0070716_100086062 3300006173 Bacteria 1890
123 Ga0070716_100110221 3300006173 Bacteria 1704
124 Ga0070716_100172751 3300006173 Bacteria 1412
125 Ga0070712_100001430 3300006175 Bacteria 14559
126 Ga0070712_100024741 3300006175 Bacteria 3983
127 Ga0070712_100029923 3300006175 Bacteria 3654
128 Ga0070712_100045889 3300006175 Bacteria 3019
129 Ga0070712_100138604 3300006175 Bacteria 1853
130 Ga0097621_100207432 3300006237 Bacteria 1703
131 Ga0068871_100060277 3300006358 Bacteria 3095
132 Ga0068871_100158580 3300006358 Bacteria 1934
133 Ga0075428_100065303 3300006844 Bacteria 3985
134 Ga0075433_10079779 3300006852 Bacteria 2884
135 Ga0075434_100116857 3300006871 Bacteria 2680
136 Ga0075434_100543344 3300006871 Bacteria 1182
137 Ga0075436_100023790 3300006914 Bacteria 4209
138 Ga0075436_100036516 3300006914 Bacteria 3391
139 Ga0075436_100038138 3300006914 Bacteria 3317
140 Ga0075436_100038908 3300006914 Bacteria 3282
141 Ga0075435_100010584 3300007076 Bacteria 6750
142 Ga0075435_100164107 3300007076 Bacteria 1872
143 Ga0099794_10056226 3300007265 Bacteria 1903
144 Ga0105251_10039771 3300009011 Bacteria 2295
145 Ga0111539_10030235 3300009094 Bacteria 6586
146 Ga0105245_10422077 3300009098 Bacteria 1337
147 Ga0105247_10109600 3300009101 Bacteria 1775
148 Ga0114129_10123228 3300009147 Bacteria 3566
149 Ga0105243_10190814 3300009148 Bacteria 1790
150 Ga0105242_10351222 3300009176 Bacteria 1362
151 Ga0105248_10835268 3300009177 Bacteria 1040
152 Ga0105237_10165429 3300009545 Bacteria 2211
153 Ga0105238_10108642 3300009551 Bacteria 2755
154 Ga0105239_10937086 3300010375 Bacteria 994
155 Ga0105246_10030702 3300011119 Bacteria 3551
156 Ga0105246_10067203 3300011119 Bacteria 2511
157 Ga0157341_1002091 3300012494 Bacteria 1282
158 Ga0157338_1006338 3300012515 Bacteria 1091
159 Ga0157370_10053967 3300013104 Bacteria 3831
160 Ga0157370_10068763 3300013104 Bacteria 3347
161 Ga0157369_10025418 3300013105 Bacteria 6576
162 Ga0157369_10044576 3300013105 Bacteria 4826
163 Ga0157369_10069173 3300013105 Bacteria 3793
164 Ga0157369_10139462 3300013105 Bacteria 2566
165 Ga0157369_10272517 3300013105 Bacteria 1763
166 Ga0163162_10264431 3300013306 Bacteria 1852
167 Ga0163163_10032737 3300014325 Bacteria 5023
168 Ga0163163_10235243 3300014325 Bacteria 1881
169 Ga0163163_10488913 3300014325 Bacteria 1292
170 Ga0157380_10022765 3300014326 Bacteria 4723
171 Ga0157380_10328683 3300014326 Bacteria 1421
172 Ga0157377_10036512 3300014745 Bacteria 2704
173 Ga0157379_10101468 3300014968 Bacteria 2582
174 Ga0157376_10229016 3300014969 Bacteria 1725
175 Ga0157376_10314520 3300014969 Bacteria 1487
176 Ga0206354_10221321 3300020081 Bacteria 3273
177 Ga0206354_10324262 3300020081 Bacteria 2578
178 Ga0206353_11100521 3300020082 Bacteria 2875
179 Ga0206353_12026084 3300020082 Bacteria 2476
180 Ga0213875_10000158 3300021388 Bacteria 71389
181 Ga0213875_10124775 3300021388 Bacteria 1203
182 Ga0224712_10100834 3300022467 Bacteria 1224
183 Ga0207692_10001781 3300025898 Bacteria 8174
184 Ga0207692_10005925 3300025898 Bacteria 4931
185 Ga0207692_10040324 3300025898 Bacteria 2303
186 Ga0207692_10065417 3300025898 Bacteria 1896
187 Ga0207710_10015780 3300025900 Bacteria 3194
188 Ga0207688_10004276 3300025901 Bacteria 7785
189 Ga0207647_10051533 3300025904 Bacteria 2543
190 Ga0207647_10175835 3300025904 Bacteria 1245
191 Ga0207685_10103586 3300025905 Bacteria 1221
192 Ga0207699_10003184 3300025906 Bacteria 7812
193 Ga0207699_10006004 3300025906 Bacteria 5846
194 Ga0207699_10018224 3300025906 Bacteria 3716
195 Ga0207699_10060602 3300025906 Bacteria 2273
196 Ga0207645_10231042 3300025907 Bacteria 1221
197 Ga0207643_10001438 3300025908 Bacteria 13665
198 Ga0207705_10041110 3300025909 Bacteria 3316
199 Ga0207684_10000787 3300025910 Bacteria 36852
200 Ga0207684_10010320 3300025910 Bacteria 8223
201 Ga0207684_10020239 3300025910 Bacteria 5685
202 Ga0207684_10021790 3300025910 Bacteria 5470
203 Ga0207684_10042341 3300025910 Bacteria 3860
204 Ga0207684_10045578 3300025910 Bacteria 3718
205 Ga0207684_10086258 3300025910 Bacteria 2674
206 Ga0207654_10053639 3300025911 Bacteria 2328
207 Ga0207693_10003435 3300025915 Bacteria 13516
208 Ga0207693_10023877 3300025915 Bacteria 4853
209 Ga0207693_10037306 3300025915 Bacteria 3830
210 Ga0207693_10057348 3300025915 Bacteria 3053
211 Ga0207693_10058382 3300025915 Bacteria 3023
212 Ga0207663_10047249 3300025916 Bacteria 2656
213 Ga0207662_10022414 3300025918 Bacteria 3622
214 Ga0207657_10002750 3300025919 Bacteria 18932
215 Ga0207657_10022835 3300025919 Bacteria 5840
216 Ga0207649_10098987 3300025920 Bacteria 1926
217 Ga0207649_10193116 3300025920 Bacteria 1433
218 Ga0207652_10017047 3300025921 Bacteria 5942
219 Ga0207652_10105681 3300025921 Bacteria 2491
220 Ga0207646_10000500 3300025922 Bacteria 52535
221 Ga0207646_10001807 3300025922 Bacteria 25880
222 Ga0207646_10050063 3300025922 Bacteria 3740
223 Ga0207646_10054303 3300025922 Bacteria 3584
224 Ga0207646_10079695 3300025922 Bacteria 2928
225 Ga0207646_10091532 3300025922 Bacteria 2722
226 Ga0207646_10097284 3300025922 Bacteria 2637
227 Ga0207646_10104414 3300025922 Bacteria 2541
228 Ga0207646_10200449 3300025922 Bacteria 1803
229 Ga0207646_10266011 3300025922 Bacteria 1550
230 Ga0207646_10330249 3300025922 Bacteria 1378
231 Ga0207650_10004613 3300025925 Bacteria 9422
232 Ga0207659_10274453 3300025926 Bacteria 1376
233 Ga0207700_10012338 3300025928 Bacteria 5504
234 Ga0207700_10054264 3300025928 Bacteria 3007
235 Ga0207700_10103492 3300025928 Bacteria 2276
236 Ga0207700_10193018 3300025928 Bacteria 1712
237 Ga0207700_10230511 3300025928 Bacteria 1574
238 Ga0207700_10387648 3300025928 Bacteria 1223
239 Ga0207664_10001200 3300025929 Bacteria 17207
240 Ga0207664_10001575 3300025929 Bacteria 14979
241 Ga0207664_10001831 3300025929 Bacteria 14023
242 Ga0207664_10003267 3300025929 Bacteria 10773
243 Ga0207664_10012574 3300025929 Bacteria 6055
244 Ga0207664_10035385 3300025929 Bacteria 3853
245 Ga0207664_10204686 3300025929 Bacteria 1705
246 Ga0207664_10214649 3300025929 Bacteria 1666
247 Ga0207664_10215974 3300025929 Bacteria 1661
248 Ga0207664_10474070 3300025929 Bacteria 1119
249 Ga0207670_10028108 3300025936 Bacteria 3565
250 Ga0207704_10328385 3300025938 Bacteria 1183
251 Ga0207665_10002304 3300025939 Bacteria 12896
252 Ga0207665_10008798 3300025939 Bacteria 6638
253 Ga0207665_10016409 3300025939 Bacteria 4862
254 Ga0207665_10054765 3300025939 Bacteria 2691
255 Ga0207665_10315019 3300025939 Bacteria 1173
256 Ga0207691_10023010 3300025940 Bacteria 5870
257 Ga0207689_10002061 3300025942 Bacteria 18976
258 Ga0207661_10103120 3300025944 Bacteria 2400
259 Ga0207661_10131026 3300025944 Bacteria 2148
260 Ga0207679_10258460 3300025945 Bacteria 1484
261 Ga0207667_10127461 3300025949 Bacteria 2622
262 Ga0207651_10439907 3300025960 Bacteria 1117
263 Ga0207640_10074296 3300025981 Bacteria 2300
264 Ga0207677_10156536 3300026023 Bacteria 1765
265 Ga0207639_10141007 3300026041 Bacteria 2008
266 Ga0207678_10002282 3300026067 Bacteria 17353
267 Ga0207678_10005083 3300026067 Bacteria 11795
268 Ga0207708_10179810 3300026075 Bacteria 1679
269 Ga0207641_10256788 3300026088 Bacteria 1634
270 Ga0207648_10044100 3300026089 Bacteria 3913
271 Ga0207676_10054942 3300026095 Bacteria 3123
272 Ga0207676_10297162 3300026095 Bacteria 1473
273 Ga0207674_10013418 3300026116 Bacteria 9094
274 Ga0207674_10026006 3300026116 Bacteria 6228
275 Ga0207674_10029653 3300026116 Bacteria 5758
276 Ga0207674_10039601 3300026116 Bacteria 4885
277 Ga0207675_100009072 3300026118 Bacteria 9333
278 Ga0207683_10000774 3300026121 Bacteria 29121
279 Ga0207683_10097628 3300026121 Bacteria 2620
280 Ga0207683_10180711 3300026121 Bacteria 1913
281 Ga0207428_10372026 3300027907 Bacteria 1049
282 Ga0268266_10159905 3300028379 Bacteria 2037
283 Ga0268266_10266874 3300028379 Bacteria 1588
284 Ga0268265_10560615 3300028380 Bacteria 1086
285 Ga0268264_10296055 3300028381 Bacteria 1521
286 Ga0265337_1000057 3300028556 Bacteria 51000
287 Ga0265326_10003994 3300028558 Bacteria 4775
288 Ga0265319_1019198 3300028563 Bacteria 2558
289 Ga0265334_10000298 3300028573 Bacteria 27757
290 Ga0265318_10051173 3300028577 Bacteria 1551
291 Ga0265323_10014644 3300028653 Bacteria 3098
292 Ga0265322_10003954 3300028654 Bacteria 4441
293 Ga0265336_10003082 3300028666 Bacteria 6639
294 Ga0265336_10060799 3300028666 Bacteria 1133
295 Ga0265338_10002491 3300028800 Bacteria 27482
296 Ga0265338_10010734 3300028800 Bacteria 10691
297 Ga0265324_10005410 3300029957 Bacteria 5519
298 Ga0265760_10023331 3300031090 Bacteria 1797
299 Ga0265325_10038636 3300031241 Bacteria 2518
300 Ga0265316_10038089 3300031344 Bacteria 3877
301 Ga0265313_10008995 3300031595 Bacteria 6550
302 Ga0307508_10181997 3300031616 Bacteria 1704
303 Ga0265342_10011537 3300031712 Bacteria 6039
304 Ga0373958_0000702 3300034819 Bacteria 4243
305 Ga0373938_0002427 3300034957 Bacteria 3005
306 Ga0373926_0000338 3300035083 Bacteria 11831
307 Ga0373926_0008176 3300035083 Bacteria 3483
308 Ga0373926_0036116 3300035083 Bacteria 1754
309 Ga0373929_0012997 3300035085 Bacteria 1590
310 Ga0373934_0002751 3300035086 Bacteria 6455
311 Ga0373934_0005659 3300035086 Bacteria 4628
312 Ga0373934_0009461 3300035086 Bacteria 3651
313 Ga0373934_0033902 3300035086 Bacteria 2005
314 Ga0373934_0089514 3300035086 Bacteria 1240
315 Ga0373940_0005533 3300035088 Bacteria 2743
316 Ga0373949_0014747 3300035090 Bacteria 1742
317 Ga0373951_0006077 3300035091 Bacteria 2775
318 Ga0373923_0016080 3300035111 Bacteria 2835
319 Ga0373923_0143768 3300035111 Bacteria 1079
320 Ga0373936_0011924 3300035113 Bacteria 3298
321 Ga0373936_0077167 3300035113 Bacteria 1381
322 Ga0373936_0097727 3300035113 Bacteria 1236
323 Ga0373945_0008784 3300035116 Bacteria 3298
324 Ga0373953_0000027 3300035117 Bacteria 39541
325 Ga0373953_0005416 3300035117 Bacteria 4141
326 Ga0373953_0061130 3300035117 Bacteria 1540
327 Ga0373953_0091118 3300035117 Bacteria 1275
328 Ga0373954_0002667 3300035118 Bacteria 7508
329 Ga0373954_0046215 3300035118 Bacteria 2035
330 Ga0373954_0087633 3300035118 Bacteria 1492
331 Ga0373954_0103078 3300035118 Bacteria 1378
332 Ga0373956_0003730 3300035119 Bacteria 6140
333 Ga0373956_0039909 3300035119 Bacteria 2081
334 Ga0373956_0051315 3300035119 Bacteria 1853
335 Ga0373956_0150830 3300035119 Bacteria 1094
336 Ga0373957_0000178 3300035120 Bacteria 16194
337 Ga0373957_0000855 3300035120 Bacteria 7968
338 Ga0373943_0007036 3300035170 Bacteria 5046
339 Ga0373943_0028150 3300035170 Bacteria 2646
340 Ga0373943_0057587 3300035170 Bacteria 1931
341 Ga0373946_0002230 3300035171 Bacteria 6837
342 Ga0373946_0040999 3300035171 Bacteria 1897
343 Ga0373955_0000277 3300035172 Bacteria 21420
344 Ga0373955_0003321 3300035172 Bacteria 7065
345 Ga0373955_0011489 3300035172 Bacteria 4223
346 Ga0373955_0011954 3300035172 Bacteria 4159
347 Ga0373955_0204464 3300035172 Bacteria 1176
348 Ga0373942_0014589 3300035207 Bacteria 1905
349 Ga0316574_0093274 3300035398 Bacteria 1922
350 Ga0373924_0000722 3300035410 Bacteria 10312
351 Ga0373924_0001566 3300035410 Bacteria 7478
352 Ga0373924_0018352 3300035410 Bacteria 2694
353 Ga0373924_0098473 3300035410 Bacteria 1256
354 Ga0373931_0005867 3300035691 Bacteria 5714
355 Ga0373931_0224919 3300035691 Bacteria 1131
356 Ga0373935_0004554 3300035692 Bacteria 8151
357 Ga0373935_0011484 3300035692 Bacteria 5316
358 Ga0373935_0017888 3300035692 Bacteria 4305
359 Ga0373933_0000056 3300035724 Bacteria 66983
360 Ga0373933_0011242 3300035724 Bacteria 4927
361 Ga0373933_0015508 3300035724 Bacteria 4249
362 Ga0373933_0017567 3300035724 Bacteria 4013
363 Ga0373933_0054262 3300035724 Bacteria 2401
364 Ga0373947_0000012 3300035725 Bacteria 155188
365 Ga0373947_0000109 3300035725 Bacteria 41040
366 Ga0373947_0007711 3300035725 Bacteria 6220
367 Ga0373937_0000152 3300036401 Bacteria 66956
368 Ga0373937_0007300 3300036401 Bacteria 9566
369 Ga0373937_0028368 3300036401 Bacteria 5064
370 Ga0373937_0172487 3300036401 Bacteria 2029
371 Ga0373937_0183687 3300036401 Bacteria 1964
372 Ga0373937_0207389 3300036401 Bacteria 1843
373 Ga0373937_0387389 3300036401 Bacteria 1326
374 Ga0373925_0000319 3300037068 Bacteria 50232
375 Ga0373925_0002082 3300037068 Bacteria 16451
376 Ga0373925_0004704 3300037068 Bacteria 10298
377 Ga0373925_0006462 3300037068 Bacteria 8623
378 Ga0373925_0023768 3300037068 Bacteria 4471
379 Ga0395905_0480055 3300037471 Bacteria 1142
380 Ga0436364_0045810 3300037853 Bacteria 51517
381 Ga0436364_0074751 3300037853 Bacteria 2044
382 Ga0436364_0560348 3300037853 Bacteria 12968
383 Ga0436364_0960361 3300037853 Bacteria 2823
384 Ga0436364_1388557 3300037853 Bacteria 1911
385 Ga0436365_0247847 3300039437 Bacteria 1835
386 Ga0436365_1837031 3300039437 Bacteria 1949
387 Ga0436363_1301976 3300039450 Bacteria 2192
388 Ga0436363_1374337 3300039450 Bacteria 1440
389 Ga0436362_0770758 3300039453 Bacteria 1928
390 Ga0450920_002111 3300042122 Bacteria 3357
391 Ga0450907_009958 3300042146 Bacteria 1576
392 Ga0466963_0061428 3300044694 Bacteria 2512
393 Ga0466967_0228890 3300045976 Bacteria 1769
394 Ga0495592_0000129 3300046454 Bacteria 66962
395 Ga0495592_0018006 3300046454 Bacteria 5366
396 Ga0495592_0101941 3300046454 Bacteria 2044
397 Ga0495592_0107423 3300046454 Bacteria 1979
398 Ga0495592_0226780 3300046454 Bacteria 1246
399 Ga0495603_0006306 3300046455 Bacteria 7094
400 Ga0495603_0055108 3300046455 Bacteria 2356
401 Ga0495629_0039097 3300046459 Bacteria 3339
402 Ga0495641_0003961 3300046461 Bacteria 10760
403 Ga0495641_0006421 3300046461 Bacteria 7622
404 Ga0495651_0000089 3300046462 Bacteria 66983
405 Ga0495653_0006178 3300046463 Bacteria 9825
406 Ga0495653_0013196 3300046463 Bacteria 6735
407 Ga0495653_0018397 3300046463 Bacteria 5674
408 Ga0495653_0084033 3300046463 Bacteria 2345
409 Ga0495580_0014361 3300046472 Bacteria 6007
410 Ga0495580_0019899 3300046472 Bacteria 4977
411 Ga0495582_0003442 3300046473 Bacteria 8921
412 Ga0495662_0006459 3300046476 Bacteria 5854
413 Ga0495664_0007818 3300046477 Bacteria 5950
414 Ga0495664_0023197 3300046477 Bacteria 3599
415 Ga0495664_0092039 3300046477 Bacteria 1823
416 Ga0495594_0030336 3300046499 Bacteria 2924
417 Ga0495608_0000086 3300046511 Bacteria 67464
418 Ga0495608_0003546 3300046511 Bacteria 11175
419 Ga0495608_0047479 3300046511 Bacteria 2854
420 Ga0495608_0064403 3300046511 Bacteria 2403
421 Ga0495618_0024625 3300046514 Bacteria 3728
422 Ga0495618_0134938 3300046514 Bacteria 1579
423 Ga0495628_0000590 3300046516 Bacteria 33418
424 Ga0495628_0021547 3300046516 Bacteria 5298
425 Ga0495628_0064060 3300046516 Bacteria 2878
426 Ga0495628_0116754 3300046516 Bacteria 2049
427 Ga0495663_0096064 3300046525 Bacteria 971
428 Ga0495666_0019640 3300046526 Bacteria 3352
429 Ga0495666_0030922 3300046526 Bacteria 2625
430 Ga0495652_0000221 3300046529 Bacteria 66315
431 Ga0495652_0006349 3300046529 Bacteria 11009
432 Ga0495652_0013290 3300046529 Bacteria 7409
433 Ga0495652_0031302 3300046529 Bacteria 4659
434 Ga0495652_0076250 3300046529 Bacteria 2781
435 Ga0495652_0140060 3300046529 Bacteria 1903
436 Ga0495665_0000985 3300046531 Bacteria 15100
437 Ga0495665_0084242 3300046531 Bacteria 1671
438 Ga0495640_0019259 3300046533 Bacteria 5041
439 Ga0495640_0023271 3300046533 Bacteria 4517
440 Ga0495640_0070064 3300046533 Bacteria 2357
441 Ga0495586_0010847 3300046535 Bacteria 4841
442 Ga0495586_0109946 3300046535 Bacteria 1533
443 Ga0495587_0000099 3300046536 Bacteria 67448
444 Ga0495587_0004516 3300046536 Bacteria 9144
445 Ga0495587_0014462 3300046536 Bacteria 4949
446 Ga0495587_0028622 3300046536 Bacteria 3387
447 Ga0495587_0034121 3300046536 Bacteria 3069
448 Ga0495587_0065030 3300046536 Bacteria 2130
449 Ga0495645_0012919 3300046543 Bacteria 5895
450 Ga0495645_0020506 3300046543 Bacteria 4771
451 Ga0495645_0109512 3300046543 Bacteria 1955
452 Ga0495645_0224481 3300046543 Bacteria 1261
453 Ga0495645_0269127 3300046543 Bacteria 1125
454 Ga0495645_0310280 3300046543 Bacteria 1027
455 Ga0495667_0000088 3300046559 Bacteria 66785
456 Ga0495667_0001780 3300046559 Bacteria 14290
457 Ga0495667_0003211 3300046559 Bacteria 10963
458 Ga0495667_0026313 3300046559 Bacteria 3920
459 Ga0495667_0038349 3300046559 Bacteria 3190
460 Ga0495667_0045786 3300046559 Bacteria 2894
461 Ga0495634_0008896 3300046642 Bacteria 7440
462 Ga0495634_0019680 3300046642 Bacteria 4793
463 Ga0495634_0063597 3300046642 Bacteria 2448
464 Ga0495634_0162497 3300046642 Bacteria 1407
465 Ga0495635_0015774 3300046663 Bacteria 5277
466 Ga0495635_0107727 3300046663 Bacteria 1903
467 Ga0495657_0000130 3300046675 Bacteria 66983
468 Ga0495657_0021780 3300046675 Bacteria 4597
469 Ga0495657_0041784 3300046675 Bacteria 3135
470 Ga0495657_0047694 3300046675 Bacteria 2894
471 Ga0495599_0000190 3300046678 Bacteria 40649
472 Ga0495599_0056812 3300046678 Bacteria 2449
473 Ga0495599_0080216 3300046678 Bacteria 2037
474 Ga0495599_0182392 3300046678 Bacteria 1293
475 Ga0495623_0000122 3300046679 Bacteria 47783
476 Ga0495623_0014657 3300046679 Bacteria 5070
477 Ga0495623_0017272 3300046679 Bacteria 4661
478 Ga0495623_0047270 3300046679 Bacteria 2731
479 Ga0495623_0116614 3300046679 Bacteria 1613
480 Ga0495646_0069815 3300046680 Bacteria 2071
481 Ga0495646_0097621 3300046680 Bacteria 1688
482 Ga0495647_0019753 3300046681 Bacteria 2412
483 Ga0495658_0003537 3300046683 Bacteria 7725
484 Ga0495613_0001071 3300046689 Bacteria 20866
485 Ga0495613_0012763 3300046689 Bacteria 6246
486 Ga0495613_0313114 3300046689 Bacteria 1084
487 Ga0495624_0006227 3300046690 Bacteria 8482
488 Ga0495624_0171631 3300046690 Bacteria 1323
489 Ga0495624_0279207 3300046690 Bacteria 1009
490 Ga0495600_0002668 3300046809 Bacteria 10314
491 Ga0495600_0005282 3300046809 Bacteria 7778
492 Ga0495600_0039229 3300046809 Bacteria 3083
493 Ga0495600_0096199 3300046809 Bacteria 1930
494 Ga0495581_0002243 3300047315 Bacteria 10870
495 Ga0495581_0008179 3300047315 Bacteria 6058
496 Ga0495604_0000117 3300047317 Bacteria 66983
497 Ga0495604_0003577 3300047317 Bacteria 12389
498 Ga0495604_0005122 3300047317 Bacteria 10375
499 Ga0495604_0106054 3300047317 Bacteria 2056
500 Ga0495674_0011662 3300047319 Bacteria 8289
501 Ga0495674_0026492 3300047319 Bacteria 5304
502 Ga0495676_0044684 3300047321 Bacteria 3613
503 Ga0495676_0127176 3300047321 Bacteria 1845
504 Ga0495680_0000345 3300047322 Bacteria 51772
505 Ga0495680_0009813 3300047322 Bacteria 8586
506 Ga0495680_0011717 3300047322 Bacteria 7745
507 Ga0495680_0012931 3300047322 Bacteria 7313
508 Ga0495680_0017499 3300047322 Bacteria 6117
509 Ga0495680_0026634 3300047322 Bacteria 4762
510 Ga0495680_0042620 3300047322 Bacteria 3599
511 Ga0495675_0003177 3300047444 Bacteria 9871
512 Ga0495675_0019590 3300047444 Bacteria 4298
513 Ga0495675_0026863 3300047444 Bacteria 3669
514 Ga0495675_0072996 3300047444 Bacteria 2164
515 Ga0495675_0076261 3300047444 Bacteria 2113
516 Ga0495684_0010188 3300047471 Bacteria 7271
517 Ga0495684_0012319 3300047471 Bacteria 6595
518 Ga0495684_0031930 3300047471 Bacteria 4042
519 Ga0495684_0044048 3300047471 Bacteria 3416
520 Ga0495593_0007011 3300047673 Bacteria 6607
521 Ga0495602_0000424 3300048088 Bacteria 39603
522 Ga0495602_0004402 3300048088 Bacteria 14700
523 Ga0495602_0044227 3300048088 Bacteria 4042
524 Ga0495602_0091081 3300048088 Bacteria 2530
525 Ga0495602_0131203 3300048088 Bacteria 1998
526 Ga0495614_0002390 3300048089 Bacteria 8348
527 Ga0495614_0005476 3300048089 Bacteria 5722
528 Ga0496102_0088203 3300048905 Bacteria 2867
529 Ga0496102_0128934 3300048905 Bacteria 2366
530 Ga0496104_0001373 3300048907 Bacteria 21053
531 Ga0496104_0047867 3300048907 Bacteria 4030
532 Ga0496104_0139311 3300048907 Bacteria 2331
533 Ga0496104_0244318 3300048907 Bacteria 1707
534 Ga0496105_0010341 3300048908 Bacteria 7337
535 Ga0496105_0040019 3300048908 Bacteria 3864
536 Ga0496105_0043021 3300048908 Bacteria 3725
537 Ga0496106_0010131 3300048909 Bacteria 6963
538 Ga0496106_0199883 3300048909 Bacteria 1591
539 Ga0496107_0080836 3300048910 Bacteria 2370
540 Ga0496107_0121384 3300048910 Bacteria 1925
541 Ga0496108_0000975 3300048911 Bacteria 22275
542 Ga0496108_0006124 3300048911 Bacteria 9734
543 Ga0496108_0122700 3300048911 Bacteria 2229
544 Ga0496108_0129060 3300048911 Bacteria 2172
545 Ga0496109_0030696 3300048912 Bacteria 4817
546 Ga0496109_0098977 3300048912 Bacteria 2704
547 Ga0496109_0388482 3300048912 Bacteria 1318
548 Ga0496109_0404983 3300048912 Bacteria 1289
549 Ga0496109_0458861 3300048912 Bacteria 1203
550 Ga0496110_0008562 3300048913 Bacteria 8236
551 Ga0496110_0025319 3300048913 Bacteria 5069
552 Ga0496111_0007769 3300048914 Bacteria 7061
553 Ga0496112_0003470 3300048915 Bacteria 13040
554 Ga0496112_0092905 3300048915 Bacteria 2987
555 Ga0496112_0269684 3300048915 Bacteria 1650
556 Ga0496113_0026171 3300048916 Bacteria 4168
557 Ga0496113_0032842 3300048916 Bacteria 3773
558 Ga0496113_0202012 3300048916 Bacteria 1580
559 Ga0496114_0011756 3300048917 Bacteria 7003
560 Ga0496115_0016813 3300048918 Bacteria 5577
561 Ga0496115_0032724 3300048918 Bacteria 4103
562 Ga0496115_0154018 3300048918 Bacteria 1898
563 Ga0496126_0156117 3300048929 Bacteria 1953
564 Ga0496126_0310706 3300048929 Bacteria 1298
565 Ga0501032_0013793 3300049569 Bacteria 5733
566 Ga0501032_0062818 3300049569 Bacteria 2488
567 Ga0501033_0050495 3300049570 Bacteria 3085
568 Ga0501033_0191948 3300049570 Bacteria 1461
569 Ga0501036_0016113 3300049572 Bacteria 6245
570 Ga0501036_0217446 3300049572 Bacteria 1605
571 Ga0501037_0227153 3300049573 Bacteria 1311
572 Ga0501038_0020639 3300049574 Bacteria 5921
573 Ga0501038_0088539 3300049574 Bacteria 2598
574 Ga0501039_0057716 3300049575 Bacteria 3006
575 Ga0501039_0140956 3300049575 Bacteria 1894
576 Ga0501039_0144156 3300049575 Bacteria 1871
577 Ga0501039_0314766 3300049575 Bacteria 1230
578 Ga0501040_0012680 3300049576 Bacteria 5529
579 Ga0501040_0058720 3300049576 Bacteria 2642
580 Ga0501040_0145722 3300049576 Bacteria 1669
581 Ga0501041_0002562 3300049577 Bacteria 10360
582 Ga0501041_0198526 3300049577 Bacteria 1257
583 Ga0501042_0004606 3300049578 Bacteria 8802
584 Ga0501042_0038387 3300049578 Bacteria 3402
585 Ga0501042_0083289 3300049578 Bacteria 2293
586 Ga0501042_0157253 3300049578 Bacteria 1640
587 Ga0501043_0002930 3300049579 Bacteria 14244
588 Ga0501043_0084400 3300049579 Bacteria 2496
589 Ga0501046_0038018 3300049580 Bacteria 3865
590 Ga0501046_0040071 3300049580 Bacteria 3745
591 Ga0501047_0334510 3300049581 Bacteria 1352
592 Ga0501048_0008430 3300049582 Bacteria 7793
593 Ga0501048_0031924 3300049582 Bacteria 3808
594 Ga0501048_0033189 3300049582 Bacteria 3730
595 Ga0501067_0100084 3300049583 Bacteria 1610
596 Ga0501068_0016970 3300049584 Bacteria 4206
597 Ga0501069_0026741 3300049585 Bacteria 3160
598 Ga0501070_0004275 3300049586 Bacteria 12284
599 Ga0501071_0007884 3300049587 Bacteria 7021
600 Ga0501071_0029685 3300049587 Bacteria 3861
601 Ga0501071_0032119 3300049587 Bacteria 3726
602 Ga0501072_0004315 3300049588 Bacteria 10796
603 Ga0501072_0023386 3300049588 Bacteria 4799
604 Ga0501072_0166277 3300049588 Bacteria 1760
605 Ga0501073_0017143 3300049589 Bacteria 5246
606 Ga0501073_0044478 3300049589 Bacteria 3129
607 Ga0501074_0100753 3300049590 Bacteria 2067
608 Ga0501074_0126400 3300049590 Bacteria 1829
609 Ga0501075_0013619 3300049591 Bacteria 5807
610 Ga0501075_0061361 3300049591 Bacteria 2833
611 Ga0501075_0078757 3300049591 Bacteria 2494
612 Ga0501076_0009978 3300049592 Bacteria 7021
613 Ga0501076_0025816 3300049592 Bacteria 4548
614 Ga0501076_0041341 3300049592 Bacteria 3626
615 Ga0501076_0278523 3300049592 Bacteria 1370
616 Ga0501077_0014637 3300049593 Bacteria 4930
617 Ga0501077_0052134 3300049593 Bacteria 2598
618 Ga0501079_0136862 3300049741 Bacteria 1907
619 Ga0501079_0168615 3300049741 Bacteria 1707
620 Ga0501079_0277648 3300049741 Bacteria 1310
621 Ga0501080_0008350 3300049742 Bacteria 9378
622 Ga0501080_0074487 3300049742 Bacteria 3158
623 Ga0501080_0113112 3300049742 Bacteria 2516
624 Ga0501081_0010570 3300049743 Bacteria 6027
625 Ga0501081_0042458 3300049743 Bacteria 3116
626 Ga0501081_0045473 3300049743 Bacteria 3014
627 Ga0501081_0193446 3300049743 Bacteria 1474
628 Ga0501083_0014432 3300049744 Bacteria 5522
629 Ga0501083_0223517 3300049744 Bacteria 1226
630 Ga0501035_0012285 3300049822 Bacteria 7915
631 Ga0501045_0017198 3300049824 Bacteria 5133
632 Ga0501045_0079023 3300049824 Bacteria 2425
633 Ga0501045_0122194 3300049824 Bacteria 1933
634 nmdc:mga05p37_13433_c1 3300050507 Bacteria 9815
635 nmdc:mga05p37_550051_c1 3300050507 Bacteria 1314
636 nmdc:mga08y16_69724_c1 3300050511 Bacteria 3665
637 nmdc:mga0n895_11679_c1 3300050512 Bacteria 7848
638 nmdc:mga0n895_159223_c1 3300050512 Bacteria 2289
639 nmdc:mga0n895_35802_c1 3300050512 Bacteria 4790
640 nmdc:mga0rr50_26444_c1 3300050513 Bacteria 4049
641 nmdc:mga0rr50_360_c1 3300050513 Bacteria 24800
642 nmdc:mga0rr50_7550_c1 3300050513 Bacteria 6715
643 nmdc:mga08x19_139398_c1 3300050514 Bacteria 1637
644 nmdc:mga08x19_24655_c1 3300050514 Bacteria 3742
645 nmdc:mga08x19_3815_c1 3300050514 Bacteria 8970
646 nmdc:mga0a205_18826_c1 3300050515 Bacteria 6500
647 nmdc:mga0a205_24802_c1 3300050515 Bacteria 5706
648 Ga0495601_0001538 3300053077 Bacteria 12746
649 Ga0495601_0076527 3300053077 Bacteria 2143
650 Ga0495612_0003598 3300053078 Bacteria 6425
651 Ga0495612_0038366 3300053078 Bacteria 1946
652 Ga0495612_0110602 3300053078 Bacteria 1175
653 Ga0495612_0146152 3300053078 Bacteria 1027
654 Ga0495595_0001168 3300053084 Bacteria 10181
655 Ga0495595_0032134 3300053084 Bacteria 2362
656 Ga0495595_0038899 3300053084 Bacteria 2169
657 Ga0495595_0150804 3300053084 Bacteria 1144
658 Ga0495619_0002859 3300053085 Bacteria 11244
659 Ga0495619_0032656 3300053085 Bacteria 3378
660 Ga0501084_0010845 3300054114 Bacteria 7548
661 Ga0501084_0021020 3300054114 Bacteria 5444
662 Ga0501084_0026845 3300054114 Bacteria 4810
663 Ga0501082_0111939 3300060353 Bacteria 2363
664 Ga0501082_0252138 3300060353 Bacteria 1536
665 Ga0466962_0051808 3300061719 Bacteria 1963
666 Ga0530510_0007545 3300061734 Bacteria 7576
667 Ga0530510_0030941 3300061734 Bacteria 3846
668 Ga0530510_0039595 3300061734 Bacteria 3403
669 2676479770 2675903059 Bacteria 8644972
670 Ga0207678_10199094
671 JGI25404J52841_10000398
672 Ga0070658_10006727
673 Ga0070658_10007493
674 Ga0070676_10351239
675 Ga0070683_100095482
676 Ga0070683_100284399
677 Ga0070690_100022486
678 Ga0070680_100098443
679 Ga0070680_100110586
680 Ga0070682_100037868
681 Ga0070682_100308805
682 Ga0068868_100147018
683 Ga0068868_100378941
684 Ga0070689_100047404
685 Ga0070691_10034550
686 Ga0070691_10084260
687 Ga0070687_100153364
688 Ga0070661_100238413
689 Ga0070692_10055715
690 Ga0070668_100114738
691 Ga0070675_100033222
692 Ga0070671_100244779
693 Ga0070673_100098201
694 Ga0070667_100112253
695 Ga0070709_10006011
696 Ga0070709_10035182
697 Ga0070709_10041597
698 Ga0070709_10335440
699 Ga0070714_100022125
700 Ga0070714_100068074
701 Ga0070714_100105493
702 Ga0070714_100180930
703 Ga0070714_100183072
704 Ga0070714_100443169
705 Ga0070713_100018274
706 Ga0070713_100130271
707 Ga0070713_100273965
708 Ga0070713_100328778
709 Ga0070710_10002884
710 Ga0070711_100063942
711 Ga0070711_100097676
712 Ga0070705_100215403
713 Ga0070708_100028053
714 Ga0070708_100052879
715 Ga0070708_100353281
716 Ga0070708_100594662
717 Ga0070663_100242030
718 Ga0070663_100339395
719 Ga0070678_100252806
720 Ga0070681_10210639
721 Ga0070681_10370948
722 Ga0068867_100061590
723 Ga0070685_10012773
724 Ga0070706_100003827
725 Ga0070706_100006264
726 Ga0070706_100008346
727 Ga0070706_100130554
728 Ga0070706_100147969
729 Ga0070707_100000596
730 Ga0070707_100011189
731 Ga0070707_100021466
732 Ga0070707_100025539
733 Ga0070707_100056960
734 Ga0070707_100067523
735 Ga0070707_100155466
736 Ga0070707_100295190
737 Ga0070698_100000272
738 Ga0070698_100000415
739 Ga0070698_100000997
740 Ga0070698_100003605
741 Ga0070698_100013860
742 Ga0070698_100028331
743 Ga0070698_100035486
744 Ga0070698_100093920
745 Ga0070698_100318580
746 Ga0070699_100088729
747 Ga0070679_100086043
748 Ga0070679_100579644
749 Ga0070684_100008234
750 Ga0070684_100026234
751 Ga0070684_100096180
752 Ga0070684_100229345
753 Ga0070697_100074348
754 Ga0070697_100201039
755 Ga0068853_100084552
756 Ga0068853_100270850
757 Ga0070672_100015514
758 Ga0070672_100430052
759 Ga0070696_100057788
760 Ga0070665_100174594
761 Ga0070665_100221691
762 Ga0070665_100422668
763 Ga0068855_100137800
764 Ga0070664_100126825
765 Ga0068857_100072535
766 Ga0068857_100326583
767 Ga0068854_100052623
768 Ga0068856_100121353
769 Ga0068856_100411945
770 Ga0070702_100121017
771 Ga0068864_100106489
772 Ga0068864_100270829
773 Ga0068864_100468157
774 Ga0068861_100246366
775 Ga0068870_10003577
776 Ga0068870_10006656
777 Ga0068863_100130514
778 Ga0068863_100145498
779 Ga0068858_100066920
780 Ga0068860_100115826
781 Ga0081455_10001397
782 Ga0081540_1000070
783 Ga0081540_1000255
784 Ga0070717_10011880
785 Ga0070717_10030716
786 Ga0070717_10040696
787 Ga0070717_10357081
788 Ga0070717_10469510
789 Ga0075363_100112466
790 Ga0070715_10003563
791 Ga0070716_100086062
792 Ga0070716_100110221
793 Ga0070716_100172751
794 Ga0070712_100001430
795 Ga0070712_100024741
796 Ga0070712_100029923
797 Ga0070712_100045889
798 Ga0070712_100138604
799 Ga0097621_100207432
800 Ga0068871_100060277
801 Ga0068871_100158580
802 Ga0075428_100065303
803 Ga0075433_10079779
804 Ga0075434_100116857
805 Ga0075434_100543344
806 Ga0075436_100023790
807 Ga0075436_100036516
808 Ga0075436_100038138
809 Ga0075436_100038908
810 Ga0075435_100010584
811 Ga0075435_100164107
812 Ga0099794_10056226
813 Ga0105251_10039771
814 Ga0111539_10030235
815 Ga0105245_10422077
816 Ga0105247_10109600
817 Ga0114129_10123228
818 Ga0105243_10190814
819 Ga0105242_10351222
820 Ga0105248_10835268
821 Ga0105237_10165429
822 Ga0105238_10108642
823 Ga0105239_10937086
824 Ga0105246_10030702
825 Ga0105246_10067203
826 Ga0157341_1002091
827 Ga0157338_1006338
828 Ga0157370_10053967
829 Ga0157370_10068763
830 Ga0157369_10025418
831 Ga0157369_10044576
832 Ga0157369_10069173
833 Ga0157369_10139462
834 Ga0157369_10272517
835 Ga0163162_10264431
836 Ga0163163_10032737
837 Ga0163163_10235243
838 Ga0163163_10488913
839 Ga0157380_10022765
840 Ga0157380_10328683
841 Ga0157377_10036512
842 Ga0157379_10101468
843 Ga0157376_10229016
844 Ga0157376_10314520
845 Ga0206354_10221321
846 Ga0206354_10324262
847 Ga0206353_11100521
848 Ga0206353_12026084
849 Ga0213875_10000158
850 Ga0213875_10124775
851 Ga0224712_10100834
852 Ga0207692_10001781
853 Ga0207692_10005925
854 Ga0207692_10040324
855 Ga0207692_10065417
856 Ga0207710_10015780
857 Ga0207688_10004276
858 Ga0207647_10051533
859 Ga0207647_10175835
860 Ga0207685_10103586
861 Ga0207699_10003184
862 Ga0207699_10006004
863 Ga0207699_10018224
864 Ga0207699_10060602
865 Ga0207645_10231042
866 Ga0207643_10001438
867 Ga0207705_10041110
868 Ga0207684_10000787
869 Ga0207684_10010320
870 Ga0207684_10020239
871 Ga0207684_10021790
872 Ga0207684_10042341
873 Ga0207684_10045578
874 Ga0207684_10086258
875 Ga0207654_10053639
876 Ga0207693_10003435
877 Ga0207693_10023877
878 Ga0207693_10037306
879 Ga0207693_10057348
880 Ga0207693_10058382
881 Ga0207663_10047249
882 Ga0207662_10022414
883 Ga0207657_10002750
884 Ga0207657_10022835
885 Ga0207649_10098987
886 Ga0207649_10193116
887 Ga0207652_10017047
888 Ga0207652_10105681
889 Ga0207646_10000500
890 Ga0207646_10001807
891 Ga0207646_10050063
892 Ga0207646_10054303
893 Ga0207646_10079695
894 Ga0207646_10091532
895 Ga0207646_10097284
896 Ga0207646_10104414
897 Ga0207646_10200449
898 Ga0207646_10266011
899 Ga0207646_10330249
900 Ga0207650_10004613
901 Ga0207659_10274453
902 Ga0207700_10012338
903 Ga0207700_10054264
904 Ga0207700_10103492
905 Ga0207700_10193018
906 Ga0207700_10230511
907 Ga0207700_10387648
908 Ga0207664_10001200
909 Ga0207664_10001575
910 Ga0207664_10001831
911 Ga0207664_10003267
912 Ga0207664_10012574
913 Ga0207664_10035385
914 Ga0207664_10204686
915 Ga0207664_10214649
916 Ga0207664_10215974
917 Ga0207664_10474070
918 Ga0207670_10028108
919 Ga0207704_10328385
920 Ga0207665_10002304
921 Ga0207665_10008798
922 Ga0207665_10016409
923 Ga0207665_10054765
924 Ga0207665_10315019
925 Ga0207691_10023010
926 Ga0207689_10002061
927 Ga0207661_10103120
928 Ga0207661_10131026
929 Ga0207679_10258460
930 Ga0207667_10127461
931 Ga0207651_10439907
932 Ga0207640_10074296
933 Ga0207677_10156536
934 Ga0207639_10141007
935 Ga0207678_10002282
936 Ga0207678_10005083
937 Ga0207708_10179810
938 Ga0207641_10256788
939 Ga0207648_10044100
940 Ga0207676_10054942
941 Ga0207676_10297162
942 Ga0207674_10013418
943 Ga0207674_10026006
944 Ga0207674_10029653
945 Ga0207674_10039601
946 Ga0207675_100009072
947 Ga0207683_10000774
948 Ga0207683_10097628
949 Ga0207683_10180711
950 Ga0207428_10372026
951 Ga0268266_10159905
952 Ga0268266_10266874
953 Ga0268265_10560615
954 Ga0268264_10296055
955 Ga0265337_1000057
956 Ga0265326_10003994
957 Ga0265319_1019198
958 Ga0265334_10000298
959 Ga0265318_10051173
960 Ga0265323_10014644
961 Ga0265322_10003954
962 Ga0265336_10003082
963 Ga0265336_10060799
964 Ga0265338_10002491
965 Ga0265338_10010734
966 Ga0265324_10005410
967 Ga0265760_10023331
968 Ga0265325_10038636
969 Ga0265316_10038089
970 Ga0265313_10008995
971 Ga0307508_10181997
972 Ga0265342_10011537
973 Ga0373958_0000702
974 Ga0373938_0002427
975 Ga0373926_0000338
976 Ga0373926_0008176
977 Ga0373926_0036116
978 Ga0373929_0012997
979 Ga0373934_0002751
980 Ga0373934_0005659
981 Ga0373934_0009461
982 Ga0373934_0033902
983 Ga0373934_0089514
984 Ga0373940_0005533
985 Ga0373949_0014747
986 Ga0373951_0006077
987 Ga0373923_0016080
988 Ga0373923_0143768
989 Ga0373936_0011924
990 Ga0373936_0077167
991 Ga0373936_0097727
992 Ga0373945_0008784
993 Ga0373953_0000027
994 Ga0373953_0005416
995 Ga0373953_0061130
996 Ga0373953_0091118
997 Ga0373954_0002667
998 Ga0373954_0046215
999 Ga0373954_0087633
1000 Ga0373954_0103078
1001 Ga0373956_0003730
1002 Ga0373956_0039909
1003 Ga0373956_0051315
1004 Ga0373956_0150830
1005 Ga0373957_0000178
1006 Ga0373957_0000855
1007 Ga0373943_0007036
1008 Ga0373943_0028150
1009 Ga0373943_0057587
1010 Ga0373946_0002230
1011 Ga0373946_0040999
1012 Ga0373955_0000277
1013 Ga0373955_0003321
1014 Ga0373955_0011489
1015 Ga0373955_0011954
1016 Ga0373955_0204464
1017 Ga0373942_0014589
1018 Ga0316574_0093274
1019 Ga0373924_0000722
1020 Ga0373924_0001566
1021 Ga0373924_0018352
1022 Ga0373924_0098473
1023 Ga0373931_0005867
1024 Ga0373931_0224919
1025 Ga0373935_0004554
1026 Ga0373935_0011484
1027 Ga0373935_0017888
1028 Ga0373933_0000056
1029 Ga0373933_0011242
1030 Ga0373933_0015508
1031 Ga0373933_0017567
1032 Ga0373933_0054262
1033 Ga0373947_0000012
1034 Ga0373947_0000109
1035 Ga0373947_0007711
1036 Ga0373937_0000152
1037 Ga0373937_0007300
1038 Ga0373937_0028368
1039 Ga0373937_0172487
1040 Ga0373937_0183687
1041 Ga0373937_0207389
1042 Ga0373937_0387389
1043 Ga0373925_0000319
1044 Ga0373925_0002082
1045 Ga0373925_0004704
1046 Ga0373925_0006462
1047 Ga0373925_0023768
1048 Ga0395905_0480055
1049 Ga0436364_0045810
1050 Ga0436364_0074751
1051 Ga0436364_0560348
1052 Ga0436364_0960361
1053 Ga0436364_1388557
1054 Ga0436365_0247847
1055 Ga0436365_1837031
1056 Ga0436363_1301976
1057 Ga0436363_1374337
1058 Ga0436362_0770758
1059 Ga0450920_002111
1060 Ga0450907_009958
1061 Ga0466963_0061428
1062 Ga0466967_0228890
1063 Ga0495592_0000129
1064 Ga0495592_0018006
1065 Ga0495592_0101941
1066 Ga0495592_0107423
1067 Ga0495592_0226780
1068 Ga0495603_0006306
1069 Ga0495603_0055108
1070 Ga0495629_0039097
1071 Ga0495641_0003961
1072 Ga0495641_0006421
1073 Ga0495651_0000089
1074 Ga0495653_0006178
1075 Ga0495653_0013196
1076 Ga0495653_0018397
1077 Ga0495653_0084033
1078 Ga0495580_0014361
1079 Ga0495580_0019899
1080 Ga0495582_0003442
1081 Ga0495662_0006459
1082 Ga0495664_0007818
1083 Ga0495664_0023197
1084 Ga0495664_0092039
1085 Ga0495594_0030336
1086 Ga0495608_0000086
1087 Ga0495608_0003546
1088 Ga0495608_0047479
1089 Ga0495608_0064403
1090 Ga0495618_0024625
1091 Ga0495618_0134938
1092 Ga0495628_0000590
1093 Ga0495628_0021547
1094 Ga0495628_0064060
1095 Ga0495628_0116754
1096 Ga0495663_0096064
1097 Ga0495666_0019640
1098 Ga0495666_0030922
1099 Ga0495652_0000221
1100 Ga0495652_0006349
1101 Ga0495652_0013290
1102 Ga0495652_0031302
1103 Ga0495652_0076250
1104 Ga0495652_0140060
1105 Ga0495665_0000985
1106 Ga0495665_0084242
1107 Ga0495640_0019259
1108 Ga0495640_0023271
1109 Ga0495640_0070064
1110 Ga0495586_0010847
1111 Ga0495586_0109946
1112 Ga0495587_0000099
1113 Ga0495587_0004516
1114 Ga0495587_0014462
1115 Ga0495587_0028622
1116 Ga0495587_0034121
1117 Ga0495587_0065030
1118 Ga0495645_0012919
1119 Ga0495645_0020506
1120 Ga0495645_0109512
1121 Ga0495645_0224481
1122 Ga0495645_0269127
1123 Ga0495645_0310280
1124 Ga0495667_0000088
1125 Ga0495667_0001780
1126 Ga0495667_0003211
1127 Ga0495667_0026313
1128 Ga0495667_0038349
1129 Ga0495667_0045786
1130 Ga0495634_0008896
1131 Ga0495634_0019680
1132 Ga0495634_0063597
1133 Ga0495634_0162497
1134 Ga0495635_0015774
1135 Ga0495635_0107727
1136 Ga0495657_0000130
1137 Ga0495657_0021780
1138 Ga0495657_0041784
1139 Ga0495657_0047694
1140 Ga0495599_0000190
1141 Ga0495599_0056812
1142 Ga0495599_0080216
1143 Ga0495599_0182392
1144 Ga0495623_0000122
1145 Ga0495623_0014657
1146 Ga0495623_0017272
1147 Ga0495623_0047270
1148 Ga0495623_0116614
1149 Ga0495646_0069815
1150 Ga0495646_0097621
1151 Ga0495647_0019753
1152 Ga0495658_0003537
1153 Ga0495613_0001071
1154 Ga0495613_0012763
1155 Ga0495613_0313114
1156 Ga0495624_0006227
1157 Ga0495624_0171631
1158 Ga0495624_0279207
1159 Ga0495600_0002668
1160 Ga0495600_0005282
1161 Ga0495600_0039229
1162 Ga0495600_0096199
1163 Ga0495581_0002243
1164 Ga0495581_0008179
1165 Ga0495604_0000117
1166 Ga0495604_0003577
1167 Ga0495604_0005122
1168 Ga0495604_0106054
1169 Ga0495674_0011662
1170 Ga0495674_0026492
1171 Ga0495676_0044684
1172 Ga0495676_0127176
1173 Ga0495680_0000345
1174 Ga0495680_0009813
1175 Ga0495680_0011717
1176 Ga0495680_0012931
1177 Ga0495680_0017499
1178 Ga0495680_0026634
1179 Ga0495680_0042620
1180 Ga0495675_0003177
1181 Ga0495675_0019590
1182 Ga0495675_0026863
1183 Ga0495675_0072996
1184 Ga0495675_0076261
1185 Ga0495684_0010188
1186 Ga0495684_0012319
1187 Ga0495684_0031930
1188 Ga0495684_0044048
1189 Ga0495593_0007011
1190 Ga0495602_0000424
1191 Ga0495602_0004402
1192 Ga0495602_0044227
1193 Ga0495602_0091081
1194 Ga0495602_0131203
1195 Ga0495614_0002390
1196 Ga0495614_0005476
1197 Ga0496102_0088203
1198 Ga0496102_0128934
1199 Ga0496104_0001373
1200 Ga0496104_0047867
1201 Ga0496104_0139311
1202 Ga0496104_0244318
1203 Ga0496105_0010341
1204 Ga0496105_0040019
1205 Ga0496105_0043021
1206 Ga0496106_0010131
1207 Ga0496106_0199883
1208 Ga0496107_0080836
1209 Ga0496107_0121384
1210 Ga0496108_0000975
1211 Ga0496108_0006124
1212 Ga0496108_0122700
1213 Ga0496108_0129060
1214 Ga0496109_0030696
1215 Ga0496109_0098977
1216 Ga0496109_0388482
1217 Ga0496109_0404983
1218 Ga0496109_0458861
1219 Ga0496110_0008562
1220 Ga0496110_0025319
1221 Ga0496111_0007769
1222 Ga0496112_0003470
1223 Ga0496112_0092905
1224 Ga0496112_0269684
1225 Ga0496113_0026171
1226 Ga0496113_0032842
1227 Ga0496113_0202012
1228 Ga0496114_0011756
1229 Ga0496115_0016813
1230 Ga0496115_0032724
1231 Ga0496115_0154018
1232 Ga0496126_0156117
1233 Ga0496126_0310706
1234 Ga0501032_0013793
1235 Ga0501032_0062818
1236 Ga0501033_0050495
1237 Ga0501033_0191948
1238 Ga0501036_0016113
1239 Ga0501036_0217446
1240 Ga0501037_0227153
1241 Ga0501038_0020639
1242 Ga0501038_0088539
1243 Ga0501039_0057716
1244 Ga0501039_0140956
1245 Ga0501039_0144156
1246 Ga0501039_0314766
1247 Ga0501040_0012680
1248 Ga0501040_0058720
1249 Ga0501040_0145722
1250 Ga0501041_0002562
1251 Ga0501041_0198526
1252 Ga0501042_0004606
1253 Ga0501042_0038387
1254 Ga0501042_0083289
1255 Ga0501042_0157253
1256 Ga0501043_0002930
1257 Ga0501043_0084400
1258 Ga0501046_0038018
1259 Ga0501046_0040071
1260 Ga0501047_0334510
1261 Ga0501048_0008430
1262 Ga0501048_0031924
1263 Ga0501048_0033189
1264 Ga0501067_0100084
1265 Ga0501068_0016970
1266 Ga0501069_0026741
1267 Ga0501070_0004275
1268 Ga0501071_0007884
1269 Ga0501071_0029685
1270 Ga0501071_0032119
1271 Ga0501072_0004315
1272 Ga0501072_0023386
1273 Ga0501072_0166277
1274 Ga0501073_0017143
1275 Ga0501073_0044478
1276 Ga0501074_0100753
1277 Ga0501074_0126400
1278 Ga0501075_0013619
1279 Ga0501075_0061361
1280 Ga0501075_0078757
1281 Ga0501076_0009978
1282 Ga0501076_0025816
1283 Ga0501076_0041341
1284 Ga0501076_0278523
1285 Ga0501077_0014637
1286 Ga0501077_0052134
1287 Ga0501079_0136862
1288 Ga0501079_0168615
1289 Ga0501079_0277648
1290 Ga0501080_0008350
1291 Ga0501080_0074487
1292 Ga0501080_0113112
1293 Ga0501081_0010570
1294 Ga0501081_0042458
1295 Ga0501081_0045473
1296 Ga0501081_0193446
1297 Ga0501083_0014432
1298 Ga0501083_0223517
1299 Ga0501035_0012285
1300 Ga0501045_0017198
1301 Ga0501045_0079023
1302 Ga0501045_0122194
1303 nmdc:mga05p37_13433_c1
1304 nmdc:mga05p37_550051_c1
1305 nmdc:mga08y16_69724_c1
1306 nmdc:mga0n895_11679_c1
1307 nmdc:mga0n895_159223_c1
1308 nmdc:mga0n895_35802_c1
1309 nmdc:mga0rr50_26444_c1
1310 nmdc:mga0rr50_360_c1
1311 nmdc:mga0rr50_7550_c1
1312 nmdc:mga08x19_139398_c1
1313 nmdc:mga08x19_24655_c1
1314 nmdc:mga08x19_3815_c1
1315 nmdc:mga0a205_18826_c1
1316 nmdc:mga0a205_24802_c1
1317 Ga0495601_0001538
1318 Ga0495601_0076527
1319 Ga0495612_0003598
1320 Ga0495612_0038366
1321 Ga0495612_0110602
1322 Ga0495612_0146152
1323 Ga0495595_0001168
1324 Ga0495595_0032134
1325 Ga0495595_0038899
1326 Ga0495595_0150804
1327 Ga0495619_0002859
1328 Ga0495619_0032656
1329 Ga0501084_0010845
1330 Ga0501084_0021020
1331 Ga0501084_0026845
1332 Ga0501082_0111939
1333 Ga0501082_0252138
1334 Ga0466962_0051808
1335 Ga0530510_0007545
1336 Ga0530510_0030941
1337 Ga0530510_0039595
1338 2676479770

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00809

Pterin_bind

Pterin binding enzyme

24

248

0.92

PF03599

CdhD

CO dehydrogenase/acetyl-CoA synthase delta subunit

43

207

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f6y-assembly1.cif.gz_B mad crystal structure analysis of methyltetrahydrofolate: corrinoid/iron-sulfur protein methyltransferase (metr) 0.94 21 269
2yck-assembly1.cif.gz_X methyltransferase bound with tetrahydrofolate 0.9398 17 269
1q85-assembly2.cif.gz_B cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+ complex, se-met) 0.9384 1 268
1q7q-assembly2.cif.gz_B cobalamin-dependent methionine synthase (1-566) from t. maritima (oxidized, orthorhombic) 0.9381 1 268
1q7q-assembly1.cif.gz_A cobalamin-dependent methionine synthase (1-566) from t. maritima (oxidized, orthorhombic) 0.9377 1 269
ID Description Score Start End Superfamily
1f6yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.94 21 269 3.20.20.20
1q8jB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.933 4 268 3.20.20.20
1q8jB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9258 4 268 3.20.20.20
4o1eB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.8914 18 273 3.20.20.20
1f6yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.891 21 269 3.20.20.20
ID Description Score Start End GO Terms
AF-A0A432H0E4-F1-model_v4 Methyltetrahydrofolate cobalamin methyltransferase 0.9832 2 178 GO:0005829
GO:0008705
GO:0032259
GO:0046653
GO:0046872
GO:0050667
AF-A0A383DDN4-F1-model_v4 Pterin-binding domain-containing protein 0.9797 1 139 GO:0005829
GO:0008705
GO:0032259
GO:0046653
GO:0046872
GO:0050667
AF-A0A316TLL8-F1-model_v4 Methyltetrahydrofolate--corrinoid methyltransferase 0.9778 1 274 GO:0005829
GO:0008705
GO:0032259
GO:0046653
GO:0046872
GO:0050667
AF-A0A3C1U407-F1-model_v4 Methyltetrahydrofolate--corrinoid methyltransferase 0.9767 2 243 GO:0005829
GO:0008705
GO:0032259
GO:0046653
GO:0046872
GO:0050667
AF-A0A7C2ITA9-F1-model_v4 deleted 0.9762 1 113

Map