F474015
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 669 | 295 | 1338 | 286 |
Family's Representative Sequence
| Representative Sequence | 3300026067|Ga0207678_10199094|Ga0207678_101990942 |
| Length | 328 |
| Sequence | MHTTISSPAKTVTIGHDQPFAIIGERINPTGRAKFQRQLRDGDLSRIEIDVAQQVAGGAMLLDVNMGAPLADEAELMVRAVTLIQGLTDLPLVIDSSIPAVLEAGLAAYQGKALVNSVTAEDERLHAILPLVKRYGAAVIGLPNDEEQIPDAPEERLALARKLIRTATDTYQIPIEDIVIDPLAMPVGADTGNTMRTLETLALVRDEFGVNTTLGASNLSFGMPDRHALTAAFLPLAAAHGLTSAIMDTRTPQVVTAARAADLLLGRDDWGAAWIAAFRAAKAAEQLSPAGTTLRTPRGMPALPDRRRGAGWRTEDAPQSPRHANRDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 70 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 83 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 95 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 138 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 142 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 143 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 144 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 147 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 149 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 153 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 156 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 158 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 159 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 160 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 161 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 162 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 164 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 166 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 167 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 168 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 169 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 172 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 177 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 178 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 181 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 185 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 186 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 187 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 188 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 189 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 190 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 191 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 192 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 193 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 238 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 239 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 240 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 241 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 242 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 245 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 246 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 247 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 248 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 249 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 250 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 251 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 294 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 295 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.95 |
| Metatranscriptomes | 0.9 |
| Isolates | 0.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.15 |
| Nodule | 0 |
| Rhizoplane | 5.23 |
| Rhizosphere | 92.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207678_10199094 | 3300026067 | Bacteria | 1712 |
| 2 | JGI25404J52841_10000398 | 3300003659 | Bacteria | 6005 |
| 3 | Ga0070658_10006727 | 3300005327 | Bacteria | 9314 |
| 4 | Ga0070658_10007493 | 3300005327 | Bacteria | 8806 |
| 5 | Ga0070676_10351239 | 3300005328 | Bacteria | 1014 |
| 6 | Ga0070683_100095482 | 3300005329 | Bacteria | 2795 |
| 7 | Ga0070683_100284399 | 3300005329 | Bacteria | 1573 |
| 8 | Ga0070690_100022486 | 3300005330 | Bacteria | 3857 |
| 9 | Ga0070680_100098443 | 3300005336 | Bacteria | 2426 |
| 10 | Ga0070680_100110586 | 3300005336 | Bacteria | 2287 |
| 11 | Ga0070682_100037868 | 3300005337 | Bacteria | 2955 |
| 12 | Ga0070682_100308805 | 3300005337 | Bacteria | 1163 |
| 13 | Ga0068868_100147018 | 3300005338 | Bacteria | 1939 |
| 14 | Ga0068868_100378941 | 3300005338 | Bacteria | 1217 |
| 15 | Ga0070689_100047404 | 3300005340 | Bacteria | 3314 |
| 16 | Ga0070691_10034550 | 3300005341 | Bacteria | 2380 |
| 17 | Ga0070691_10084260 | 3300005341 | Bacteria | 1560 |
| 18 | Ga0070687_100153364 | 3300005343 | Bacteria | 1354 |
| 19 | Ga0070661_100238413 | 3300005344 | Bacteria | 1400 |
| 20 | Ga0070692_10055715 | 3300005345 | Bacteria | 2068 |
| 21 | Ga0070668_100114738 | 3300005347 | Bacteria | 2147 |
| 22 | Ga0070675_100033222 | 3300005354 | Bacteria | 4181 |
| 23 | Ga0070671_100244779 | 3300005355 | Bacteria | 1522 |
| 24 | Ga0070673_100098201 | 3300005364 | Bacteria | 2406 |
| 25 | Ga0070667_100112253 | 3300005367 | Bacteria | 2364 |
| 26 | Ga0070709_10006011 | 3300005434 | Bacteria | 6598 |
| 27 | Ga0070709_10035182 | 3300005434 | Bacteria | 3042 |
| 28 | Ga0070709_10041597 | 3300005434 | Bacteria | 2832 |
| 29 | Ga0070709_10335440 | 3300005434 | Bacteria | 1113 |
| 30 | Ga0070714_100022125 | 3300005435 | Bacteria | 5210 |
| 31 | Ga0070714_100068074 | 3300005435 | Bacteria | 3071 |
| 32 | Ga0070714_100105493 | 3300005435 | Bacteria | 2488 |
| 33 | Ga0070714_100180930 | 3300005435 | Bacteria | 1918 |
| 34 | Ga0070714_100183072 | 3300005435 | Bacteria | 1907 |
| 35 | Ga0070714_100443169 | 3300005435 | Bacteria | 1233 |
| 36 | Ga0070713_100018274 | 3300005436 | Bacteria | 5329 |
| 37 | Ga0070713_100130271 | 3300005436 | Bacteria | 2217 |
| 38 | Ga0070713_100273965 | 3300005436 | Bacteria | 1546 |
| 39 | Ga0070713_100328778 | 3300005436 | Bacteria | 1413 |
| 40 | Ga0070710_10002884 | 3300005437 | Bacteria | 8191 |
| 41 | Ga0070711_100063942 | 3300005439 | Bacteria | 2569 |
| 42 | Ga0070711_100097676 | 3300005439 | Bacteria | 2130 |
| 43 | Ga0070705_100215403 | 3300005440 | Bacteria | 1326 |
| 44 | Ga0070708_100028053 | 3300005445 | Bacteria | 4840 |
| 45 | Ga0070708_100052879 | 3300005445 | Bacteria | 3602 |
| 46 | Ga0070708_100353281 | 3300005445 | Bacteria | 1385 |
| 47 | Ga0070708_100594662 | 3300005445 | Bacteria | 1043 |
| 48 | Ga0070663_100242030 | 3300005455 | Bacteria | 1424 |
| 49 | Ga0070663_100339395 | 3300005455 | Bacteria | 1213 |
| 50 | Ga0070678_100252806 | 3300005456 | Bacteria | 1478 |
| 51 | Ga0070681_10210639 | 3300005458 | Bacteria | 1860 |
| 52 | Ga0070681_10370948 | 3300005458 | Bacteria | 1342 |
| 53 | Ga0068867_100061590 | 3300005459 | Bacteria | 2786 |
| 54 | Ga0070685_10012773 | 3300005466 | Bacteria | 4417 |
| 55 | Ga0070706_100003827 | 3300005467 | Bacteria | 14708 |
| 56 | Ga0070706_100006264 | 3300005467 | Bacteria | 11256 |
| 57 | Ga0070706_100008346 | 3300005467 | Bacteria | 9648 |
| 58 | Ga0070706_100130554 | 3300005467 | Bacteria | 2344 |
| 59 | Ga0070706_100147969 | 3300005467 | Bacteria | 2193 |
| 60 | Ga0070707_100000596 | 3300005468 | Bacteria | 36368 |
| 61 | Ga0070707_100011189 | 3300005468 | Bacteria | 8363 |
| 62 | Ga0070707_100021466 | 3300005468 | Bacteria | 6103 |
| 63 | Ga0070707_100025539 | 3300005468 | Bacteria | 5605 |
| 64 | Ga0070707_100056960 | 3300005468 | Bacteria | 3749 |
| 65 | Ga0070707_100067523 | 3300005468 | Bacteria | 3440 |
| 66 | Ga0070707_100155466 | 3300005468 | Bacteria | 2228 |
| 67 | Ga0070707_100295190 | 3300005468 | Bacteria | 1575 |
| 68 | Ga0070698_100000272 | 3300005471 | Bacteria | 52507 |
| 69 | Ga0070698_100000415 | 3300005471 | Bacteria | 45479 |
| 70 | Ga0070698_100000997 | 3300005471 | Bacteria | 31180 |
| 71 | Ga0070698_100003605 | 3300005471 | Bacteria | 17018 |
| 72 | Ga0070698_100013860 | 3300005471 | Bacteria | 8524 |
| 73 | Ga0070698_100028331 | 3300005471 | Bacteria | 5819 |
| 74 | Ga0070698_100035486 | 3300005471 | Bacteria | 5156 |
| 75 | Ga0070698_100093920 | 3300005471 | Bacteria | 2979 |
| 76 | Ga0070698_100318580 | 3300005471 | Bacteria | 1486 |
| 77 | Ga0070699_100088729 | 3300005518 | Bacteria | 2701 |
| 78 | Ga0070679_100086043 | 3300005530 | Bacteria | 3130 |
| 79 | Ga0070679_100579644 | 3300005530 | Bacteria | 1065 |
| 80 | Ga0070684_100008234 | 3300005535 | Bacteria | 8146 |
| 81 | Ga0070684_100026234 | 3300005535 | Bacteria | 4906 |
| 82 | Ga0070684_100096180 | 3300005535 | Bacteria | 2640 |
| 83 | Ga0070684_100229345 | 3300005535 | Bacteria | 1695 |
| 84 | Ga0070697_100074348 | 3300005536 | Bacteria | 2792 |
| 85 | Ga0070697_100201039 | 3300005536 | Bacteria | 1694 |
| 86 | Ga0068853_100084552 | 3300005539 | Bacteria | 2780 |
| 87 | Ga0068853_100270850 | 3300005539 | Bacteria | 1563 |
| 88 | Ga0070672_100015514 | 3300005543 | Bacteria | 5427 |
| 89 | Ga0070672_100430052 | 3300005543 | Bacteria | 1135 |
| 90 | Ga0070696_100057788 | 3300005546 | Bacteria | 2708 |
| 91 | Ga0070665_100174594 | 3300005548 | Bacteria | 2150 |
| 92 | Ga0070665_100221691 | 3300005548 | Bacteria | 1891 |
| 93 | Ga0070665_100422668 | 3300005548 | Bacteria | 1341 |
| 94 | Ga0068855_100137800 | 3300005563 | Bacteria | 2783 |
| 95 | Ga0070664_100126825 | 3300005564 | Bacteria | 2239 |
| 96 | Ga0068857_100072535 | 3300005577 | Bacteria | 3068 |
| 97 | Ga0068857_100326583 | 3300005577 | Bacteria | 1417 |
| 98 | Ga0068854_100052623 | 3300005578 | Bacteria | 2921 |
| 99 | Ga0068856_100121353 | 3300005614 | Bacteria | 2615 |
| 100 | Ga0068856_100411945 | 3300005614 | Bacteria | 1371 |
| 101 | Ga0070702_100121017 | 3300005615 | Bacteria | 1639 |
| 102 | Ga0068864_100106489 | 3300005618 | Bacteria | 2493 |
| 103 | Ga0068864_100270829 | 3300005618 | Bacteria | 1582 |
| 104 | Ga0068864_100468157 | 3300005618 | Bacteria | 1208 |
| 105 | Ga0068861_100246366 | 3300005719 | Bacteria | 1522 |
| 106 | Ga0068870_10003577 | 3300005840 | Bacteria | 6589 |
| 107 | Ga0068870_10006656 | 3300005840 | Bacteria | 5107 |
| 108 | Ga0068863_100130514 | 3300005841 | Bacteria | 2399 |
| 109 | Ga0068863_100145498 | 3300005841 | Bacteria | 2266 |
| 110 | Ga0068858_100066920 | 3300005842 | Bacteria | 3326 |
| 111 | Ga0068860_100115826 | 3300005843 | Bacteria | 2563 |
| 112 | Ga0081455_10001397 | 3300005937 | Bacteria | 29816 |
| 113 | Ga0081540_1000070 | 3300005983 | Bacteria | 111392 |
| 114 | Ga0081540_1000255 | 3300005983 | Bacteria | 56347 |
| 115 | Ga0070717_10011880 | 3300006028 | Bacteria | 6627 |
| 116 | Ga0070717_10030716 | 3300006028 | Bacteria | 4316 |
| 117 | Ga0070717_10040696 | 3300006028 | Bacteria | 3787 |
| 118 | Ga0070717_10357081 | 3300006028 | Bacteria | 1307 |
| 119 | Ga0070717_10469510 | 3300006028 | Bacteria | 1135 |
| 120 | Ga0075363_100112466 | 3300006048 | Bacteria | 1514 |
| 121 | Ga0070715_10003563 | 3300006163 | Bacteria | 4985 |
| 122 | Ga0070716_100086062 | 3300006173 | Bacteria | 1890 |
| 123 | Ga0070716_100110221 | 3300006173 | Bacteria | 1704 |
| 124 | Ga0070716_100172751 | 3300006173 | Bacteria | 1412 |
| 125 | Ga0070712_100001430 | 3300006175 | Bacteria | 14559 |
| 126 | Ga0070712_100024741 | 3300006175 | Bacteria | 3983 |
| 127 | Ga0070712_100029923 | 3300006175 | Bacteria | 3654 |
| 128 | Ga0070712_100045889 | 3300006175 | Bacteria | 3019 |
| 129 | Ga0070712_100138604 | 3300006175 | Bacteria | 1853 |
| 130 | Ga0097621_100207432 | 3300006237 | Bacteria | 1703 |
| 131 | Ga0068871_100060277 | 3300006358 | Bacteria | 3095 |
| 132 | Ga0068871_100158580 | 3300006358 | Bacteria | 1934 |
| 133 | Ga0075428_100065303 | 3300006844 | Bacteria | 3985 |
| 134 | Ga0075433_10079779 | 3300006852 | Bacteria | 2884 |
| 135 | Ga0075434_100116857 | 3300006871 | Bacteria | 2680 |
| 136 | Ga0075434_100543344 | 3300006871 | Bacteria | 1182 |
| 137 | Ga0075436_100023790 | 3300006914 | Bacteria | 4209 |
| 138 | Ga0075436_100036516 | 3300006914 | Bacteria | 3391 |
| 139 | Ga0075436_100038138 | 3300006914 | Bacteria | 3317 |
| 140 | Ga0075436_100038908 | 3300006914 | Bacteria | 3282 |
| 141 | Ga0075435_100010584 | 3300007076 | Bacteria | 6750 |
| 142 | Ga0075435_100164107 | 3300007076 | Bacteria | 1872 |
| 143 | Ga0099794_10056226 | 3300007265 | Bacteria | 1903 |
| 144 | Ga0105251_10039771 | 3300009011 | Bacteria | 2295 |
| 145 | Ga0111539_10030235 | 3300009094 | Bacteria | 6586 |
| 146 | Ga0105245_10422077 | 3300009098 | Bacteria | 1337 |
| 147 | Ga0105247_10109600 | 3300009101 | Bacteria | 1775 |
| 148 | Ga0114129_10123228 | 3300009147 | Bacteria | 3566 |
| 149 | Ga0105243_10190814 | 3300009148 | Bacteria | 1790 |
| 150 | Ga0105242_10351222 | 3300009176 | Bacteria | 1362 |
| 151 | Ga0105248_10835268 | 3300009177 | Bacteria | 1040 |
| 152 | Ga0105237_10165429 | 3300009545 | Bacteria | 2211 |
| 153 | Ga0105238_10108642 | 3300009551 | Bacteria | 2755 |
| 154 | Ga0105239_10937086 | 3300010375 | Bacteria | 994 |
| 155 | Ga0105246_10030702 | 3300011119 | Bacteria | 3551 |
| 156 | Ga0105246_10067203 | 3300011119 | Bacteria | 2511 |
| 157 | Ga0157341_1002091 | 3300012494 | Bacteria | 1282 |
| 158 | Ga0157338_1006338 | 3300012515 | Bacteria | 1091 |
| 159 | Ga0157370_10053967 | 3300013104 | Bacteria | 3831 |
| 160 | Ga0157370_10068763 | 3300013104 | Bacteria | 3347 |
| 161 | Ga0157369_10025418 | 3300013105 | Bacteria | 6576 |
| 162 | Ga0157369_10044576 | 3300013105 | Bacteria | 4826 |
| 163 | Ga0157369_10069173 | 3300013105 | Bacteria | 3793 |
| 164 | Ga0157369_10139462 | 3300013105 | Bacteria | 2566 |
| 165 | Ga0157369_10272517 | 3300013105 | Bacteria | 1763 |
| 166 | Ga0163162_10264431 | 3300013306 | Bacteria | 1852 |
| 167 | Ga0163163_10032737 | 3300014325 | Bacteria | 5023 |
| 168 | Ga0163163_10235243 | 3300014325 | Bacteria | 1881 |
| 169 | Ga0163163_10488913 | 3300014325 | Bacteria | 1292 |
| 170 | Ga0157380_10022765 | 3300014326 | Bacteria | 4723 |
| 171 | Ga0157380_10328683 | 3300014326 | Bacteria | 1421 |
| 172 | Ga0157377_10036512 | 3300014745 | Bacteria | 2704 |
| 173 | Ga0157379_10101468 | 3300014968 | Bacteria | 2582 |
| 174 | Ga0157376_10229016 | 3300014969 | Bacteria | 1725 |
| 175 | Ga0157376_10314520 | 3300014969 | Bacteria | 1487 |
| 176 | Ga0206354_10221321 | 3300020081 | Bacteria | 3273 |
| 177 | Ga0206354_10324262 | 3300020081 | Bacteria | 2578 |
| 178 | Ga0206353_11100521 | 3300020082 | Bacteria | 2875 |
| 179 | Ga0206353_12026084 | 3300020082 | Bacteria | 2476 |
| 180 | Ga0213875_10000158 | 3300021388 | Bacteria | 71389 |
| 181 | Ga0213875_10124775 | 3300021388 | Bacteria | 1203 |
| 182 | Ga0224712_10100834 | 3300022467 | Bacteria | 1224 |
| 183 | Ga0207692_10001781 | 3300025898 | Bacteria | 8174 |
| 184 | Ga0207692_10005925 | 3300025898 | Bacteria | 4931 |
| 185 | Ga0207692_10040324 | 3300025898 | Bacteria | 2303 |
| 186 | Ga0207692_10065417 | 3300025898 | Bacteria | 1896 |
| 187 | Ga0207710_10015780 | 3300025900 | Bacteria | 3194 |
| 188 | Ga0207688_10004276 | 3300025901 | Bacteria | 7785 |
| 189 | Ga0207647_10051533 | 3300025904 | Bacteria | 2543 |
| 190 | Ga0207647_10175835 | 3300025904 | Bacteria | 1245 |
| 191 | Ga0207685_10103586 | 3300025905 | Bacteria | 1221 |
| 192 | Ga0207699_10003184 | 3300025906 | Bacteria | 7812 |
| 193 | Ga0207699_10006004 | 3300025906 | Bacteria | 5846 |
| 194 | Ga0207699_10018224 | 3300025906 | Bacteria | 3716 |
| 195 | Ga0207699_10060602 | 3300025906 | Bacteria | 2273 |
| 196 | Ga0207645_10231042 | 3300025907 | Bacteria | 1221 |
| 197 | Ga0207643_10001438 | 3300025908 | Bacteria | 13665 |
| 198 | Ga0207705_10041110 | 3300025909 | Bacteria | 3316 |
| 199 | Ga0207684_10000787 | 3300025910 | Bacteria | 36852 |
| 200 | Ga0207684_10010320 | 3300025910 | Bacteria | 8223 |
| 201 | Ga0207684_10020239 | 3300025910 | Bacteria | 5685 |
| 202 | Ga0207684_10021790 | 3300025910 | Bacteria | 5470 |
| 203 | Ga0207684_10042341 | 3300025910 | Bacteria | 3860 |
| 204 | Ga0207684_10045578 | 3300025910 | Bacteria | 3718 |
| 205 | Ga0207684_10086258 | 3300025910 | Bacteria | 2674 |
| 206 | Ga0207654_10053639 | 3300025911 | Bacteria | 2328 |
| 207 | Ga0207693_10003435 | 3300025915 | Bacteria | 13516 |
| 208 | Ga0207693_10023877 | 3300025915 | Bacteria | 4853 |
| 209 | Ga0207693_10037306 | 3300025915 | Bacteria | 3830 |
| 210 | Ga0207693_10057348 | 3300025915 | Bacteria | 3053 |
| 211 | Ga0207693_10058382 | 3300025915 | Bacteria | 3023 |
| 212 | Ga0207663_10047249 | 3300025916 | Bacteria | 2656 |
| 213 | Ga0207662_10022414 | 3300025918 | Bacteria | 3622 |
| 214 | Ga0207657_10002750 | 3300025919 | Bacteria | 18932 |
| 215 | Ga0207657_10022835 | 3300025919 | Bacteria | 5840 |
| 216 | Ga0207649_10098987 | 3300025920 | Bacteria | 1926 |
| 217 | Ga0207649_10193116 | 3300025920 | Bacteria | 1433 |
| 218 | Ga0207652_10017047 | 3300025921 | Bacteria | 5942 |
| 219 | Ga0207652_10105681 | 3300025921 | Bacteria | 2491 |
| 220 | Ga0207646_10000500 | 3300025922 | Bacteria | 52535 |
| 221 | Ga0207646_10001807 | 3300025922 | Bacteria | 25880 |
| 222 | Ga0207646_10050063 | 3300025922 | Bacteria | 3740 |
| 223 | Ga0207646_10054303 | 3300025922 | Bacteria | 3584 |
| 224 | Ga0207646_10079695 | 3300025922 | Bacteria | 2928 |
| 225 | Ga0207646_10091532 | 3300025922 | Bacteria | 2722 |
| 226 | Ga0207646_10097284 | 3300025922 | Bacteria | 2637 |
| 227 | Ga0207646_10104414 | 3300025922 | Bacteria | 2541 |
| 228 | Ga0207646_10200449 | 3300025922 | Bacteria | 1803 |
| 229 | Ga0207646_10266011 | 3300025922 | Bacteria | 1550 |
| 230 | Ga0207646_10330249 | 3300025922 | Bacteria | 1378 |
| 231 | Ga0207650_10004613 | 3300025925 | Bacteria | 9422 |
| 232 | Ga0207659_10274453 | 3300025926 | Bacteria | 1376 |
| 233 | Ga0207700_10012338 | 3300025928 | Bacteria | 5504 |
| 234 | Ga0207700_10054264 | 3300025928 | Bacteria | 3007 |
| 235 | Ga0207700_10103492 | 3300025928 | Bacteria | 2276 |
| 236 | Ga0207700_10193018 | 3300025928 | Bacteria | 1712 |
| 237 | Ga0207700_10230511 | 3300025928 | Bacteria | 1574 |
| 238 | Ga0207700_10387648 | 3300025928 | Bacteria | 1223 |
| 239 | Ga0207664_10001200 | 3300025929 | Bacteria | 17207 |
| 240 | Ga0207664_10001575 | 3300025929 | Bacteria | 14979 |
| 241 | Ga0207664_10001831 | 3300025929 | Bacteria | 14023 |
| 242 | Ga0207664_10003267 | 3300025929 | Bacteria | 10773 |
| 243 | Ga0207664_10012574 | 3300025929 | Bacteria | 6055 |
| 244 | Ga0207664_10035385 | 3300025929 | Bacteria | 3853 |
| 245 | Ga0207664_10204686 | 3300025929 | Bacteria | 1705 |
| 246 | Ga0207664_10214649 | 3300025929 | Bacteria | 1666 |
| 247 | Ga0207664_10215974 | 3300025929 | Bacteria | 1661 |
| 248 | Ga0207664_10474070 | 3300025929 | Bacteria | 1119 |
| 249 | Ga0207670_10028108 | 3300025936 | Bacteria | 3565 |
| 250 | Ga0207704_10328385 | 3300025938 | Bacteria | 1183 |
| 251 | Ga0207665_10002304 | 3300025939 | Bacteria | 12896 |
| 252 | Ga0207665_10008798 | 3300025939 | Bacteria | 6638 |
| 253 | Ga0207665_10016409 | 3300025939 | Bacteria | 4862 |
| 254 | Ga0207665_10054765 | 3300025939 | Bacteria | 2691 |
| 255 | Ga0207665_10315019 | 3300025939 | Bacteria | 1173 |
| 256 | Ga0207691_10023010 | 3300025940 | Bacteria | 5870 |
| 257 | Ga0207689_10002061 | 3300025942 | Bacteria | 18976 |
| 258 | Ga0207661_10103120 | 3300025944 | Bacteria | 2400 |
| 259 | Ga0207661_10131026 | 3300025944 | Bacteria | 2148 |
| 260 | Ga0207679_10258460 | 3300025945 | Bacteria | 1484 |
| 261 | Ga0207667_10127461 | 3300025949 | Bacteria | 2622 |
| 262 | Ga0207651_10439907 | 3300025960 | Bacteria | 1117 |
| 263 | Ga0207640_10074296 | 3300025981 | Bacteria | 2300 |
| 264 | Ga0207677_10156536 | 3300026023 | Bacteria | 1765 |
| 265 | Ga0207639_10141007 | 3300026041 | Bacteria | 2008 |
| 266 | Ga0207678_10002282 | 3300026067 | Bacteria | 17353 |
| 267 | Ga0207678_10005083 | 3300026067 | Bacteria | 11795 |
| 268 | Ga0207708_10179810 | 3300026075 | Bacteria | 1679 |
| 269 | Ga0207641_10256788 | 3300026088 | Bacteria | 1634 |
| 270 | Ga0207648_10044100 | 3300026089 | Bacteria | 3913 |
| 271 | Ga0207676_10054942 | 3300026095 | Bacteria | 3123 |
| 272 | Ga0207676_10297162 | 3300026095 | Bacteria | 1473 |
| 273 | Ga0207674_10013418 | 3300026116 | Bacteria | 9094 |
| 274 | Ga0207674_10026006 | 3300026116 | Bacteria | 6228 |
| 275 | Ga0207674_10029653 | 3300026116 | Bacteria | 5758 |
| 276 | Ga0207674_10039601 | 3300026116 | Bacteria | 4885 |
| 277 | Ga0207675_100009072 | 3300026118 | Bacteria | 9333 |
| 278 | Ga0207683_10000774 | 3300026121 | Bacteria | 29121 |
| 279 | Ga0207683_10097628 | 3300026121 | Bacteria | 2620 |
| 280 | Ga0207683_10180711 | 3300026121 | Bacteria | 1913 |
| 281 | Ga0207428_10372026 | 3300027907 | Bacteria | 1049 |
| 282 | Ga0268266_10159905 | 3300028379 | Bacteria | 2037 |
| 283 | Ga0268266_10266874 | 3300028379 | Bacteria | 1588 |
| 284 | Ga0268265_10560615 | 3300028380 | Bacteria | 1086 |
| 285 | Ga0268264_10296055 | 3300028381 | Bacteria | 1521 |
| 286 | Ga0265337_1000057 | 3300028556 | Bacteria | 51000 |
| 287 | Ga0265326_10003994 | 3300028558 | Bacteria | 4775 |
| 288 | Ga0265319_1019198 | 3300028563 | Bacteria | 2558 |
| 289 | Ga0265334_10000298 | 3300028573 | Bacteria | 27757 |
| 290 | Ga0265318_10051173 | 3300028577 | Bacteria | 1551 |
| 291 | Ga0265323_10014644 | 3300028653 | Bacteria | 3098 |
| 292 | Ga0265322_10003954 | 3300028654 | Bacteria | 4441 |
| 293 | Ga0265336_10003082 | 3300028666 | Bacteria | 6639 |
| 294 | Ga0265336_10060799 | 3300028666 | Bacteria | 1133 |
| 295 | Ga0265338_10002491 | 3300028800 | Bacteria | 27482 |
| 296 | Ga0265338_10010734 | 3300028800 | Bacteria | 10691 |
| 297 | Ga0265324_10005410 | 3300029957 | Bacteria | 5519 |
| 298 | Ga0265760_10023331 | 3300031090 | Bacteria | 1797 |
| 299 | Ga0265325_10038636 | 3300031241 | Bacteria | 2518 |
| 300 | Ga0265316_10038089 | 3300031344 | Bacteria | 3877 |
| 301 | Ga0265313_10008995 | 3300031595 | Bacteria | 6550 |
| 302 | Ga0307508_10181997 | 3300031616 | Bacteria | 1704 |
| 303 | Ga0265342_10011537 | 3300031712 | Bacteria | 6039 |
| 304 | Ga0373958_0000702 | 3300034819 | Bacteria | 4243 |
| 305 | Ga0373938_0002427 | 3300034957 | Bacteria | 3005 |
| 306 | Ga0373926_0000338 | 3300035083 | Bacteria | 11831 |
| 307 | Ga0373926_0008176 | 3300035083 | Bacteria | 3483 |
| 308 | Ga0373926_0036116 | 3300035083 | Bacteria | 1754 |
| 309 | Ga0373929_0012997 | 3300035085 | Bacteria | 1590 |
| 310 | Ga0373934_0002751 | 3300035086 | Bacteria | 6455 |
| 311 | Ga0373934_0005659 | 3300035086 | Bacteria | 4628 |
| 312 | Ga0373934_0009461 | 3300035086 | Bacteria | 3651 |
| 313 | Ga0373934_0033902 | 3300035086 | Bacteria | 2005 |
| 314 | Ga0373934_0089514 | 3300035086 | Bacteria | 1240 |
| 315 | Ga0373940_0005533 | 3300035088 | Bacteria | 2743 |
| 316 | Ga0373949_0014747 | 3300035090 | Bacteria | 1742 |
| 317 | Ga0373951_0006077 | 3300035091 | Bacteria | 2775 |
| 318 | Ga0373923_0016080 | 3300035111 | Bacteria | 2835 |
| 319 | Ga0373923_0143768 | 3300035111 | Bacteria | 1079 |
| 320 | Ga0373936_0011924 | 3300035113 | Bacteria | 3298 |
| 321 | Ga0373936_0077167 | 3300035113 | Bacteria | 1381 |
| 322 | Ga0373936_0097727 | 3300035113 | Bacteria | 1236 |
| 323 | Ga0373945_0008784 | 3300035116 | Bacteria | 3298 |
| 324 | Ga0373953_0000027 | 3300035117 | Bacteria | 39541 |
| 325 | Ga0373953_0005416 | 3300035117 | Bacteria | 4141 |
| 326 | Ga0373953_0061130 | 3300035117 | Bacteria | 1540 |
| 327 | Ga0373953_0091118 | 3300035117 | Bacteria | 1275 |
| 328 | Ga0373954_0002667 | 3300035118 | Bacteria | 7508 |
| 329 | Ga0373954_0046215 | 3300035118 | Bacteria | 2035 |
| 330 | Ga0373954_0087633 | 3300035118 | Bacteria | 1492 |
| 331 | Ga0373954_0103078 | 3300035118 | Bacteria | 1378 |
| 332 | Ga0373956_0003730 | 3300035119 | Bacteria | 6140 |
| 333 | Ga0373956_0039909 | 3300035119 | Bacteria | 2081 |
| 334 | Ga0373956_0051315 | 3300035119 | Bacteria | 1853 |
| 335 | Ga0373956_0150830 | 3300035119 | Bacteria | 1094 |
| 336 | Ga0373957_0000178 | 3300035120 | Bacteria | 16194 |
| 337 | Ga0373957_0000855 | 3300035120 | Bacteria | 7968 |
| 338 | Ga0373943_0007036 | 3300035170 | Bacteria | 5046 |
| 339 | Ga0373943_0028150 | 3300035170 | Bacteria | 2646 |
| 340 | Ga0373943_0057587 | 3300035170 | Bacteria | 1931 |
| 341 | Ga0373946_0002230 | 3300035171 | Bacteria | 6837 |
| 342 | Ga0373946_0040999 | 3300035171 | Bacteria | 1897 |
| 343 | Ga0373955_0000277 | 3300035172 | Bacteria | 21420 |
| 344 | Ga0373955_0003321 | 3300035172 | Bacteria | 7065 |
| 345 | Ga0373955_0011489 | 3300035172 | Bacteria | 4223 |
| 346 | Ga0373955_0011954 | 3300035172 | Bacteria | 4159 |
| 347 | Ga0373955_0204464 | 3300035172 | Bacteria | 1176 |
| 348 | Ga0373942_0014589 | 3300035207 | Bacteria | 1905 |
| 349 | Ga0316574_0093274 | 3300035398 | Bacteria | 1922 |
| 350 | Ga0373924_0000722 | 3300035410 | Bacteria | 10312 |
| 351 | Ga0373924_0001566 | 3300035410 | Bacteria | 7478 |
| 352 | Ga0373924_0018352 | 3300035410 | Bacteria | 2694 |
| 353 | Ga0373924_0098473 | 3300035410 | Bacteria | 1256 |
| 354 | Ga0373931_0005867 | 3300035691 | Bacteria | 5714 |
| 355 | Ga0373931_0224919 | 3300035691 | Bacteria | 1131 |
| 356 | Ga0373935_0004554 | 3300035692 | Bacteria | 8151 |
| 357 | Ga0373935_0011484 | 3300035692 | Bacteria | 5316 |
| 358 | Ga0373935_0017888 | 3300035692 | Bacteria | 4305 |
| 359 | Ga0373933_0000056 | 3300035724 | Bacteria | 66983 |
| 360 | Ga0373933_0011242 | 3300035724 | Bacteria | 4927 |
| 361 | Ga0373933_0015508 | 3300035724 | Bacteria | 4249 |
| 362 | Ga0373933_0017567 | 3300035724 | Bacteria | 4013 |
| 363 | Ga0373933_0054262 | 3300035724 | Bacteria | 2401 |
| 364 | Ga0373947_0000012 | 3300035725 | Bacteria | 155188 |
| 365 | Ga0373947_0000109 | 3300035725 | Bacteria | 41040 |
| 366 | Ga0373947_0007711 | 3300035725 | Bacteria | 6220 |
| 367 | Ga0373937_0000152 | 3300036401 | Bacteria | 66956 |
| 368 | Ga0373937_0007300 | 3300036401 | Bacteria | 9566 |
| 369 | Ga0373937_0028368 | 3300036401 | Bacteria | 5064 |
| 370 | Ga0373937_0172487 | 3300036401 | Bacteria | 2029 |
| 371 | Ga0373937_0183687 | 3300036401 | Bacteria | 1964 |
| 372 | Ga0373937_0207389 | 3300036401 | Bacteria | 1843 |
| 373 | Ga0373937_0387389 | 3300036401 | Bacteria | 1326 |
| 374 | Ga0373925_0000319 | 3300037068 | Bacteria | 50232 |
| 375 | Ga0373925_0002082 | 3300037068 | Bacteria | 16451 |
| 376 | Ga0373925_0004704 | 3300037068 | Bacteria | 10298 |
| 377 | Ga0373925_0006462 | 3300037068 | Bacteria | 8623 |
| 378 | Ga0373925_0023768 | 3300037068 | Bacteria | 4471 |
| 379 | Ga0395905_0480055 | 3300037471 | Bacteria | 1142 |
| 380 | Ga0436364_0045810 | 3300037853 | Bacteria | 51517 |
| 381 | Ga0436364_0074751 | 3300037853 | Bacteria | 2044 |
| 382 | Ga0436364_0560348 | 3300037853 | Bacteria | 12968 |
| 383 | Ga0436364_0960361 | 3300037853 | Bacteria | 2823 |
| 384 | Ga0436364_1388557 | 3300037853 | Bacteria | 1911 |
| 385 | Ga0436365_0247847 | 3300039437 | Bacteria | 1835 |
| 386 | Ga0436365_1837031 | 3300039437 | Bacteria | 1949 |
| 387 | Ga0436363_1301976 | 3300039450 | Bacteria | 2192 |
| 388 | Ga0436363_1374337 | 3300039450 | Bacteria | 1440 |
| 389 | Ga0436362_0770758 | 3300039453 | Bacteria | 1928 |
| 390 | Ga0450920_002111 | 3300042122 | Bacteria | 3357 |
| 391 | Ga0450907_009958 | 3300042146 | Bacteria | 1576 |
| 392 | Ga0466963_0061428 | 3300044694 | Bacteria | 2512 |
| 393 | Ga0466967_0228890 | 3300045976 | Bacteria | 1769 |
| 394 | Ga0495592_0000129 | 3300046454 | Bacteria | 66962 |
| 395 | Ga0495592_0018006 | 3300046454 | Bacteria | 5366 |
| 396 | Ga0495592_0101941 | 3300046454 | Bacteria | 2044 |
| 397 | Ga0495592_0107423 | 3300046454 | Bacteria | 1979 |
| 398 | Ga0495592_0226780 | 3300046454 | Bacteria | 1246 |
| 399 | Ga0495603_0006306 | 3300046455 | Bacteria | 7094 |
| 400 | Ga0495603_0055108 | 3300046455 | Bacteria | 2356 |
| 401 | Ga0495629_0039097 | 3300046459 | Bacteria | 3339 |
| 402 | Ga0495641_0003961 | 3300046461 | Bacteria | 10760 |
| 403 | Ga0495641_0006421 | 3300046461 | Bacteria | 7622 |
| 404 | Ga0495651_0000089 | 3300046462 | Bacteria | 66983 |
| 405 | Ga0495653_0006178 | 3300046463 | Bacteria | 9825 |
| 406 | Ga0495653_0013196 | 3300046463 | Bacteria | 6735 |
| 407 | Ga0495653_0018397 | 3300046463 | Bacteria | 5674 |
| 408 | Ga0495653_0084033 | 3300046463 | Bacteria | 2345 |
| 409 | Ga0495580_0014361 | 3300046472 | Bacteria | 6007 |
| 410 | Ga0495580_0019899 | 3300046472 | Bacteria | 4977 |
| 411 | Ga0495582_0003442 | 3300046473 | Bacteria | 8921 |
| 412 | Ga0495662_0006459 | 3300046476 | Bacteria | 5854 |
| 413 | Ga0495664_0007818 | 3300046477 | Bacteria | 5950 |
| 414 | Ga0495664_0023197 | 3300046477 | Bacteria | 3599 |
| 415 | Ga0495664_0092039 | 3300046477 | Bacteria | 1823 |
| 416 | Ga0495594_0030336 | 3300046499 | Bacteria | 2924 |
| 417 | Ga0495608_0000086 | 3300046511 | Bacteria | 67464 |
| 418 | Ga0495608_0003546 | 3300046511 | Bacteria | 11175 |
| 419 | Ga0495608_0047479 | 3300046511 | Bacteria | 2854 |
| 420 | Ga0495608_0064403 | 3300046511 | Bacteria | 2403 |
| 421 | Ga0495618_0024625 | 3300046514 | Bacteria | 3728 |
| 422 | Ga0495618_0134938 | 3300046514 | Bacteria | 1579 |
| 423 | Ga0495628_0000590 | 3300046516 | Bacteria | 33418 |
| 424 | Ga0495628_0021547 | 3300046516 | Bacteria | 5298 |
| 425 | Ga0495628_0064060 | 3300046516 | Bacteria | 2878 |
| 426 | Ga0495628_0116754 | 3300046516 | Bacteria | 2049 |
| 427 | Ga0495663_0096064 | 3300046525 | Bacteria | 971 |
| 428 | Ga0495666_0019640 | 3300046526 | Bacteria | 3352 |
| 429 | Ga0495666_0030922 | 3300046526 | Bacteria | 2625 |
| 430 | Ga0495652_0000221 | 3300046529 | Bacteria | 66315 |
| 431 | Ga0495652_0006349 | 3300046529 | Bacteria | 11009 |
| 432 | Ga0495652_0013290 | 3300046529 | Bacteria | 7409 |
| 433 | Ga0495652_0031302 | 3300046529 | Bacteria | 4659 |
| 434 | Ga0495652_0076250 | 3300046529 | Bacteria | 2781 |
| 435 | Ga0495652_0140060 | 3300046529 | Bacteria | 1903 |
| 436 | Ga0495665_0000985 | 3300046531 | Bacteria | 15100 |
| 437 | Ga0495665_0084242 | 3300046531 | Bacteria | 1671 |
| 438 | Ga0495640_0019259 | 3300046533 | Bacteria | 5041 |
| 439 | Ga0495640_0023271 | 3300046533 | Bacteria | 4517 |
| 440 | Ga0495640_0070064 | 3300046533 | Bacteria | 2357 |
| 441 | Ga0495586_0010847 | 3300046535 | Bacteria | 4841 |
| 442 | Ga0495586_0109946 | 3300046535 | Bacteria | 1533 |
| 443 | Ga0495587_0000099 | 3300046536 | Bacteria | 67448 |
| 444 | Ga0495587_0004516 | 3300046536 | Bacteria | 9144 |
| 445 | Ga0495587_0014462 | 3300046536 | Bacteria | 4949 |
| 446 | Ga0495587_0028622 | 3300046536 | Bacteria | 3387 |
| 447 | Ga0495587_0034121 | 3300046536 | Bacteria | 3069 |
| 448 | Ga0495587_0065030 | 3300046536 | Bacteria | 2130 |
| 449 | Ga0495645_0012919 | 3300046543 | Bacteria | 5895 |
| 450 | Ga0495645_0020506 | 3300046543 | Bacteria | 4771 |
| 451 | Ga0495645_0109512 | 3300046543 | Bacteria | 1955 |
| 452 | Ga0495645_0224481 | 3300046543 | Bacteria | 1261 |
| 453 | Ga0495645_0269127 | 3300046543 | Bacteria | 1125 |
| 454 | Ga0495645_0310280 | 3300046543 | Bacteria | 1027 |
| 455 | Ga0495667_0000088 | 3300046559 | Bacteria | 66785 |
| 456 | Ga0495667_0001780 | 3300046559 | Bacteria | 14290 |
| 457 | Ga0495667_0003211 | 3300046559 | Bacteria | 10963 |
| 458 | Ga0495667_0026313 | 3300046559 | Bacteria | 3920 |
| 459 | Ga0495667_0038349 | 3300046559 | Bacteria | 3190 |
| 460 | Ga0495667_0045786 | 3300046559 | Bacteria | 2894 |
| 461 | Ga0495634_0008896 | 3300046642 | Bacteria | 7440 |
| 462 | Ga0495634_0019680 | 3300046642 | Bacteria | 4793 |
| 463 | Ga0495634_0063597 | 3300046642 | Bacteria | 2448 |
| 464 | Ga0495634_0162497 | 3300046642 | Bacteria | 1407 |
| 465 | Ga0495635_0015774 | 3300046663 | Bacteria | 5277 |
| 466 | Ga0495635_0107727 | 3300046663 | Bacteria | 1903 |
| 467 | Ga0495657_0000130 | 3300046675 | Bacteria | 66983 |
| 468 | Ga0495657_0021780 | 3300046675 | Bacteria | 4597 |
| 469 | Ga0495657_0041784 | 3300046675 | Bacteria | 3135 |
| 470 | Ga0495657_0047694 | 3300046675 | Bacteria | 2894 |
| 471 | Ga0495599_0000190 | 3300046678 | Bacteria | 40649 |
| 472 | Ga0495599_0056812 | 3300046678 | Bacteria | 2449 |
| 473 | Ga0495599_0080216 | 3300046678 | Bacteria | 2037 |
| 474 | Ga0495599_0182392 | 3300046678 | Bacteria | 1293 |
| 475 | Ga0495623_0000122 | 3300046679 | Bacteria | 47783 |
| 476 | Ga0495623_0014657 | 3300046679 | Bacteria | 5070 |
| 477 | Ga0495623_0017272 | 3300046679 | Bacteria | 4661 |
| 478 | Ga0495623_0047270 | 3300046679 | Bacteria | 2731 |
| 479 | Ga0495623_0116614 | 3300046679 | Bacteria | 1613 |
| 480 | Ga0495646_0069815 | 3300046680 | Bacteria | 2071 |
| 481 | Ga0495646_0097621 | 3300046680 | Bacteria | 1688 |
| 482 | Ga0495647_0019753 | 3300046681 | Bacteria | 2412 |
| 483 | Ga0495658_0003537 | 3300046683 | Bacteria | 7725 |
| 484 | Ga0495613_0001071 | 3300046689 | Bacteria | 20866 |
| 485 | Ga0495613_0012763 | 3300046689 | Bacteria | 6246 |
| 486 | Ga0495613_0313114 | 3300046689 | Bacteria | 1084 |
| 487 | Ga0495624_0006227 | 3300046690 | Bacteria | 8482 |
| 488 | Ga0495624_0171631 | 3300046690 | Bacteria | 1323 |
| 489 | Ga0495624_0279207 | 3300046690 | Bacteria | 1009 |
| 490 | Ga0495600_0002668 | 3300046809 | Bacteria | 10314 |
| 491 | Ga0495600_0005282 | 3300046809 | Bacteria | 7778 |
| 492 | Ga0495600_0039229 | 3300046809 | Bacteria | 3083 |
| 493 | Ga0495600_0096199 | 3300046809 | Bacteria | 1930 |
| 494 | Ga0495581_0002243 | 3300047315 | Bacteria | 10870 |
| 495 | Ga0495581_0008179 | 3300047315 | Bacteria | 6058 |
| 496 | Ga0495604_0000117 | 3300047317 | Bacteria | 66983 |
| 497 | Ga0495604_0003577 | 3300047317 | Bacteria | 12389 |
| 498 | Ga0495604_0005122 | 3300047317 | Bacteria | 10375 |
| 499 | Ga0495604_0106054 | 3300047317 | Bacteria | 2056 |
| 500 | Ga0495674_0011662 | 3300047319 | Bacteria | 8289 |
| 501 | Ga0495674_0026492 | 3300047319 | Bacteria | 5304 |
| 502 | Ga0495676_0044684 | 3300047321 | Bacteria | 3613 |
| 503 | Ga0495676_0127176 | 3300047321 | Bacteria | 1845 |
| 504 | Ga0495680_0000345 | 3300047322 | Bacteria | 51772 |
| 505 | Ga0495680_0009813 | 3300047322 | Bacteria | 8586 |
| 506 | Ga0495680_0011717 | 3300047322 | Bacteria | 7745 |
| 507 | Ga0495680_0012931 | 3300047322 | Bacteria | 7313 |
| 508 | Ga0495680_0017499 | 3300047322 | Bacteria | 6117 |
| 509 | Ga0495680_0026634 | 3300047322 | Bacteria | 4762 |
| 510 | Ga0495680_0042620 | 3300047322 | Bacteria | 3599 |
| 511 | Ga0495675_0003177 | 3300047444 | Bacteria | 9871 |
| 512 | Ga0495675_0019590 | 3300047444 | Bacteria | 4298 |
| 513 | Ga0495675_0026863 | 3300047444 | Bacteria | 3669 |
| 514 | Ga0495675_0072996 | 3300047444 | Bacteria | 2164 |
| 515 | Ga0495675_0076261 | 3300047444 | Bacteria | 2113 |
| 516 | Ga0495684_0010188 | 3300047471 | Bacteria | 7271 |
| 517 | Ga0495684_0012319 | 3300047471 | Bacteria | 6595 |
| 518 | Ga0495684_0031930 | 3300047471 | Bacteria | 4042 |
| 519 | Ga0495684_0044048 | 3300047471 | Bacteria | 3416 |
| 520 | Ga0495593_0007011 | 3300047673 | Bacteria | 6607 |
| 521 | Ga0495602_0000424 | 3300048088 | Bacteria | 39603 |
| 522 | Ga0495602_0004402 | 3300048088 | Bacteria | 14700 |
| 523 | Ga0495602_0044227 | 3300048088 | Bacteria | 4042 |
| 524 | Ga0495602_0091081 | 3300048088 | Bacteria | 2530 |
| 525 | Ga0495602_0131203 | 3300048088 | Bacteria | 1998 |
| 526 | Ga0495614_0002390 | 3300048089 | Bacteria | 8348 |
| 527 | Ga0495614_0005476 | 3300048089 | Bacteria | 5722 |
| 528 | Ga0496102_0088203 | 3300048905 | Bacteria | 2867 |
| 529 | Ga0496102_0128934 | 3300048905 | Bacteria | 2366 |
| 530 | Ga0496104_0001373 | 3300048907 | Bacteria | 21053 |
| 531 | Ga0496104_0047867 | 3300048907 | Bacteria | 4030 |
| 532 | Ga0496104_0139311 | 3300048907 | Bacteria | 2331 |
| 533 | Ga0496104_0244318 | 3300048907 | Bacteria | 1707 |
| 534 | Ga0496105_0010341 | 3300048908 | Bacteria | 7337 |
| 535 | Ga0496105_0040019 | 3300048908 | Bacteria | 3864 |
| 536 | Ga0496105_0043021 | 3300048908 | Bacteria | 3725 |
| 537 | Ga0496106_0010131 | 3300048909 | Bacteria | 6963 |
| 538 | Ga0496106_0199883 | 3300048909 | Bacteria | 1591 |
| 539 | Ga0496107_0080836 | 3300048910 | Bacteria | 2370 |
| 540 | Ga0496107_0121384 | 3300048910 | Bacteria | 1925 |
| 541 | Ga0496108_0000975 | 3300048911 | Bacteria | 22275 |
| 542 | Ga0496108_0006124 | 3300048911 | Bacteria | 9734 |
| 543 | Ga0496108_0122700 | 3300048911 | Bacteria | 2229 |
| 544 | Ga0496108_0129060 | 3300048911 | Bacteria | 2172 |
| 545 | Ga0496109_0030696 | 3300048912 | Bacteria | 4817 |
| 546 | Ga0496109_0098977 | 3300048912 | Bacteria | 2704 |
| 547 | Ga0496109_0388482 | 3300048912 | Bacteria | 1318 |
| 548 | Ga0496109_0404983 | 3300048912 | Bacteria | 1289 |
| 549 | Ga0496109_0458861 | 3300048912 | Bacteria | 1203 |
| 550 | Ga0496110_0008562 | 3300048913 | Bacteria | 8236 |
| 551 | Ga0496110_0025319 | 3300048913 | Bacteria | 5069 |
| 552 | Ga0496111_0007769 | 3300048914 | Bacteria | 7061 |
| 553 | Ga0496112_0003470 | 3300048915 | Bacteria | 13040 |
| 554 | Ga0496112_0092905 | 3300048915 | Bacteria | 2987 |
| 555 | Ga0496112_0269684 | 3300048915 | Bacteria | 1650 |
| 556 | Ga0496113_0026171 | 3300048916 | Bacteria | 4168 |
| 557 | Ga0496113_0032842 | 3300048916 | Bacteria | 3773 |
| 558 | Ga0496113_0202012 | 3300048916 | Bacteria | 1580 |
| 559 | Ga0496114_0011756 | 3300048917 | Bacteria | 7003 |
| 560 | Ga0496115_0016813 | 3300048918 | Bacteria | 5577 |
| 561 | Ga0496115_0032724 | 3300048918 | Bacteria | 4103 |
| 562 | Ga0496115_0154018 | 3300048918 | Bacteria | 1898 |
| 563 | Ga0496126_0156117 | 3300048929 | Bacteria | 1953 |
| 564 | Ga0496126_0310706 | 3300048929 | Bacteria | 1298 |
| 565 | Ga0501032_0013793 | 3300049569 | Bacteria | 5733 |
| 566 | Ga0501032_0062818 | 3300049569 | Bacteria | 2488 |
| 567 | Ga0501033_0050495 | 3300049570 | Bacteria | 3085 |
| 568 | Ga0501033_0191948 | 3300049570 | Bacteria | 1461 |
| 569 | Ga0501036_0016113 | 3300049572 | Bacteria | 6245 |
| 570 | Ga0501036_0217446 | 3300049572 | Bacteria | 1605 |
| 571 | Ga0501037_0227153 | 3300049573 | Bacteria | 1311 |
| 572 | Ga0501038_0020639 | 3300049574 | Bacteria | 5921 |
| 573 | Ga0501038_0088539 | 3300049574 | Bacteria | 2598 |
| 574 | Ga0501039_0057716 | 3300049575 | Bacteria | 3006 |
| 575 | Ga0501039_0140956 | 3300049575 | Bacteria | 1894 |
| 576 | Ga0501039_0144156 | 3300049575 | Bacteria | 1871 |
| 577 | Ga0501039_0314766 | 3300049575 | Bacteria | 1230 |
| 578 | Ga0501040_0012680 | 3300049576 | Bacteria | 5529 |
| 579 | Ga0501040_0058720 | 3300049576 | Bacteria | 2642 |
| 580 | Ga0501040_0145722 | 3300049576 | Bacteria | 1669 |
| 581 | Ga0501041_0002562 | 3300049577 | Bacteria | 10360 |
| 582 | Ga0501041_0198526 | 3300049577 | Bacteria | 1257 |
| 583 | Ga0501042_0004606 | 3300049578 | Bacteria | 8802 |
| 584 | Ga0501042_0038387 | 3300049578 | Bacteria | 3402 |
| 585 | Ga0501042_0083289 | 3300049578 | Bacteria | 2293 |
| 586 | Ga0501042_0157253 | 3300049578 | Bacteria | 1640 |
| 587 | Ga0501043_0002930 | 3300049579 | Bacteria | 14244 |
| 588 | Ga0501043_0084400 | 3300049579 | Bacteria | 2496 |
| 589 | Ga0501046_0038018 | 3300049580 | Bacteria | 3865 |
| 590 | Ga0501046_0040071 | 3300049580 | Bacteria | 3745 |
| 591 | Ga0501047_0334510 | 3300049581 | Bacteria | 1352 |
| 592 | Ga0501048_0008430 | 3300049582 | Bacteria | 7793 |
| 593 | Ga0501048_0031924 | 3300049582 | Bacteria | 3808 |
| 594 | Ga0501048_0033189 | 3300049582 | Bacteria | 3730 |
| 595 | Ga0501067_0100084 | 3300049583 | Bacteria | 1610 |
| 596 | Ga0501068_0016970 | 3300049584 | Bacteria | 4206 |
| 597 | Ga0501069_0026741 | 3300049585 | Bacteria | 3160 |
| 598 | Ga0501070_0004275 | 3300049586 | Bacteria | 12284 |
| 599 | Ga0501071_0007884 | 3300049587 | Bacteria | 7021 |
| 600 | Ga0501071_0029685 | 3300049587 | Bacteria | 3861 |
| 601 | Ga0501071_0032119 | 3300049587 | Bacteria | 3726 |
| 602 | Ga0501072_0004315 | 3300049588 | Bacteria | 10796 |
| 603 | Ga0501072_0023386 | 3300049588 | Bacteria | 4799 |
| 604 | Ga0501072_0166277 | 3300049588 | Bacteria | 1760 |
| 605 | Ga0501073_0017143 | 3300049589 | Bacteria | 5246 |
| 606 | Ga0501073_0044478 | 3300049589 | Bacteria | 3129 |
| 607 | Ga0501074_0100753 | 3300049590 | Bacteria | 2067 |
| 608 | Ga0501074_0126400 | 3300049590 | Bacteria | 1829 |
| 609 | Ga0501075_0013619 | 3300049591 | Bacteria | 5807 |
| 610 | Ga0501075_0061361 | 3300049591 | Bacteria | 2833 |
| 611 | Ga0501075_0078757 | 3300049591 | Bacteria | 2494 |
| 612 | Ga0501076_0009978 | 3300049592 | Bacteria | 7021 |
| 613 | Ga0501076_0025816 | 3300049592 | Bacteria | 4548 |
| 614 | Ga0501076_0041341 | 3300049592 | Bacteria | 3626 |
| 615 | Ga0501076_0278523 | 3300049592 | Bacteria | 1370 |
| 616 | Ga0501077_0014637 | 3300049593 | Bacteria | 4930 |
| 617 | Ga0501077_0052134 | 3300049593 | Bacteria | 2598 |
| 618 | Ga0501079_0136862 | 3300049741 | Bacteria | 1907 |
| 619 | Ga0501079_0168615 | 3300049741 | Bacteria | 1707 |
| 620 | Ga0501079_0277648 | 3300049741 | Bacteria | 1310 |
| 621 | Ga0501080_0008350 | 3300049742 | Bacteria | 9378 |
| 622 | Ga0501080_0074487 | 3300049742 | Bacteria | 3158 |
| 623 | Ga0501080_0113112 | 3300049742 | Bacteria | 2516 |
| 624 | Ga0501081_0010570 | 3300049743 | Bacteria | 6027 |
| 625 | Ga0501081_0042458 | 3300049743 | Bacteria | 3116 |
| 626 | Ga0501081_0045473 | 3300049743 | Bacteria | 3014 |
| 627 | Ga0501081_0193446 | 3300049743 | Bacteria | 1474 |
| 628 | Ga0501083_0014432 | 3300049744 | Bacteria | 5522 |
| 629 | Ga0501083_0223517 | 3300049744 | Bacteria | 1226 |
| 630 | Ga0501035_0012285 | 3300049822 | Bacteria | 7915 |
| 631 | Ga0501045_0017198 | 3300049824 | Bacteria | 5133 |
| 632 | Ga0501045_0079023 | 3300049824 | Bacteria | 2425 |
| 633 | Ga0501045_0122194 | 3300049824 | Bacteria | 1933 |
| 634 | nmdc:mga05p37_13433_c1 | 3300050507 | Bacteria | 9815 |
| 635 | nmdc:mga05p37_550051_c1 | 3300050507 | Bacteria | 1314 |
| 636 | nmdc:mga08y16_69724_c1 | 3300050511 | Bacteria | 3665 |
| 637 | nmdc:mga0n895_11679_c1 | 3300050512 | Bacteria | 7848 |
| 638 | nmdc:mga0n895_159223_c1 | 3300050512 | Bacteria | 2289 |
| 639 | nmdc:mga0n895_35802_c1 | 3300050512 | Bacteria | 4790 |
| 640 | nmdc:mga0rr50_26444_c1 | 3300050513 | Bacteria | 4049 |
| 641 | nmdc:mga0rr50_360_c1 | 3300050513 | Bacteria | 24800 |
| 642 | nmdc:mga0rr50_7550_c1 | 3300050513 | Bacteria | 6715 |
| 643 | nmdc:mga08x19_139398_c1 | 3300050514 | Bacteria | 1637 |
| 644 | nmdc:mga08x19_24655_c1 | 3300050514 | Bacteria | 3742 |
| 645 | nmdc:mga08x19_3815_c1 | 3300050514 | Bacteria | 8970 |
| 646 | nmdc:mga0a205_18826_c1 | 3300050515 | Bacteria | 6500 |
| 647 | nmdc:mga0a205_24802_c1 | 3300050515 | Bacteria | 5706 |
| 648 | Ga0495601_0001538 | 3300053077 | Bacteria | 12746 |
| 649 | Ga0495601_0076527 | 3300053077 | Bacteria | 2143 |
| 650 | Ga0495612_0003598 | 3300053078 | Bacteria | 6425 |
| 651 | Ga0495612_0038366 | 3300053078 | Bacteria | 1946 |
| 652 | Ga0495612_0110602 | 3300053078 | Bacteria | 1175 |
| 653 | Ga0495612_0146152 | 3300053078 | Bacteria | 1027 |
| 654 | Ga0495595_0001168 | 3300053084 | Bacteria | 10181 |
| 655 | Ga0495595_0032134 | 3300053084 | Bacteria | 2362 |
| 656 | Ga0495595_0038899 | 3300053084 | Bacteria | 2169 |
| 657 | Ga0495595_0150804 | 3300053084 | Bacteria | 1144 |
| 658 | Ga0495619_0002859 | 3300053085 | Bacteria | 11244 |
| 659 | Ga0495619_0032656 | 3300053085 | Bacteria | 3378 |
| 660 | Ga0501084_0010845 | 3300054114 | Bacteria | 7548 |
| 661 | Ga0501084_0021020 | 3300054114 | Bacteria | 5444 |
| 662 | Ga0501084_0026845 | 3300054114 | Bacteria | 4810 |
| 663 | Ga0501082_0111939 | 3300060353 | Bacteria | 2363 |
| 664 | Ga0501082_0252138 | 3300060353 | Bacteria | 1536 |
| 665 | Ga0466962_0051808 | 3300061719 | Bacteria | 1963 |
| 666 | Ga0530510_0007545 | 3300061734 | Bacteria | 7576 |
| 667 | Ga0530510_0030941 | 3300061734 | Bacteria | 3846 |
| 668 | Ga0530510_0039595 | 3300061734 | Bacteria | 3403 |
| 669 | 2676479770 | 2675903059 | Bacteria | 8644972 |
| 670 | Ga0207678_10199094 | |||
| 671 | JGI25404J52841_10000398 | |||
| 672 | Ga0070658_10006727 | |||
| 673 | Ga0070658_10007493 | |||
| 674 | Ga0070676_10351239 | |||
| 675 | Ga0070683_100095482 | |||
| 676 | Ga0070683_100284399 | |||
| 677 | Ga0070690_100022486 | |||
| 678 | Ga0070680_100098443 | |||
| 679 | Ga0070680_100110586 | |||
| 680 | Ga0070682_100037868 | |||
| 681 | Ga0070682_100308805 | |||
| 682 | Ga0068868_100147018 | |||
| 683 | Ga0068868_100378941 | |||
| 684 | Ga0070689_100047404 | |||
| 685 | Ga0070691_10034550 | |||
| 686 | Ga0070691_10084260 | |||
| 687 | Ga0070687_100153364 | |||
| 688 | Ga0070661_100238413 | |||
| 689 | Ga0070692_10055715 | |||
| 690 | Ga0070668_100114738 | |||
| 691 | Ga0070675_100033222 | |||
| 692 | Ga0070671_100244779 | |||
| 693 | Ga0070673_100098201 | |||
| 694 | Ga0070667_100112253 | |||
| 695 | Ga0070709_10006011 | |||
| 696 | Ga0070709_10035182 | |||
| 697 | Ga0070709_10041597 | |||
| 698 | Ga0070709_10335440 | |||
| 699 | Ga0070714_100022125 | |||
| 700 | Ga0070714_100068074 | |||
| 701 | Ga0070714_100105493 | |||
| 702 | Ga0070714_100180930 | |||
| 703 | Ga0070714_100183072 | |||
| 704 | Ga0070714_100443169 | |||
| 705 | Ga0070713_100018274 | |||
| 706 | Ga0070713_100130271 | |||
| 707 | Ga0070713_100273965 | |||
| 708 | Ga0070713_100328778 | |||
| 709 | Ga0070710_10002884 | |||
| 710 | Ga0070711_100063942 | |||
| 711 | Ga0070711_100097676 | |||
| 712 | Ga0070705_100215403 | |||
| 713 | Ga0070708_100028053 | |||
| 714 | Ga0070708_100052879 | |||
| 715 | Ga0070708_100353281 | |||
| 716 | Ga0070708_100594662 | |||
| 717 | Ga0070663_100242030 | |||
| 718 | Ga0070663_100339395 | |||
| 719 | Ga0070678_100252806 | |||
| 720 | Ga0070681_10210639 | |||
| 721 | Ga0070681_10370948 | |||
| 722 | Ga0068867_100061590 | |||
| 723 | Ga0070685_10012773 | |||
| 724 | Ga0070706_100003827 | |||
| 725 | Ga0070706_100006264 | |||
| 726 | Ga0070706_100008346 | |||
| 727 | Ga0070706_100130554 | |||
| 728 | Ga0070706_100147969 | |||
| 729 | Ga0070707_100000596 | |||
| 730 | Ga0070707_100011189 | |||
| 731 | Ga0070707_100021466 | |||
| 732 | Ga0070707_100025539 | |||
| 733 | Ga0070707_100056960 | |||
| 734 | Ga0070707_100067523 | |||
| 735 | Ga0070707_100155466 | |||
| 736 | Ga0070707_100295190 | |||
| 737 | Ga0070698_100000272 | |||
| 738 | Ga0070698_100000415 | |||
| 739 | Ga0070698_100000997 | |||
| 740 | Ga0070698_100003605 | |||
| 741 | Ga0070698_100013860 | |||
| 742 | Ga0070698_100028331 | |||
| 743 | Ga0070698_100035486 | |||
| 744 | Ga0070698_100093920 | |||
| 745 | Ga0070698_100318580 | |||
| 746 | Ga0070699_100088729 | |||
| 747 | Ga0070679_100086043 | |||
| 748 | Ga0070679_100579644 | |||
| 749 | Ga0070684_100008234 | |||
| 750 | Ga0070684_100026234 | |||
| 751 | Ga0070684_100096180 | |||
| 752 | Ga0070684_100229345 | |||
| 753 | Ga0070697_100074348 | |||
| 754 | Ga0070697_100201039 | |||
| 755 | Ga0068853_100084552 | |||
| 756 | Ga0068853_100270850 | |||
| 757 | Ga0070672_100015514 | |||
| 758 | Ga0070672_100430052 | |||
| 759 | Ga0070696_100057788 | |||
| 760 | Ga0070665_100174594 | |||
| 761 | Ga0070665_100221691 | |||
| 762 | Ga0070665_100422668 | |||
| 763 | Ga0068855_100137800 | |||
| 764 | Ga0070664_100126825 | |||
| 765 | Ga0068857_100072535 | |||
| 766 | Ga0068857_100326583 | |||
| 767 | Ga0068854_100052623 | |||
| 768 | Ga0068856_100121353 | |||
| 769 | Ga0068856_100411945 | |||
| 770 | Ga0070702_100121017 | |||
| 771 | Ga0068864_100106489 | |||
| 772 | Ga0068864_100270829 | |||
| 773 | Ga0068864_100468157 | |||
| 774 | Ga0068861_100246366 | |||
| 775 | Ga0068870_10003577 | |||
| 776 | Ga0068870_10006656 | |||
| 777 | Ga0068863_100130514 | |||
| 778 | Ga0068863_100145498 | |||
| 779 | Ga0068858_100066920 | |||
| 780 | Ga0068860_100115826 | |||
| 781 | Ga0081455_10001397 | |||
| 782 | Ga0081540_1000070 | |||
| 783 | Ga0081540_1000255 | |||
| 784 | Ga0070717_10011880 | |||
| 785 | Ga0070717_10030716 | |||
| 786 | Ga0070717_10040696 | |||
| 787 | Ga0070717_10357081 | |||
| 788 | Ga0070717_10469510 | |||
| 789 | Ga0075363_100112466 | |||
| 790 | Ga0070715_10003563 | |||
| 791 | Ga0070716_100086062 | |||
| 792 | Ga0070716_100110221 | |||
| 793 | Ga0070716_100172751 | |||
| 794 | Ga0070712_100001430 | |||
| 795 | Ga0070712_100024741 | |||
| 796 | Ga0070712_100029923 | |||
| 797 | Ga0070712_100045889 | |||
| 798 | Ga0070712_100138604 | |||
| 799 | Ga0097621_100207432 | |||
| 800 | Ga0068871_100060277 | |||
| 801 | Ga0068871_100158580 | |||
| 802 | Ga0075428_100065303 | |||
| 803 | Ga0075433_10079779 | |||
| 804 | Ga0075434_100116857 | |||
| 805 | Ga0075434_100543344 | |||
| 806 | Ga0075436_100023790 | |||
| 807 | Ga0075436_100036516 | |||
| 808 | Ga0075436_100038138 | |||
| 809 | Ga0075436_100038908 | |||
| 810 | Ga0075435_100010584 | |||
| 811 | Ga0075435_100164107 | |||
| 812 | Ga0099794_10056226 | |||
| 813 | Ga0105251_10039771 | |||
| 814 | Ga0111539_10030235 | |||
| 815 | Ga0105245_10422077 | |||
| 816 | Ga0105247_10109600 | |||
| 817 | Ga0114129_10123228 | |||
| 818 | Ga0105243_10190814 | |||
| 819 | Ga0105242_10351222 | |||
| 820 | Ga0105248_10835268 | |||
| 821 | Ga0105237_10165429 | |||
| 822 | Ga0105238_10108642 | |||
| 823 | Ga0105239_10937086 | |||
| 824 | Ga0105246_10030702 | |||
| 825 | Ga0105246_10067203 | |||
| 826 | Ga0157341_1002091 | |||
| 827 | Ga0157338_1006338 | |||
| 828 | Ga0157370_10053967 | |||
| 829 | Ga0157370_10068763 | |||
| 830 | Ga0157369_10025418 | |||
| 831 | Ga0157369_10044576 | |||
| 832 | Ga0157369_10069173 | |||
| 833 | Ga0157369_10139462 | |||
| 834 | Ga0157369_10272517 | |||
| 835 | Ga0163162_10264431 | |||
| 836 | Ga0163163_10032737 | |||
| 837 | Ga0163163_10235243 | |||
| 838 | Ga0163163_10488913 | |||
| 839 | Ga0157380_10022765 | |||
| 840 | Ga0157380_10328683 | |||
| 841 | Ga0157377_10036512 | |||
| 842 | Ga0157379_10101468 | |||
| 843 | Ga0157376_10229016 | |||
| 844 | Ga0157376_10314520 | |||
| 845 | Ga0206354_10221321 | |||
| 846 | Ga0206354_10324262 | |||
| 847 | Ga0206353_11100521 | |||
| 848 | Ga0206353_12026084 | |||
| 849 | Ga0213875_10000158 | |||
| 850 | Ga0213875_10124775 | |||
| 851 | Ga0224712_10100834 | |||
| 852 | Ga0207692_10001781 | |||
| 853 | Ga0207692_10005925 | |||
| 854 | Ga0207692_10040324 | |||
| 855 | Ga0207692_10065417 | |||
| 856 | Ga0207710_10015780 | |||
| 857 | Ga0207688_10004276 | |||
| 858 | Ga0207647_10051533 | |||
| 859 | Ga0207647_10175835 | |||
| 860 | Ga0207685_10103586 | |||
| 861 | Ga0207699_10003184 | |||
| 862 | Ga0207699_10006004 | |||
| 863 | Ga0207699_10018224 | |||
| 864 | Ga0207699_10060602 | |||
| 865 | Ga0207645_10231042 | |||
| 866 | Ga0207643_10001438 | |||
| 867 | Ga0207705_10041110 | |||
| 868 | Ga0207684_10000787 | |||
| 869 | Ga0207684_10010320 | |||
| 870 | Ga0207684_10020239 | |||
| 871 | Ga0207684_10021790 | |||
| 872 | Ga0207684_10042341 | |||
| 873 | Ga0207684_10045578 | |||
| 874 | Ga0207684_10086258 | |||
| 875 | Ga0207654_10053639 | |||
| 876 | Ga0207693_10003435 | |||
| 877 | Ga0207693_10023877 | |||
| 878 | Ga0207693_10037306 | |||
| 879 | Ga0207693_10057348 | |||
| 880 | Ga0207693_10058382 | |||
| 881 | Ga0207663_10047249 | |||
| 882 | Ga0207662_10022414 | |||
| 883 | Ga0207657_10002750 | |||
| 884 | Ga0207657_10022835 | |||
| 885 | Ga0207649_10098987 | |||
| 886 | Ga0207649_10193116 | |||
| 887 | Ga0207652_10017047 | |||
| 888 | Ga0207652_10105681 | |||
| 889 | Ga0207646_10000500 | |||
| 890 | Ga0207646_10001807 | |||
| 891 | Ga0207646_10050063 | |||
| 892 | Ga0207646_10054303 | |||
| 893 | Ga0207646_10079695 | |||
| 894 | Ga0207646_10091532 | |||
| 895 | Ga0207646_10097284 | |||
| 896 | Ga0207646_10104414 | |||
| 897 | Ga0207646_10200449 | |||
| 898 | Ga0207646_10266011 | |||
| 899 | Ga0207646_10330249 | |||
| 900 | Ga0207650_10004613 | |||
| 901 | Ga0207659_10274453 | |||
| 902 | Ga0207700_10012338 | |||
| 903 | Ga0207700_10054264 | |||
| 904 | Ga0207700_10103492 | |||
| 905 | Ga0207700_10193018 | |||
| 906 | Ga0207700_10230511 | |||
| 907 | Ga0207700_10387648 | |||
| 908 | Ga0207664_10001200 | |||
| 909 | Ga0207664_10001575 | |||
| 910 | Ga0207664_10001831 | |||
| 911 | Ga0207664_10003267 | |||
| 912 | Ga0207664_10012574 | |||
| 913 | Ga0207664_10035385 | |||
| 914 | Ga0207664_10204686 | |||
| 915 | Ga0207664_10214649 | |||
| 916 | Ga0207664_10215974 | |||
| 917 | Ga0207664_10474070 | |||
| 918 | Ga0207670_10028108 | |||
| 919 | Ga0207704_10328385 | |||
| 920 | Ga0207665_10002304 | |||
| 921 | Ga0207665_10008798 | |||
| 922 | Ga0207665_10016409 | |||
| 923 | Ga0207665_10054765 | |||
| 924 | Ga0207665_10315019 | |||
| 925 | Ga0207691_10023010 | |||
| 926 | Ga0207689_10002061 | |||
| 927 | Ga0207661_10103120 | |||
| 928 | Ga0207661_10131026 | |||
| 929 | Ga0207679_10258460 | |||
| 930 | Ga0207667_10127461 | |||
| 931 | Ga0207651_10439907 | |||
| 932 | Ga0207640_10074296 | |||
| 933 | Ga0207677_10156536 | |||
| 934 | Ga0207639_10141007 | |||
| 935 | Ga0207678_10002282 | |||
| 936 | Ga0207678_10005083 | |||
| 937 | Ga0207708_10179810 | |||
| 938 | Ga0207641_10256788 | |||
| 939 | Ga0207648_10044100 | |||
| 940 | Ga0207676_10054942 | |||
| 941 | Ga0207676_10297162 | |||
| 942 | Ga0207674_10013418 | |||
| 943 | Ga0207674_10026006 | |||
| 944 | Ga0207674_10029653 | |||
| 945 | Ga0207674_10039601 | |||
| 946 | Ga0207675_100009072 | |||
| 947 | Ga0207683_10000774 | |||
| 948 | Ga0207683_10097628 | |||
| 949 | Ga0207683_10180711 | |||
| 950 | Ga0207428_10372026 | |||
| 951 | Ga0268266_10159905 | |||
| 952 | Ga0268266_10266874 | |||
| 953 | Ga0268265_10560615 | |||
| 954 | Ga0268264_10296055 | |||
| 955 | Ga0265337_1000057 | |||
| 956 | Ga0265326_10003994 | |||
| 957 | Ga0265319_1019198 | |||
| 958 | Ga0265334_10000298 | |||
| 959 | Ga0265318_10051173 | |||
| 960 | Ga0265323_10014644 | |||
| 961 | Ga0265322_10003954 | |||
| 962 | Ga0265336_10003082 | |||
| 963 | Ga0265336_10060799 | |||
| 964 | Ga0265338_10002491 | |||
| 965 | Ga0265338_10010734 | |||
| 966 | Ga0265324_10005410 | |||
| 967 | Ga0265760_10023331 | |||
| 968 | Ga0265325_10038636 | |||
| 969 | Ga0265316_10038089 | |||
| 970 | Ga0265313_10008995 | |||
| 971 | Ga0307508_10181997 | |||
| 972 | Ga0265342_10011537 | |||
| 973 | Ga0373958_0000702 | |||
| 974 | Ga0373938_0002427 | |||
| 975 | Ga0373926_0000338 | |||
| 976 | Ga0373926_0008176 | |||
| 977 | Ga0373926_0036116 | |||
| 978 | Ga0373929_0012997 | |||
| 979 | Ga0373934_0002751 | |||
| 980 | Ga0373934_0005659 | |||
| 981 | Ga0373934_0009461 | |||
| 982 | Ga0373934_0033902 | |||
| 983 | Ga0373934_0089514 | |||
| 984 | Ga0373940_0005533 | |||
| 985 | Ga0373949_0014747 | |||
| 986 | Ga0373951_0006077 | |||
| 987 | Ga0373923_0016080 | |||
| 988 | Ga0373923_0143768 | |||
| 989 | Ga0373936_0011924 | |||
| 990 | Ga0373936_0077167 | |||
| 991 | Ga0373936_0097727 | |||
| 992 | Ga0373945_0008784 | |||
| 993 | Ga0373953_0000027 | |||
| 994 | Ga0373953_0005416 | |||
| 995 | Ga0373953_0061130 | |||
| 996 | Ga0373953_0091118 | |||
| 997 | Ga0373954_0002667 | |||
| 998 | Ga0373954_0046215 | |||
| 999 | Ga0373954_0087633 | |||
| 1000 | Ga0373954_0103078 | |||
| 1001 | Ga0373956_0003730 | |||
| 1002 | Ga0373956_0039909 | |||
| 1003 | Ga0373956_0051315 | |||
| 1004 | Ga0373956_0150830 | |||
| 1005 | Ga0373957_0000178 | |||
| 1006 | Ga0373957_0000855 | |||
| 1007 | Ga0373943_0007036 | |||
| 1008 | Ga0373943_0028150 | |||
| 1009 | Ga0373943_0057587 | |||
| 1010 | Ga0373946_0002230 | |||
| 1011 | Ga0373946_0040999 | |||
| 1012 | Ga0373955_0000277 | |||
| 1013 | Ga0373955_0003321 | |||
| 1014 | Ga0373955_0011489 | |||
| 1015 | Ga0373955_0011954 | |||
| 1016 | Ga0373955_0204464 | |||
| 1017 | Ga0373942_0014589 | |||
| 1018 | Ga0316574_0093274 | |||
| 1019 | Ga0373924_0000722 | |||
| 1020 | Ga0373924_0001566 | |||
| 1021 | Ga0373924_0018352 | |||
| 1022 | Ga0373924_0098473 | |||
| 1023 | Ga0373931_0005867 | |||
| 1024 | Ga0373931_0224919 | |||
| 1025 | Ga0373935_0004554 | |||
| 1026 | Ga0373935_0011484 | |||
| 1027 | Ga0373935_0017888 | |||
| 1028 | Ga0373933_0000056 | |||
| 1029 | Ga0373933_0011242 | |||
| 1030 | Ga0373933_0015508 | |||
| 1031 | Ga0373933_0017567 | |||
| 1032 | Ga0373933_0054262 | |||
| 1033 | Ga0373947_0000012 | |||
| 1034 | Ga0373947_0000109 | |||
| 1035 | Ga0373947_0007711 | |||
| 1036 | Ga0373937_0000152 | |||
| 1037 | Ga0373937_0007300 | |||
| 1038 | Ga0373937_0028368 | |||
| 1039 | Ga0373937_0172487 | |||
| 1040 | Ga0373937_0183687 | |||
| 1041 | Ga0373937_0207389 | |||
| 1042 | Ga0373937_0387389 | |||
| 1043 | Ga0373925_0000319 | |||
| 1044 | Ga0373925_0002082 | |||
| 1045 | Ga0373925_0004704 | |||
| 1046 | Ga0373925_0006462 | |||
| 1047 | Ga0373925_0023768 | |||
| 1048 | Ga0395905_0480055 | |||
| 1049 | Ga0436364_0045810 | |||
| 1050 | Ga0436364_0074751 | |||
| 1051 | Ga0436364_0560348 | |||
| 1052 | Ga0436364_0960361 | |||
| 1053 | Ga0436364_1388557 | |||
| 1054 | Ga0436365_0247847 | |||
| 1055 | Ga0436365_1837031 | |||
| 1056 | Ga0436363_1301976 | |||
| 1057 | Ga0436363_1374337 | |||
| 1058 | Ga0436362_0770758 | |||
| 1059 | Ga0450920_002111 | |||
| 1060 | Ga0450907_009958 | |||
| 1061 | Ga0466963_0061428 | |||
| 1062 | Ga0466967_0228890 | |||
| 1063 | Ga0495592_0000129 | |||
| 1064 | Ga0495592_0018006 | |||
| 1065 | Ga0495592_0101941 | |||
| 1066 | Ga0495592_0107423 | |||
| 1067 | Ga0495592_0226780 | |||
| 1068 | Ga0495603_0006306 | |||
| 1069 | Ga0495603_0055108 | |||
| 1070 | Ga0495629_0039097 | |||
| 1071 | Ga0495641_0003961 | |||
| 1072 | Ga0495641_0006421 | |||
| 1073 | Ga0495651_0000089 | |||
| 1074 | Ga0495653_0006178 | |||
| 1075 | Ga0495653_0013196 | |||
| 1076 | Ga0495653_0018397 | |||
| 1077 | Ga0495653_0084033 | |||
| 1078 | Ga0495580_0014361 | |||
| 1079 | Ga0495580_0019899 | |||
| 1080 | Ga0495582_0003442 | |||
| 1081 | Ga0495662_0006459 | |||
| 1082 | Ga0495664_0007818 | |||
| 1083 | Ga0495664_0023197 | |||
| 1084 | Ga0495664_0092039 | |||
| 1085 | Ga0495594_0030336 | |||
| 1086 | Ga0495608_0000086 | |||
| 1087 | Ga0495608_0003546 | |||
| 1088 | Ga0495608_0047479 | |||
| 1089 | Ga0495608_0064403 | |||
| 1090 | Ga0495618_0024625 | |||
| 1091 | Ga0495618_0134938 | |||
| 1092 | Ga0495628_0000590 | |||
| 1093 | Ga0495628_0021547 | |||
| 1094 | Ga0495628_0064060 | |||
| 1095 | Ga0495628_0116754 | |||
| 1096 | Ga0495663_0096064 | |||
| 1097 | Ga0495666_0019640 | |||
| 1098 | Ga0495666_0030922 | |||
| 1099 | Ga0495652_0000221 | |||
| 1100 | Ga0495652_0006349 | |||
| 1101 | Ga0495652_0013290 | |||
| 1102 | Ga0495652_0031302 | |||
| 1103 | Ga0495652_0076250 | |||
| 1104 | Ga0495652_0140060 | |||
| 1105 | Ga0495665_0000985 | |||
| 1106 | Ga0495665_0084242 | |||
| 1107 | Ga0495640_0019259 | |||
| 1108 | Ga0495640_0023271 | |||
| 1109 | Ga0495640_0070064 | |||
| 1110 | Ga0495586_0010847 | |||
| 1111 | Ga0495586_0109946 | |||
| 1112 | Ga0495587_0000099 | |||
| 1113 | Ga0495587_0004516 | |||
| 1114 | Ga0495587_0014462 | |||
| 1115 | Ga0495587_0028622 | |||
| 1116 | Ga0495587_0034121 | |||
| 1117 | Ga0495587_0065030 | |||
| 1118 | Ga0495645_0012919 | |||
| 1119 | Ga0495645_0020506 | |||
| 1120 | Ga0495645_0109512 | |||
| 1121 | Ga0495645_0224481 | |||
| 1122 | Ga0495645_0269127 | |||
| 1123 | Ga0495645_0310280 | |||
| 1124 | Ga0495667_0000088 | |||
| 1125 | Ga0495667_0001780 | |||
| 1126 | Ga0495667_0003211 | |||
| 1127 | Ga0495667_0026313 | |||
| 1128 | Ga0495667_0038349 | |||
| 1129 | Ga0495667_0045786 | |||
| 1130 | Ga0495634_0008896 | |||
| 1131 | Ga0495634_0019680 | |||
| 1132 | Ga0495634_0063597 | |||
| 1133 | Ga0495634_0162497 | |||
| 1134 | Ga0495635_0015774 | |||
| 1135 | Ga0495635_0107727 | |||
| 1136 | Ga0495657_0000130 | |||
| 1137 | Ga0495657_0021780 | |||
| 1138 | Ga0495657_0041784 | |||
| 1139 | Ga0495657_0047694 | |||
| 1140 | Ga0495599_0000190 | |||
| 1141 | Ga0495599_0056812 | |||
| 1142 | Ga0495599_0080216 | |||
| 1143 | Ga0495599_0182392 | |||
| 1144 | Ga0495623_0000122 | |||
| 1145 | Ga0495623_0014657 | |||
| 1146 | Ga0495623_0017272 | |||
| 1147 | Ga0495623_0047270 | |||
| 1148 | Ga0495623_0116614 | |||
| 1149 | Ga0495646_0069815 | |||
| 1150 | Ga0495646_0097621 | |||
| 1151 | Ga0495647_0019753 | |||
| 1152 | Ga0495658_0003537 | |||
| 1153 | Ga0495613_0001071 | |||
| 1154 | Ga0495613_0012763 | |||
| 1155 | Ga0495613_0313114 | |||
| 1156 | Ga0495624_0006227 | |||
| 1157 | Ga0495624_0171631 | |||
| 1158 | Ga0495624_0279207 | |||
| 1159 | Ga0495600_0002668 | |||
| 1160 | Ga0495600_0005282 | |||
| 1161 | Ga0495600_0039229 | |||
| 1162 | Ga0495600_0096199 | |||
| 1163 | Ga0495581_0002243 | |||
| 1164 | Ga0495581_0008179 | |||
| 1165 | Ga0495604_0000117 | |||
| 1166 | Ga0495604_0003577 | |||
| 1167 | Ga0495604_0005122 | |||
| 1168 | Ga0495604_0106054 | |||
| 1169 | Ga0495674_0011662 | |||
| 1170 | Ga0495674_0026492 | |||
| 1171 | Ga0495676_0044684 | |||
| 1172 | Ga0495676_0127176 | |||
| 1173 | Ga0495680_0000345 | |||
| 1174 | Ga0495680_0009813 | |||
| 1175 | Ga0495680_0011717 | |||
| 1176 | Ga0495680_0012931 | |||
| 1177 | Ga0495680_0017499 | |||
| 1178 | Ga0495680_0026634 | |||
| 1179 | Ga0495680_0042620 | |||
| 1180 | Ga0495675_0003177 | |||
| 1181 | Ga0495675_0019590 | |||
| 1182 | Ga0495675_0026863 | |||
| 1183 | Ga0495675_0072996 | |||
| 1184 | Ga0495675_0076261 | |||
| 1185 | Ga0495684_0010188 | |||
| 1186 | Ga0495684_0012319 | |||
| 1187 | Ga0495684_0031930 | |||
| 1188 | Ga0495684_0044048 | |||
| 1189 | Ga0495593_0007011 | |||
| 1190 | Ga0495602_0000424 | |||
| 1191 | Ga0495602_0004402 | |||
| 1192 | Ga0495602_0044227 | |||
| 1193 | Ga0495602_0091081 | |||
| 1194 | Ga0495602_0131203 | |||
| 1195 | Ga0495614_0002390 | |||
| 1196 | Ga0495614_0005476 | |||
| 1197 | Ga0496102_0088203 | |||
| 1198 | Ga0496102_0128934 | |||
| 1199 | Ga0496104_0001373 | |||
| 1200 | Ga0496104_0047867 | |||
| 1201 | Ga0496104_0139311 | |||
| 1202 | Ga0496104_0244318 | |||
| 1203 | Ga0496105_0010341 | |||
| 1204 | Ga0496105_0040019 | |||
| 1205 | Ga0496105_0043021 | |||
| 1206 | Ga0496106_0010131 | |||
| 1207 | Ga0496106_0199883 | |||
| 1208 | Ga0496107_0080836 | |||
| 1209 | Ga0496107_0121384 | |||
| 1210 | Ga0496108_0000975 | |||
| 1211 | Ga0496108_0006124 | |||
| 1212 | Ga0496108_0122700 | |||
| 1213 | Ga0496108_0129060 | |||
| 1214 | Ga0496109_0030696 | |||
| 1215 | Ga0496109_0098977 | |||
| 1216 | Ga0496109_0388482 | |||
| 1217 | Ga0496109_0404983 | |||
| 1218 | Ga0496109_0458861 | |||
| 1219 | Ga0496110_0008562 | |||
| 1220 | Ga0496110_0025319 | |||
| 1221 | Ga0496111_0007769 | |||
| 1222 | Ga0496112_0003470 | |||
| 1223 | Ga0496112_0092905 | |||
| 1224 | Ga0496112_0269684 | |||
| 1225 | Ga0496113_0026171 | |||
| 1226 | Ga0496113_0032842 | |||
| 1227 | Ga0496113_0202012 | |||
| 1228 | Ga0496114_0011756 | |||
| 1229 | Ga0496115_0016813 | |||
| 1230 | Ga0496115_0032724 | |||
| 1231 | Ga0496115_0154018 | |||
| 1232 | Ga0496126_0156117 | |||
| 1233 | Ga0496126_0310706 | |||
| 1234 | Ga0501032_0013793 | |||
| 1235 | Ga0501032_0062818 | |||
| 1236 | Ga0501033_0050495 | |||
| 1237 | Ga0501033_0191948 | |||
| 1238 | Ga0501036_0016113 | |||
| 1239 | Ga0501036_0217446 | |||
| 1240 | Ga0501037_0227153 | |||
| 1241 | Ga0501038_0020639 | |||
| 1242 | Ga0501038_0088539 | |||
| 1243 | Ga0501039_0057716 | |||
| 1244 | Ga0501039_0140956 | |||
| 1245 | Ga0501039_0144156 | |||
| 1246 | Ga0501039_0314766 | |||
| 1247 | Ga0501040_0012680 | |||
| 1248 | Ga0501040_0058720 | |||
| 1249 | Ga0501040_0145722 | |||
| 1250 | Ga0501041_0002562 | |||
| 1251 | Ga0501041_0198526 | |||
| 1252 | Ga0501042_0004606 | |||
| 1253 | Ga0501042_0038387 | |||
| 1254 | Ga0501042_0083289 | |||
| 1255 | Ga0501042_0157253 | |||
| 1256 | Ga0501043_0002930 | |||
| 1257 | Ga0501043_0084400 | |||
| 1258 | Ga0501046_0038018 | |||
| 1259 | Ga0501046_0040071 | |||
| 1260 | Ga0501047_0334510 | |||
| 1261 | Ga0501048_0008430 | |||
| 1262 | Ga0501048_0031924 | |||
| 1263 | Ga0501048_0033189 | |||
| 1264 | Ga0501067_0100084 | |||
| 1265 | Ga0501068_0016970 | |||
| 1266 | Ga0501069_0026741 | |||
| 1267 | Ga0501070_0004275 | |||
| 1268 | Ga0501071_0007884 | |||
| 1269 | Ga0501071_0029685 | |||
| 1270 | Ga0501071_0032119 | |||
| 1271 | Ga0501072_0004315 | |||
| 1272 | Ga0501072_0023386 | |||
| 1273 | Ga0501072_0166277 | |||
| 1274 | Ga0501073_0017143 | |||
| 1275 | Ga0501073_0044478 | |||
| 1276 | Ga0501074_0100753 | |||
| 1277 | Ga0501074_0126400 | |||
| 1278 | Ga0501075_0013619 | |||
| 1279 | Ga0501075_0061361 | |||
| 1280 | Ga0501075_0078757 | |||
| 1281 | Ga0501076_0009978 | |||
| 1282 | Ga0501076_0025816 | |||
| 1283 | Ga0501076_0041341 | |||
| 1284 | Ga0501076_0278523 | |||
| 1285 | Ga0501077_0014637 | |||
| 1286 | Ga0501077_0052134 | |||
| 1287 | Ga0501079_0136862 | |||
| 1288 | Ga0501079_0168615 | |||
| 1289 | Ga0501079_0277648 | |||
| 1290 | Ga0501080_0008350 | |||
| 1291 | Ga0501080_0074487 | |||
| 1292 | Ga0501080_0113112 | |||
| 1293 | Ga0501081_0010570 | |||
| 1294 | Ga0501081_0042458 | |||
| 1295 | Ga0501081_0045473 | |||
| 1296 | Ga0501081_0193446 | |||
| 1297 | Ga0501083_0014432 | |||
| 1298 | Ga0501083_0223517 | |||
| 1299 | Ga0501035_0012285 | |||
| 1300 | Ga0501045_0017198 | |||
| 1301 | Ga0501045_0079023 | |||
| 1302 | Ga0501045_0122194 | |||
| 1303 | nmdc:mga05p37_13433_c1 | |||
| 1304 | nmdc:mga05p37_550051_c1 | |||
| 1305 | nmdc:mga08y16_69724_c1 | |||
| 1306 | nmdc:mga0n895_11679_c1 | |||
| 1307 | nmdc:mga0n895_159223_c1 | |||
| 1308 | nmdc:mga0n895_35802_c1 | |||
| 1309 | nmdc:mga0rr50_26444_c1 | |||
| 1310 | nmdc:mga0rr50_360_c1 | |||
| 1311 | nmdc:mga0rr50_7550_c1 | |||
| 1312 | nmdc:mga08x19_139398_c1 | |||
| 1313 | nmdc:mga08x19_24655_c1 | |||
| 1314 | nmdc:mga08x19_3815_c1 | |||
| 1315 | nmdc:mga0a205_18826_c1 | |||
| 1316 | nmdc:mga0a205_24802_c1 | |||
| 1317 | Ga0495601_0001538 | |||
| 1318 | Ga0495601_0076527 | |||
| 1319 | Ga0495612_0003598 | |||
| 1320 | Ga0495612_0038366 | |||
| 1321 | Ga0495612_0110602 | |||
| 1322 | Ga0495612_0146152 | |||
| 1323 | Ga0495595_0001168 | |||
| 1324 | Ga0495595_0032134 | |||
| 1325 | Ga0495595_0038899 | |||
| 1326 | Ga0495595_0150804 | |||
| 1327 | Ga0495619_0002859 | |||
| 1328 | Ga0495619_0032656 | |||
| 1329 | Ga0501084_0010845 | |||
| 1330 | Ga0501084_0021020 | |||
| 1331 | Ga0501084_0026845 | |||
| 1332 | Ga0501082_0111939 | |||
| 1333 | Ga0501082_0252138 | |||
| 1334 | Ga0466962_0051808 | |||
| 1335 | Ga0530510_0007545 | |||
| 1336 | Ga0530510_0030941 | |||
| 1337 | Ga0530510_0039595 | |||
| 1338 | 2676479770 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1f6y-assembly1.cif.gz_B | mad crystal structure analysis of methyltetrahydrofolate: corrinoid/iron-sulfur protein methyltransferase (metr) | 0.94 | 21 | 269 |
| 2yck-assembly1.cif.gz_X | methyltransferase bound with tetrahydrofolate | 0.9398 | 17 | 269 |
| 1q85-assembly2.cif.gz_B | cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+ complex, se-met) | 0.9384 | 1 | 268 |
| 1q7q-assembly2.cif.gz_B | cobalamin-dependent methionine synthase (1-566) from t. maritima (oxidized, orthorhombic) | 0.9381 | 1 | 268 |
| 1q7q-assembly1.cif.gz_A | cobalamin-dependent methionine synthase (1-566) from t. maritima (oxidized, orthorhombic) | 0.9377 | 1 | 269 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1f6yB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like | 0.94 | 21 | 269 | 3.20.20.20 |
| 1q8jB02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like | 0.933 | 4 | 268 | 3.20.20.20 |
| 1q8jB02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like | 0.9258 | 4 | 268 | 3.20.20.20 |
| 4o1eB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like | 0.8914 | 18 | 273 | 3.20.20.20 |
| 1f6yB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like | 0.891 | 21 | 269 | 3.20.20.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A432H0E4-F1-model_v4 | Methyltetrahydrofolate cobalamin methyltransferase | 0.9832 | 2 | 178 |
GO:0005829
GO:0008705 GO:0032259 GO:0046653 GO:0046872 GO:0050667 |
| AF-A0A383DDN4-F1-model_v4 | Pterin-binding domain-containing protein | 0.9797 | 1 | 139 |
GO:0005829
GO:0008705 GO:0032259 GO:0046653 GO:0046872 GO:0050667 |
| AF-A0A316TLL8-F1-model_v4 | Methyltetrahydrofolate--corrinoid methyltransferase | 0.9778 | 1 | 274 |
GO:0005829
GO:0008705 GO:0032259 GO:0046653 GO:0046872 GO:0050667 |
| AF-A0A3C1U407-F1-model_v4 | Methyltetrahydrofolate--corrinoid methyltransferase | 0.9767 | 2 | 243 |
GO:0005829
GO:0008705 GO:0032259 GO:0046653 GO:0046872 GO:0050667 |
| AF-A0A7C2ITA9-F1-model_v4 | deleted | 0.9762 | 1 | 113 |
|