F473988

General Info

Members Datasets Scaffolds Average Seq Length
669 346 1338 121

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100432784|Ga0070716_1004327842
Length 145
Sequence MHAFDVLGDPVRRRILELLAEGELTSGAIGAIVQHEFGITQPAVSQHLKVLRDSGLATVRPEGTRRLYAVNSEPLRELDAWLDRFRRFWTPHLEALATELARGRRERRLASPIPKSAAQTERGKTHDRRDPADQRRPAPGRHAGT

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
100 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
101 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
102 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
183 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
191 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
192 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
193 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
194 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
195 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
196 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
197 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
198 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
199 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
200 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
201 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
202 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
207 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
208 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
209 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
210 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
211 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
212 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
218 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
219 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
220 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
229 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
232 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
233 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
234 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
246 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
250 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
254 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
255 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
256 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
257 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
261 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
265 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
266 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
267 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
268 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
271 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
280 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
281 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
282 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
289 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
296 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
302 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
303 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
304 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
305 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
306 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
307 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
308 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
309 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
310 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
313 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
314 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
315 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
316 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
317 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
318 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
319 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
320 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
321 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
322 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
323 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
324 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
325 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
326 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
327 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
328 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
329 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
330 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
331 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
332 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
333 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
334 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
335 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
336 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
337 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
338 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
339 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
340 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
341 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
342 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
343 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
344 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
345 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
346 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.86
Metatranscriptomes 0.6
Isolates 2.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0.45
Rhizoplane 4.78
Rhizosphere 90.43
Stem 0
Stem Tuber 0
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_100432784 3300006173 Bacteria 954
2 JGI24740J21852_10132250 3300001979 Bacteria 622
3 JGI25404J52841_10006383 3300003659 Bacteria 2464
4 JGI25404J52841_10091599 3300003659 Bacteria 636
5 Ga0070658_10230584 3300005327 Bacteria 1568
6 Ga0070676_10245309 3300005328 Bacteria 1193
7 Ga0070683_100148201 3300005329 Bacteria 2224
8 Ga0070690_100231494 3300005330 Bacteria 1299
9 Ga0070670_100949126 3300005331 Bacteria 781
10 Ga0070666_10038443 3300005335 Bacteria 3185
11 Ga0070680_100235575 3300005336 Bacteria 1546
12 Ga0070682_100534503 3300005337 Bacteria 914
13 Ga0068868_101432813 3300005338 Bacteria 645
14 Ga0070689_100535274 3300005340 Bacteria 1007
15 Ga0070691_10034609 3300005341 Bacteria 2378
16 Ga0070692_10053418 3300005345 Bacteria 2107
17 Ga0070668_100000526 3300005347 Bacteria 25426
18 Ga0070668_101532207 3300005347 Bacteria 610
19 Ga0070669_100396502 3300005353 Bacteria 1128
20 Ga0070671_100645246 3300005355 Bacteria 916
21 Ga0070671_101575242 3300005355 Bacteria 582
22 Ga0070674_100229780 3300005356 Bacteria 1447
23 Ga0070673_100557500 3300005364 Bacteria 1041
24 Ga0070673_101009242 3300005364 Bacteria 775
25 Ga0070688_100042050 3300005365 Bacteria 2809
26 Ga0070659_100046902 3300005366 Bacteria 3387
27 Ga0070667_100474056 3300005367 Bacteria 1145
28 Ga0070703_10316341 3300005406 Bacteria 656
29 Ga0070709_10360543 3300005434 Bacteria 1076
30 Ga0070709_11104166 3300005434 Bacteria 634
31 Ga0070714_100124264 3300005435 Bacteria 2298
32 Ga0070714_101171868 3300005435 Bacteria 749
33 Ga0070713_100018406 3300005436 Bacteria 5309
34 Ga0070713_100699707 3300005436 Bacteria 967
35 Ga0070710_10001648 3300005437 Bacteria 10536
36 Ga0070710_10866930 3300005437 Bacteria 649
37 Ga0070710_10872782 3300005437 Bacteria 647
38 Ga0070701_10019307 3300005438 Bacteria 3218
39 Ga0070711_100124355 3300005439 Bacteria 1913
40 Ga0070711_100297416 3300005439 Bacteria 1282
41 Ga0070711_101265189 3300005439 Bacteria 639
42 Ga0070700_100055391 3300005441 Bacteria 2482
43 Ga0070694_100086447 3300005444 Bacteria 2191
44 Ga0070694_100290873 3300005444 Bacteria 1249
45 Ga0070694_101391809 3300005444 Bacteria 592
46 Ga0070708_100507845 3300005445 Bacteria 1137
47 Ga0070663_100138637 3300005455 Bacteria 1855
48 Ga0070663_101039663 3300005455 Bacteria 714
49 Ga0070678_100167782 3300005456 Bacteria 1785
50 Ga0070662_100126982 3300005457 Bacteria 1961
51 Ga0070662_100175291 3300005457 Bacteria 1687
52 Ga0070681_10071934 3300005458 Bacteria 3422
53 Ga0068867_100421737 3300005459 Bacteria 1130
54 Ga0070685_10147042 3300005466 Bacteria 1490
55 Ga0070707_100685510 3300005468 Bacteria 987
56 Ga0070707_100817936 3300005468 Bacteria 896
57 Ga0070698_100174061 3300005471 Bacteria 2092
58 Ga0070698_100508689 3300005471 Bacteria 1142
59 Ga0070698_100521940 3300005471 Bacteria 1126
60 Ga0070699_100057578 3300005518 Bacteria 3366
61 Ga0070679_100125242 3300005530 Bacteria 2552
62 Ga0070684_100130082 3300005535 Bacteria 2270
63 Ga0070684_101091468 3300005535 Bacteria 750
64 Ga0068853_100432688 3300005539 Bacteria 1235
65 Ga0070672_100333743 3300005543 Bacteria 1290
66 Ga0070695_100075321 3300005545 Bacteria 2220
67 Ga0070696_100279830 3300005546 Bacteria 1271
68 Ga0070696_100312685 3300005546 Bacteria 1206
69 Ga0070693_100374477 3300005547 Bacteria 980
70 Ga0070665_100449042 3300005548 Bacteria 1299
71 Ga0070704_100222700 3300005549 Bacteria 1535
72 Ga0070704_100656254 3300005549 Bacteria 927
73 Ga0068855_100871656 3300005563 Bacteria 953
74 Ga0068855_101397701 3300005563 Bacteria 721
75 Ga0070664_101006141 3300005564 Bacteria 783
76 Ga0068857_100006900 3300005577 Bacteria 9778
77 Ga0068857_100764299 3300005577 Bacteria 921
78 Ga0068854_100252152 3300005578 Bacteria 1410
79 Ga0068856_100204450 3300005614 Bacteria 1989
80 Ga0070702_100085859 3300005615 Bacteria 1896
81 Ga0070702_100820585 3300005615 Bacteria 721
82 Ga0068859_100987732 3300005617 Bacteria 924
83 Ga0068864_101425993 3300005618 Bacteria 695
84 Ga0068866_10135083 3300005718 Bacteria 1408
85 Ga0068861_100009466 3300005719 Bacteria 6727
86 Ga0068861_100285868 3300005719 Bacteria 1422
87 Ga0068861_100493053 3300005719 Bacteria 1106
88 Ga0068861_100721305 3300005719 Bacteria 928
89 Ga0068851_10068958 3300005834 Bacteria 1826
90 Ga0068870_10070878 3300005840 Bacteria 1901
91 Ga0068870_10305543 3300005840 Bacteria 1006
92 Ga0068870_10473471 3300005840 Bacteria 830
93 Ga0068863_100074561 3300005841 Bacteria 3210
94 Ga0068863_101709095 3300005841 Bacteria 639
95 Ga0068863_102731249 3300005841 Bacteria 502
96 Ga0068858_100132976 3300005842 Bacteria 2333
97 Ga0068858_101228716 3300005842 Bacteria 737
98 Ga0068860_100833457 3300005843 Bacteria 936
99 Ga0068860_101656283 3300005843 Bacteria 662
100 Ga0068862_100001097 3300005844 Bacteria 25721
101 Ga0068862_100187986 3300005844 Bacteria 1857
102 Ga0081540_1000418 3300005983 Bacteria 41960
103 Ga0081540_1003610 3300005983 Bacteria 12143
104 Ga0070717_10690272 3300006028 Bacteria 927
105 Ga0070717_11346864 3300006028 Bacteria 649
106 Ga0070717_11398608 3300006028 Bacteria 635
107 Ga0075363_100059487 3300006048 Bacteria 2055
108 Ga0075363_100761938 3300006048 Bacteria 587
109 Ga0070715_10004363 3300006163 Bacteria 4632
110 Ga0070715_10236204 3300006163 Bacteria 948
111 Ga0070715_10271924 3300006163 Bacteria 894
112 Ga0070715_10622344 3300006163 Bacteria 635
113 Ga0070716_100002101 3300006173 Bacteria 9144
114 Ga0070716_100070812 3300006173 Bacteria 2049
115 Ga0070712_100101407 3300006175 Bacteria 2129
116 Ga0070712_100205069 3300006175 Bacteria 1551
117 Ga0070712_100410336 3300006175 Bacteria 1120
118 Ga0070712_100595275 3300006175 Bacteria 935
119 Ga0070712_100871148 3300006175 Bacteria 775
120 Ga0097621_100053971 3300006237 Bacteria 3276
121 Ga0097621_101371163 3300006237 Bacteria 669
122 Ga0075370_10210617 3300006353 Bacteria 1147
123 Ga0068871_100330873 3300006358 Bacteria 1343
124 Ga0068871_100709270 3300006358 Bacteria 922
125 Ga0075430_101377339 3300006846 Bacteria 580
126 Ga0075433_10026480 3300006852 Bacteria 4909
127 Ga0075433_10034341 3300006852 Bacteria 4355
128 Ga0075433_10087301 3300006852 Bacteria 2755
129 Ga0075434_100021240 3300006871 Bacteria 6310
130 Ga0075434_100139107 3300006871 Bacteria 2447
131 Ga0075434_100223160 3300006871 Bacteria 1904
132 Ga0075434_100355709 3300006871 Bacteria 1485
133 Ga0075434_101926761 3300006871 Bacteria 597
134 Ga0075436_100048029 3300006914 Bacteria 2945
135 Ga0075436_100058006 3300006914 Bacteria 2674
136 Ga0075436_100108942 3300006914 Bacteria 1932
137 Ga0075436_100224411 3300006914 Bacteria 1333
138 Ga0075436_100373291 3300006914 Bacteria 1030
139 Ga0075436_100871238 3300006914 Bacteria 673
140 Ga0075436_101418881 3300006914 Bacteria 526
141 Ga0097620_100987801 3300006931 Bacteria 924
142 Ga0075435_100004226 3300007076 Bacteria 9863
143 Ga0075435_100089409 3300007076 Bacteria 2539
144 Ga0075435_100215751 3300007076 Bacteria 1628
145 Ga0075435_100393325 3300007076 Bacteria 1191
146 Ga0075435_100449985 3300007076 Bacteria 1110
147 Ga0099795_10014819 3300007788 Bacteria 2426
148 Ga0105251_10088065 3300009011 Bacteria 1429
149 Ga0105244_10225861 3300009036 Bacteria 877
150 Ga0111539_10038604 3300009094 Bacteria 5761
151 Ga0111539_10097899 3300009094 Bacteria 3446
152 Ga0111539_10740945 3300009094 Bacteria 1144
153 Ga0111539_11638193 3300009094 Bacteria 746
154 Ga0105245_11038406 3300009098 Bacteria 865
155 Ga0105247_10628585 3300009101 Bacteria 799
156 Ga0114129_10348488 3300009147 Bacteria 1962
157 Ga0114129_11931908 3300009147 Bacteria 715
158 Ga0114129_13502405 3300009147 Bacteria 502
159 Ga0105243_10166080 3300009148 Bacteria 1908
160 Ga0105243_11115712 3300009148 Bacteria 798
161 Ga0105241_10719770 3300009174 Bacteria 913
162 Ga0105242_12297044 3300009176 Bacteria 586
163 Ga0105248_10157592 3300009177 Bacteria 2562
164 Ga0105248_10513654 3300009177 Bacteria 1351
165 Ga0105237_10774443 3300009545 Bacteria 966
166 Ga0105237_11303554 3300009545 Bacteria 733
167 Ga0105238_10865971 3300009551 Bacteria 921
168 Ga0105249_10029690 3300009553 Bacteria 4938
169 Ga0099796_10363605 3300010159 Bacteria 627
170 Ga0105239_11631535 3300010375 Bacteria 746
171 Ga0105246_10085877 3300011119 Bacteria 2254
172 Ga0105246_10543380 3300011119 Bacteria 994
173 Ga0157328_1022443 3300012478 Bacteria 543
174 Ga0157339_1002666 3300012505 Bacteria 1226
175 Ga0157326_1040834 3300012513 Bacteria 650
176 Ga0157338_1002501 3300012515 Bacteria 1446
177 Ga0157373_10222256 3300013100 Bacteria 1332
178 Ga0157373_10555648 3300013100 Bacteria 833
179 Ga0157371_10101909 3300013102 Bacteria 2036
180 Ga0157370_10169747 3300013104 Bacteria 2028
181 Ga0157369_10239005 3300013105 Bacteria 1897
182 Ga0157374_11190424 3300013296 Bacteria 783
183 Ga0157378_11296882 3300013297 Bacteria 769
184 Ga0163162_10042065 3300013306 Bacteria 4572
185 Ga0163162_10816766 3300013306 Bacteria 1049
186 Ga0157372_10478347 3300013307 Bacteria 1452
187 Ga0157375_11095280 3300013308 Bacteria 932
188 Ga0157375_12600365 3300013308 Bacteria 605
189 Ga0157375_12857384 3300013308 Bacteria 577
190 Ga0163163_10186551 3300014325 Bacteria 2122
191 Ga0163163_12992319 3300014325 Bacteria 527
192 Ga0157380_10016449 3300014326 Bacteria 5456
193 Ga0157380_10433728 3300014326 Bacteria 1257
194 Ga0157380_12315990 3300014326 Bacteria 602
195 Ga0182008_10051548 3300014497 Bacteria 2041
196 Ga0157377_10349128 3300014745 Bacteria 992
197 Ga0157379_10978499 3300014968 Bacteria 806
198 Ga0157379_12307829 3300014968 Bacteria 536
199 Ga0157376_10124403 3300014969 Bacteria 2291
200 Ga0157376_10721288 3300014969 Bacteria 1004
201 Ga0157376_11148906 3300014969 Bacteria 803
202 Ga0163161_11808455 3300017792 Bacteria 543
203 Ga0206356_11142786 3300020070 Bacteria 777
204 Ga0206354_11416015 3300020081 Bacteria 1563
205 Ga0206353_11964218 3300020082 Bacteria 821
206 Ga0213876_10589304 3300021384 Bacteria 591
207 Ga0213875_10197125 3300021388 Bacteria 947
208 Ga0224712_10068032 3300022467 Bacteria 1438
209 Ga0207653_10254887 3300025885 Bacteria 673
210 Ga0207692_10000516 3300025898 Bacteria 13691
211 Ga0207692_10003266 3300025898 Bacteria 6313
212 Ga0207692_10009181 3300025898 Bacteria 4120
213 Ga0207692_10126281 3300025898 Bacteria 1439
214 Ga0207692_10599141 3300025898 Bacteria 708
215 Ga0207692_10950949 3300025898 Bacteria 566
216 Ga0207688_10018534 3300025901 Bacteria 3786
217 Ga0207680_10371383 3300025903 Bacteria 1007
218 Ga0207647_10242209 3300025904 Bacteria 1036
219 Ga0207685_10001304 3300025905 Bacteria 5125
220 Ga0207685_10021515 3300025905 Bacteria 2163
221 Ga0207685_10411756 3300025905 Bacteria 695
222 Ga0207699_10005025 3300025906 Bacteria 6327
223 Ga0207699_10006331 3300025906 Bacteria 5723
224 Ga0207699_10190659 3300025906 Bacteria 1383
225 Ga0207699_10829875 3300025906 Bacteria 680
226 Ga0207645_10315613 3300025907 Bacteria 1042
227 Ga0207643_10151117 3300025908 Bacteria 1392
228 Ga0207643_10284345 3300025908 Bacteria 1026
229 Ga0207643_10363010 3300025908 Bacteria 911
230 Ga0207705_10283235 3300025909 Bacteria 1269
231 Ga0207684_11270316 3300025910 Bacteria 607
232 Ga0207707_10823061 3300025912 Bacteria 772
233 Ga0207695_11140546 3300025913 Bacteria 660
234 Ga0207671_10303869 3300025914 Bacteria 1261
235 Ga0207693_10006195 3300025915 Bacteria 9927
236 Ga0207693_10034572 3300025915 Bacteria 3986
237 Ga0207693_10127732 3300025915 Bacteria 1998
238 Ga0207693_10300961 3300025915 Bacteria 1256
239 Ga0207693_10451086 3300025915 Bacteria 1005
240 Ga0207663_10075004 3300025916 Bacteria 2193
241 Ga0207663_10265521 3300025916 Bacteria 1269
242 Ga0207663_10373075 3300025916 Bacteria 1085
243 Ga0207663_11062481 3300025916 Bacteria 650
244 Ga0207663_11062959 3300025916 Bacteria 650
245 Ga0207660_10728211 3300025917 Bacteria 809
246 Ga0207660_11125624 3300025917 Bacteria 639
247 Ga0207662_10003184 3300025918 Bacteria 8397
248 Ga0207657_10041532 3300025919 Bacteria 4067
249 Ga0207649_11119969 3300025920 Bacteria 621
250 Ga0207652_10408937 3300025921 Bacteria 1224
251 Ga0207646_10175996 3300025922 Bacteria 1933
252 Ga0207646_10253227 3300025922 Bacteria 1591
253 Ga0207681_10014402 3300025923 Bacteria 4913
254 Ga0207681_11121804 3300025923 Bacteria 661
255 Ga0207650_10079370 3300025925 Bacteria 2485
256 Ga0207659_11589341 3300025926 Bacteria 558
257 Ga0207700_10013313 3300025928 Bacteria 5346
258 Ga0207700_10028057 3300025928 Bacteria 3950
259 Ga0207700_10365850 3300025928 Bacteria 1258
260 Ga0207700_10587930 3300025928 Bacteria 990
261 Ga0207700_11902607 3300025928 Bacteria 521
262 Ga0207664_10005270 3300025929 Bacteria 8832
263 Ga0207664_10010793 3300025929 Bacteria 6464
264 Ga0207664_10185556 3300025929 Bacteria 1788
265 Ga0207664_10219485 3300025929 Bacteria 1648
266 Ga0207644_10236877 3300025931 Bacteria 1452
267 Ga0207644_11530445 3300025931 Bacteria 560
268 Ga0207690_11784624 3300025932 Bacteria 514
269 Ga0207706_10018518 3300025933 Bacteria 6266
270 Ga0207706_10071500 3300025933 Bacteria 3051
271 Ga0207706_10353717 3300025933 Bacteria 1277
272 Ga0207709_10526287 3300025935 Bacteria 926
273 Ga0207669_10284603 3300025937 Bacteria 1249
274 Ga0207665_10000965 3300025939 Bacteria 19469
275 Ga0207665_10001409 3300025939 Bacteria 16174
276 Ga0207665_10015829 3300025939 Bacteria 4950
277 Ga0207665_10024415 3300025939 Bacteria 3985
278 Ga0207665_10119777 3300025939 Bacteria 1858
279 Ga0207665_10406103 3300025939 Bacteria 1038
280 Ga0207691_10164220 3300025940 Bacteria 1946
281 Ga0207691_10328903 3300025940 Bacteria 1310
282 Ga0207711_10206406 3300025941 Bacteria 1794
283 Ga0207711_10675071 3300025941 Bacteria 964
284 Ga0207689_10096944 3300025942 Bacteria 2422
285 Ga0207689_11300668 3300025942 Bacteria 611
286 Ga0207679_11037961 3300025945 Bacteria 752
287 Ga0207679_11330975 3300025945 Bacteria 659
288 Ga0207667_10272065 3300025949 Bacteria 1732
289 Ga0207667_11034372 3300025949 Bacteria 807
290 Ga0207651_10170329 3300025960 Bacteria 1717
291 Ga0207712_10011961 3300025961 Bacteria 5537
292 Ga0207668_11441842 3300025972 Bacteria 621
293 Ga0207640_12125479 3300025981 Bacteria 509
294 Ga0207658_10651999 3300025986 Bacteria 949
295 Ga0207677_11600309 3300026023 Bacteria 603
296 Ga0207639_10362304 3300026041 Bacteria 1297
297 Ga0207639_11963033 3300026041 Bacteria 546
298 Ga0207678_10001978 3300026067 Bacteria 18679
299 Ga0207708_10203026 3300026075 Bacteria 1582
300 Ga0207708_10859966 3300026075 Bacteria 783
301 Ga0207708_11323004 3300026075 Bacteria 631
302 Ga0207702_10180591 3300026078 Bacteria 1943
303 Ga0207641_11351953 3300026088 Bacteria 713
304 Ga0207648_10038436 3300026089 Bacteria 4211
305 Ga0207648_10516891 3300026089 Bacteria 1094
306 Ga0207648_11725591 3300026089 Bacteria 588
307 Ga0207676_11028594 3300026095 Bacteria 812
308 Ga0207676_11163523 3300026095 Bacteria 764
309 Ga0207674_10000575 3300026116 Bacteria 48309
310 Ga0207674_10022775 3300026116 Bacteria 6723
311 Ga0207674_11000060 3300026116 Bacteria 805
312 Ga0207675_100012053 3300026118 Bacteria 8076
313 Ga0207675_100085736 3300026118 Bacteria 2956
314 Ga0207675_101298819 3300026118 Bacteria 748
315 Ga0207683_10001492 3300026121 Bacteria 21111
316 Ga0207683_10408871 3300026121 Bacteria 1249
317 Ga0207428_10856702 3300027907 Bacteria 643
318 Ga0207428_11161122 3300027907 Bacteria 538
319 Ga0268266_10370707 3300028379 Bacteria 1348
320 Ga0268265_10007264 3300028380 Bacteria 7487
321 Ga0268265_10518132 3300028380 Bacteria 1127
322 Ga0307512_10035060 3300030522 Bacteria 4283
323 Ga0307508_10438072 3300031616 Bacteria 899
324 Ga0307413_10366257 3300031824 Bacteria 1118
325 Ga0307410_10417402 3300031852 Bacteria 1088
326 Ga0307412_10757505 3300031911 Bacteria 839
327 Ga0307409_100327990 3300031995 Bacteria 1435
328 Ga0307409_102208607 3300031995 Bacteria 580
329 Ga0307414_12107261 3300032004 Bacteria 527
330 Ga0307411_12072222 3300032005 Bacteria 532
331 Ga0373930_0032304 3300034816 Bacteria 1082
332 Ga0373948_0047412 3300034817 Bacteria 915
333 Ga0373948_0057338 3300034817 Bacteria 849
334 Ga0373950_0008490 3300034818 Bacteria 1619
335 Ga0373938_0005814 3300034957 Bacteria 2108
336 Ga0373938_0217969 3300034957 Bacteria 535
337 Ga0373926_0003421 3300035083 Bacteria 5117
338 Ga0373926_0022088 3300035083 Bacteria 2207
339 Ga0373928_0007899 3300035084 Bacteria 2060
340 Ga0373928_0033487 3300035084 Bacteria 1149
341 Ga0373929_0025586 3300035085 Bacteria 1227
342 Ga0373929_0240087 3300035085 Bacteria 522
343 Ga0373934_0009155 3300035086 Bacteria 3706
344 Ga0373934_0021869 3300035086 Bacteria 2465
345 Ga0373934_0058973 3300035086 Bacteria 1527
346 Ga0373934_0422132 3300035086 Bacteria 558
347 Ga0373940_0005254 3300035088 Bacteria 2793
348 Ga0373944_0002838 3300035089 Bacteria 4434
349 Ga0373944_0006088 3300035089 Bacteria 3195
350 Ga0373949_0003896 3300035090 Bacteria 3465
351 Ga0373951_0223628 3300035091 Bacteria 556
352 Ga0373952_0063717 3300035092 Bacteria 907
353 Ga0373952_0218077 3300035092 Bacteria 565
354 Ga0373923_0009153 3300035111 Bacteria 3562
355 Ga0373923_0009769 3300035111 Bacteria 3470
356 Ga0373923_0393351 3300035111 Bacteria 666
357 Ga0373932_0025057 3300035112 Bacteria 1611
358 Ga0373932_0055511 3300035112 Bacteria 1188
359 Ga0373936_0003295 3300035113 Bacteria 6053
360 Ga0373936_0018536 3300035113 Bacteria 2689
361 Ga0373936_0051648 3300035113 Bacteria 1664
362 Ga0373936_0145719 3300035113 Bacteria 1024
363 Ga0373939_0128913 3300035114 Bacteria 900
364 Ga0373941_0068471 3300035115 Bacteria 1172
365 Ga0373945_0000807 3300035116 Bacteria 9175
366 Ga0373945_0007249 3300035116 Bacteria 3589
367 Ga0373953_0117885 3300035117 Bacteria 1126
368 Ga0373954_0045889 3300035118 Bacteria 2042
369 Ga0373954_0290188 3300035118 Bacteria 806
370 Ga0373954_0420552 3300035118 Bacteria 661
371 Ga0373956_0009789 3300035119 Bacteria 3905
372 Ga0373957_0012545 3300035120 Bacteria 2856
373 Ga0373957_0348565 3300035120 Bacteria 632
374 Ga0373960_0002730 3300035121 Bacteria 3992
375 Ga0373960_0093362 3300035121 Bacteria 965
376 Ga0373943_0000935 3300035170 Bacteria 12873
377 Ga0373943_0029068 3300035170 Bacteria 2609
378 Ga0373946_0000200 3300035171 Bacteria 18482
379 Ga0373946_0034635 3300035171 Bacteria 2039
380 Ga0373955_0017179 3300035172 Bacteria 3575
381 Ga0373955_0252453 3300035172 Bacteria 1057
382 Ga0373942_0003359 3300035207 Bacteria 3763
383 Ga0373942_0006244 3300035207 Bacteria 2750
384 Ga0373961_0406825 3300035241 Bacteria 523
385 Ga0373962_0068187 3300035242 Bacteria 1057
386 Ga0373924_0002451 3300035410 Bacteria 6245
387 Ga0373924_0002777 3300035410 Bacteria 5907
388 Ga0373924_0217349 3300035410 Bacteria 844
389 Ga0373931_0039346 3300035691 Bacteria 2477
390 Ga0373935_0039220 3300035692 Bacteria 2969
391 Ga0373935_0043893 3300035692 Bacteria 2815
392 Ga0373935_0210009 3300035692 Bacteria 1348
393 Ga0373935_0944719 3300035692 Bacteria 639
394 Ga0373935_1012600 3300035692 Bacteria 617
395 Ga0373927_0001422 3300035695 Bacteria 18048
396 Ga0373927_0023137 3300035695 Bacteria 4069
397 Ga0373927_0516803 3300035695 Bacteria 789
398 Ga0373927_0549276 3300035695 Bacteria 763
399 Ga0373933_0002802 3300035724 Bacteria 9739
400 Ga0373933_0002922 3300035724 Bacteria 9545
401 Ga0373933_0056646 3300035724 Bacteria 2353
402 Ga0373947_0009282 3300035725 Bacteria 5652
403 Ga0373947_0135629 3300035725 Bacteria 1574
404 Ga0373947_0251706 3300035725 Bacteria 1168
405 Ga0373937_0002675 3300036401 Bacteria 14854
406 Ga0373937_0135375 3300036401 Bacteria 2303
407 Ga0373937_0265123 3300036401 Bacteria 1620
408 Ga0373937_0603807 3300036401 Bacteria 1041
409 Ga0373925_0013179 3300037068 Bacteria 5984
410 Ga0373925_0017046 3300037068 Bacteria 5257
411 Ga0373925_0115143 3300037068 Bacteria 2081
412 Ga0373925_0300704 3300037068 Bacteria 1295
413 Ga0436364_0217374 3300037853 Bacteria 3079
414 Ga0436364_1445614 3300037853 Bacteria 1165
415 Ga0242420_135191 3300038996 Bacteria 546
416 Ga0436365_0843559 3300039437 Bacteria 2521
417 Ga0436365_1450088 3300039437 Bacteria 2372
418 Ga0436365_1826404 3300039437 Bacteria 632
419 Ga0439465_0048631 3300041413 Bacteria 1384
420 Ga0451851_0087590 3300041507 Bacteria 635
421 Ga0451853_0613802 3300041512 Bacteria 503
422 Ga0466969_0460774 3300044656 Bacteria 579
423 Ga0466959_1092913 3300045049 Bacteria 530
424 Ga0466967_0129695 3300045976 Bacteria 2339
425 Ga0466967_0324639 3300045976 Bacteria 1485
426 Ga0466967_0655766 3300045976 Bacteria 1038
427 Ga0495592_0196930 3300046454 Bacteria 1362
428 Ga0495592_0256119 3300046454 Bacteria 1154
429 Ga0495603_0110158 3300046455 Bacteria 1606
430 Ga0495603_0553859 3300046455 Bacteria 658
431 Ga0495629_0008068 3300046459 Bacteria 7751
432 Ga0495629_0298349 3300046459 Bacteria 1104
433 Ga0495641_0009313 3300046461 Bacteria 5845
434 Ga0495641_0018109 3300046461 Bacteria 3644
435 Ga0495641_0083092 3300046461 Bacteria 1434
436 Ga0495651_0026946 3300046462 Bacteria 4474
437 Ga0495651_0029437 3300046462 Bacteria 4282
438 Ga0495651_0042541 3300046462 Bacteria 3527
439 Ga0495651_0080263 3300046462 Bacteria 2464
440 Ga0495651_0187652 3300046462 Bacteria 1457
441 Ga0495651_0228359 3300046462 Bacteria 1284
442 Ga0495653_0006274 3300046463 Bacteria 9756
443 Ga0495653_0008853 3300046463 Bacteria 8236
444 Ga0495653_0016305 3300046463 Bacteria 6053
445 Ga0495653_0086831 3300046463 Bacteria 2298
446 Ga0495653_0155135 3300046463 Bacteria 1595
447 Ga0495580_0009659 3300046472 Bacteria 7575
448 Ga0495582_0107913 3300046473 Bacteria 1563
449 Ga0495639_0006854 3300046475 Bacteria 4896
450 Ga0495639_0037370 3300046475 Bacteria 2176
451 Ga0495639_0252273 3300046475 Bacteria 872
452 Ga0495662_0030369 3300046476 Bacteria 2608
453 Ga0495664_0016927 3300046477 Bacteria 4163
454 Ga0495594_0061940 3300046499 Bacteria 2071
455 Ga0495608_0030126 3300046511 Bacteria 3676
456 Ga0495608_0038464 3300046511 Bacteria 3212
457 Ga0495608_0105052 3300046511 Bacteria 1818
458 Ga0495608_0194249 3300046511 Bacteria 1280
459 Ga0495608_0323557 3300046511 Bacteria 952
460 Ga0495618_0027137 3300046514 Bacteria 3565
461 Ga0495618_0031379 3300046514 Bacteria 3323
462 Ga0495618_0045793 3300046514 Bacteria 2760
463 Ga0495618_0228039 3300046514 Bacteria 1173
464 Ga0495628_0065703 3300046516 Bacteria 2836
465 Ga0495628_0157424 3300046516 Bacteria 1727
466 Ga0495628_0465475 3300046516 Bacteria 916
467 Ga0495630_0081325 3300046517 Bacteria 2444
468 Ga0495630_0158809 3300046517 Bacteria 1721
469 Ga0495666_0004794 3300046526 Bacteria 6837
470 Ga0495666_0269218 3300046526 Bacteria 774
471 Ga0495652_0062991 3300046529 Bacteria 3124
472 Ga0495652_0097360 3300046529 Bacteria 2393
473 Ga0495652_0174621 3300046529 Bacteria 1655
474 Ga0495652_0244853 3300046529 Bacteria 1332
475 Ga0495652_0703882 3300046529 Bacteria 679
476 Ga0495652_0744259 3300046529 Bacteria 656
477 Ga0495665_0002478 3300046531 Bacteria 9974
478 Ga0495665_0013868 3300046531 Bacteria 4354
479 Ga0495665_0042846 3300046531 Bacteria 2408
480 Ga0495640_0028514 3300046533 Bacteria 4019
481 Ga0495640_0037867 3300046533 Bacteria 3397
482 Ga0495640_0057785 3300046533 Bacteria 2647
483 Ga0495586_0003236 3300046535 Bacteria 8751
484 Ga0495586_0204394 3300046535 Bacteria 1120
485 Ga0495586_0257205 3300046535 Bacteria 997
486 Ga0495587_0048909 3300046536 Bacteria 2504
487 Ga0495587_0050407 3300046536 Bacteria 2463
488 Ga0495587_0050482 3300046536 Bacteria 2461
489 Ga0495587_0182834 3300046536 Bacteria 1188
490 Ga0495587_0183028 3300046536 Bacteria 1187
491 Ga0495645_0031745 3300046543 Bacteria 3849
492 Ga0495645_0160514 3300046543 Bacteria 1554
493 Ga0495667_0023763 3300046559 Bacteria 4128
494 Ga0495667_0028239 3300046559 Bacteria 3776
495 Ga0495667_0303920 3300046559 Bacteria 1010
496 Ga0495667_0419166 3300046559 Bacteria 843
497 Ga0495634_0136437 3300046642 Bacteria 1560
498 Ga0495634_0866774 3300046642 Bacteria 512
499 Ga0495635_0003705 3300046663 Bacteria 10595
500 Ga0495635_0005109 3300046663 Bacteria 9127
501 Ga0495635_0015693 3300046663 Bacteria 5292
502 Ga0495635_0083959 3300046663 Bacteria 2179
503 Ga0495635_0271075 3300046663 Bacteria 1141
504 Ga0495635_0280843 3300046663 Bacteria 1118
505 Ga0495635_0962620 3300046663 Bacteria 544
506 Ga0495588_0033876 3300046674 Bacteria 2583
507 Ga0495657_0029264 3300046675 Bacteria 3865
508 Ga0495657_0060401 3300046675 Bacteria 2511
509 Ga0495657_0132016 3300046675 Bacteria 1563
510 Ga0495657_0137768 3300046675 Bacteria 1523
511 Ga0495657_0309587 3300046675 Bacteria 940
512 Ga0495599_0026110 3300046678 Bacteria 3659
513 Ga0495599_0033261 3300046678 Bacteria 3239
514 Ga0495599_0094151 3300046678 Bacteria 1868
515 Ga0495599_0248152 3300046678 Bacteria 1084
516 Ga0495599_0554701 3300046678 Bacteria 672
517 Ga0495623_0026135 3300046679 Bacteria 3759
518 Ga0495623_0122349 3300046679 Bacteria 1565
519 Ga0495623_0681142 3300046679 Bacteria 528
520 Ga0495646_0032605 3300046680 Bacteria 3241
521 Ga0495647_0023289 3300046681 Bacteria 2244
522 Ga0495647_0164044 3300046681 Bacteria 959
523 Ga0495658_0010635 3300046683 Bacteria 4605
524 Ga0495613_0141100 3300046689 Bacteria 1721
525 Ga0495613_0616066 3300046689 Bacteria 721
526 Ga0495624_0184239 3300046690 Bacteria 1271
527 Ga0495600_0054353 3300046809 Bacteria 2615
528 Ga0495600_0077236 3300046809 Bacteria 2174
529 Ga0495600_0192725 3300046809 Bacteria 1310
530 Ga0495600_0192728 3300046809 Bacteria 1310
531 Ga0495600_0444409 3300046809 Bacteria 802
532 Ga0495581_0006465 3300047315 Bacteria 6801
533 Ga0495581_0075278 3300047315 Bacteria 1953
534 Ga0495581_0139805 3300047315 Bacteria 1412
535 Ga0495581_0585459 3300047315 Bacteria 647
536 Ga0495604_0028216 3300047317 Bacteria 4464
537 Ga0495604_0676848 3300047317 Bacteria 656
538 Ga0495604_0738607 3300047317 Bacteria 623
539 Ga0495674_0004138 3300047319 Bacteria 14007
540 Ga0495674_0096391 3300047319 Bacteria 2521
541 Ga0495674_0244883 3300047319 Bacteria 1476
542 Ga0495674_0538717 3300047319 Bacteria 930
543 Ga0495674_0613830 3300047319 Bacteria 860
544 Ga0495674_0912432 3300047319 Bacteria 677
545 Ga0495676_0003741 3300047321 Bacteria 13817
546 Ga0495676_0074749 3300047321 Bacteria 2593
547 Ga0495676_0545012 3300047321 Bacteria 758
548 Ga0495680_0004413 3300047322 Bacteria 13446
549 Ga0495680_0026269 3300047322 Bacteria 4803
550 Ga0495680_0028999 3300047322 Bacteria 4535
551 Ga0495680_0072317 3300047322 Bacteria 2623
552 Ga0495675_0091500 3300047444 Bacteria 1909
553 Ga0495675_0092683 3300047444 Bacteria 1895
554 Ga0495675_0224953 3300047444 Bacteria 1134
555 Ga0495684_0028869 3300047471 Bacteria 4258
556 Ga0495684_0036436 3300047471 Bacteria 3771
557 Ga0495684_0036852 3300047471 Bacteria 3749
558 Ga0495684_0051562 3300047471 Bacteria 3140
559 Ga0495684_0088602 3300047471 Bacteria 2345
560 Ga0495684_0213553 3300047471 Bacteria 1417
561 Ga0495593_0045643 3300047673 Bacteria 2337
562 Ga0495593_0279986 3300047673 Bacteria 834
563 Ga0495602_0051278 3300048088 Bacteria 3676
564 Ga0495602_0076796 3300048088 Bacteria 2828
565 Ga0495602_0126122 3300048088 Bacteria 2050
566 Ga0495602_0153066 3300048088 Bacteria 1810
567 Ga0495602_0451297 3300048088 Bacteria 907
568 Ga0495614_0299785 3300048089 Bacteria 743
569 Ga0496100_0008258 3300048903 Bacteria 5801
570 Ga0496100_0898523 3300048903 Bacteria 695
571 Ga0496101_0003684 3300048904 Bacteria 9563
572 Ga0496101_0268900 3300048904 Bacteria 1330
573 Ga0496102_0152718 3300048905 Bacteria 2170
574 Ga0496102_0781052 3300048905 Bacteria 877
575 Ga0496104_0038396 3300048907 Bacteria 4480
576 Ga0496104_0413776 3300048907 Bacteria 1260
577 Ga0496104_0437330 3300048907 Bacteria 1220
578 Ga0496104_1126450 3300048907 Bacteria 688
579 Ga0496105_0012631 3300048908 Bacteria 6687
580 Ga0496105_0222698 3300048908 Bacteria 1535
581 Ga0496106_0103832 3300048909 Bacteria 2206
582 Ga0496106_0489093 3300048909 Bacteria 988
583 Ga0496106_0875637 3300048909 Bacteria 710
584 Ga0496107_0133092 3300048910 Bacteria 1836
585 Ga0496107_0146425 3300048910 Bacteria 1746
586 Ga0496108_0198990 3300048911 Bacteria 1738
587 Ga0496109_0150987 3300048912 Bacteria 2175
588 Ga0496109_2064414 3300048912 Bacteria 502
589 Ga0496110_0353999 3300048913 Bacteria 1337
590 Ga0496111_0084120 3300048914 Bacteria 2325
591 Ga0496111_0950640 3300048914 Bacteria 617
592 Ga0496112_0138711 3300048915 Bacteria 2401
593 Ga0496112_0195086 3300048915 Bacteria 1986
594 Ga0496112_0698221 3300048915 Bacteria 942
595 Ga0496113_0475075 3300048916 Bacteria 1004
596 Ga0496113_0545015 3300048916 Bacteria 930
597 Ga0496114_0024992 3300048917 Bacteria 4878
598 Ga0496114_0889360 3300048917 Bacteria 771
599 Ga0496115_0001929 3300048918 Bacteria 14801
600 Ga0496115_0109402 3300048918 Bacteria 2269
601 Ga0496126_0288529 3300048929 Bacteria 1358
602 Ga0501038_0240949 3300049574 Bacteria 1436
603 Ga0501040_0776744 3300049576 Bacteria 693
604 Ga0501068_0182314 3300049584 Bacteria 1328
605 Ga0501070_0000637 3300049586 Bacteria 32300
606 Ga0501070_0122536 3300049586 Bacteria 2149
607 Ga0501072_0772038 3300049588 Bacteria 753
608 Ga0501073_0559315 3300049589 Bacteria 790
609 Ga0501074_0145312 3300049590 Bacteria 1696
610 Ga0501075_0962908 3300049591 Unclassified 648
611 Ga0501077_0769086 3300049593 Bacteria 619
612 Ga0501079_0777583 3300049741 Bacteria 754
613 Ga0501081_0505499 3300049743 Unclassified 901
614 Ga0501083_0469575 3300049744 Bacteria 819
615 Ga0501035_0656162 3300049822 Bacteria 850
616 Ga0501045_0099657 3300049824 Bacteria 2150
617 nmdc:mga06z11_529930_c1 3300050494 Bacteria 714
618 nmdc:mga07m45_34924_c2 3300050496 Bacteria 2275
619 nmdc:mga05p37_1651410_c1 3300050507 Bacteria 628
620 nmdc:mga05p37_1976367_c1 3300050507 Bacteria 553
621 nmdc:mga05p37_297012_c1 3300050507 Bacteria 1921
622 nmdc:mga05p37_530741_c1 3300050507 Bacteria 1344
623 nmdc:mga05p37_942279_c1 3300050507 Unclassified 925
624 nmdc:mga08y16_56631_c1 3300050511 Bacteria 4096
625 nmdc:mga08y16_570618_c1 3300050511 Bacteria 1143
626 nmdc:mga0n895_416005_c1 3300050512 Bacteria 1359
627 nmdc:mga0n895_54619_c1 3300050512 Bacteria 3930
628 nmdc:mga0n895_7786_c1 3300050512 Bacteria 9230
629 nmdc:mga0n895_806938_c1 3300050512 Bacteria 928
630 nmdc:mga0n895_95999_c1 3300050512 Bacteria 2970
631 nmdc:mga0rr50_257285_c1 3300050513 Bacteria 1452
632 nmdc:mga0rr50_392444_c1 3300050513 Bacteria 1172
633 nmdc:mga0rr50_526663_c1 3300050513 Bacteria 1006
634 nmdc:mga08x19_159514_c1 3300050514 Bacteria 1531
635 nmdc:mga08x19_22661_c1 3300050514 Bacteria 3889
636 nmdc:mga08x19_7206_c1 3300050514 Bacteria 6604
637 nmdc:mga0a205_105188_c2 3300050515 Bacteria 1641
638 nmdc:mga0a205_15490_c1 3300050515 Bacteria 7126
639 nmdc:mga0a205_314510_c1 3300050515 Bacteria 1438
640 Ga0495601_0037942 3300053077 Bacteria 3011
641 Ga0495612_0021191 3300053078 Bacteria 2607
642 Ga0495612_0031118 3300053078 Bacteria 2151
643 Ga0495612_0071949 3300053078 Bacteria 1443
644 Ga0495595_0057682 3300053084 Bacteria 1811
645 Ga0495595_0070509 3300053084 Bacteria 1651
646 Ga0495619_0096964 3300053085 Bacteria 2003
647 Ga0495619_0101446 3300053085 Bacteria 1959
648 Ga0500568_0289327 3300053139 Bacteria 595
649 Ga0500616_0157262 3300053153 Bacteria 1045
650 Ga0501084_0864488 3300054114 Unclassified 761
651 Ga0501082_0260956 3300060353 Bacteria 1507
652 Ga0530510_0073033 3300061734 Bacteria 2490
653 2515757696 2515154137 Bacteria 5711575
654 2516091277 2515154203 Bacteria 5458536
655 2837270612 2837268691 Bacteria 7850704
656 2855680802 2855676851 Bacteria 7063653
657 2858849563 2858848962 Bacteria 6963058
658 2858892868 2858888857 Bacteria 7060307
659 2858895785 2858895516 Bacteria 7378898
660 2866617699 2866612099 Bacteria 7543886
661 2868089638 2868088558 Bacteria 7609351
662 2869049031 2869048445 Bacteria 6875584
663 2880491051 2880489317 Bacteria 7096270
664 2880501437 2880495981 Bacteria 7340502
665 2929229924 2929226422 Bacteria 7248583
666 8003874426 8003870546 Bacteria 7396674
667 8054706456 8054704163 Bacteria 7247792
668 8054730206 8054727385 Bacteria 7558670
669 8054738227 8054734606 Bacteria 6947278
670 Ga0070716_100432784
671 JGI24740J21852_10132250
672 JGI25404J52841_10006383
673 JGI25404J52841_10091599
674 Ga0070658_10230584
675 Ga0070676_10245309
676 Ga0070683_100148201
677 Ga0070690_100231494
678 Ga0070670_100949126
679 Ga0070666_10038443
680 Ga0070680_100235575
681 Ga0070682_100534503
682 Ga0068868_101432813
683 Ga0070689_100535274
684 Ga0070691_10034609
685 Ga0070692_10053418
686 Ga0070668_100000526
687 Ga0070668_101532207
688 Ga0070669_100396502
689 Ga0070671_100645246
690 Ga0070671_101575242
691 Ga0070674_100229780
692 Ga0070673_100557500
693 Ga0070673_101009242
694 Ga0070688_100042050
695 Ga0070659_100046902
696 Ga0070667_100474056
697 Ga0070703_10316341
698 Ga0070709_10360543
699 Ga0070709_11104166
700 Ga0070714_100124264
701 Ga0070714_101171868
702 Ga0070713_100018406
703 Ga0070713_100699707
704 Ga0070710_10001648
705 Ga0070710_10866930
706 Ga0070710_10872782
707 Ga0070701_10019307
708 Ga0070711_100124355
709 Ga0070711_100297416
710 Ga0070711_101265189
711 Ga0070700_100055391
712 Ga0070694_100086447
713 Ga0070694_100290873
714 Ga0070694_101391809
715 Ga0070708_100507845
716 Ga0070663_100138637
717 Ga0070663_101039663
718 Ga0070678_100167782
719 Ga0070662_100126982
720 Ga0070662_100175291
721 Ga0070681_10071934
722 Ga0068867_100421737
723 Ga0070685_10147042
724 Ga0070707_100685510
725 Ga0070707_100817936
726 Ga0070698_100174061
727 Ga0070698_100508689
728 Ga0070698_100521940
729 Ga0070699_100057578
730 Ga0070679_100125242
731 Ga0070684_100130082
732 Ga0070684_101091468
733 Ga0068853_100432688
734 Ga0070672_100333743
735 Ga0070695_100075321
736 Ga0070696_100279830
737 Ga0070696_100312685
738 Ga0070693_100374477
739 Ga0070665_100449042
740 Ga0070704_100222700
741 Ga0070704_100656254
742 Ga0068855_100871656
743 Ga0068855_101397701
744 Ga0070664_101006141
745 Ga0068857_100006900
746 Ga0068857_100764299
747 Ga0068854_100252152
748 Ga0068856_100204450
749 Ga0070702_100085859
750 Ga0070702_100820585
751 Ga0068859_100987732
752 Ga0068864_101425993
753 Ga0068866_10135083
754 Ga0068861_100009466
755 Ga0068861_100285868
756 Ga0068861_100493053
757 Ga0068861_100721305
758 Ga0068851_10068958
759 Ga0068870_10070878
760 Ga0068870_10305543
761 Ga0068870_10473471
762 Ga0068863_100074561
763 Ga0068863_101709095
764 Ga0068863_102731249
765 Ga0068858_100132976
766 Ga0068858_101228716
767 Ga0068860_100833457
768 Ga0068860_101656283
769 Ga0068862_100001097
770 Ga0068862_100187986
771 Ga0081540_1000418
772 Ga0081540_1003610
773 Ga0070717_10690272
774 Ga0070717_11346864
775 Ga0070717_11398608
776 Ga0075363_100059487
777 Ga0075363_100761938
778 Ga0070715_10004363
779 Ga0070715_10236204
780 Ga0070715_10271924
781 Ga0070715_10622344
782 Ga0070716_100002101
783 Ga0070716_100070812
784 Ga0070712_100101407
785 Ga0070712_100205069
786 Ga0070712_100410336
787 Ga0070712_100595275
788 Ga0070712_100871148
789 Ga0097621_100053971
790 Ga0097621_101371163
791 Ga0075370_10210617
792 Ga0068871_100330873
793 Ga0068871_100709270
794 Ga0075430_101377339
795 Ga0075433_10026480
796 Ga0075433_10034341
797 Ga0075433_10087301
798 Ga0075434_100021240
799 Ga0075434_100139107
800 Ga0075434_100223160
801 Ga0075434_100355709
802 Ga0075434_101926761
803 Ga0075436_100048029
804 Ga0075436_100058006
805 Ga0075436_100108942
806 Ga0075436_100224411
807 Ga0075436_100373291
808 Ga0075436_100871238
809 Ga0075436_101418881
810 Ga0097620_100987801
811 Ga0075435_100004226
812 Ga0075435_100089409
813 Ga0075435_100215751
814 Ga0075435_100393325
815 Ga0075435_100449985
816 Ga0099795_10014819
817 Ga0105251_10088065
818 Ga0105244_10225861
819 Ga0111539_10038604
820 Ga0111539_10097899
821 Ga0111539_10740945
822 Ga0111539_11638193
823 Ga0105245_11038406
824 Ga0105247_10628585
825 Ga0114129_10348488
826 Ga0114129_11931908
827 Ga0114129_13502405
828 Ga0105243_10166080
829 Ga0105243_11115712
830 Ga0105241_10719770
831 Ga0105242_12297044
832 Ga0105248_10157592
833 Ga0105248_10513654
834 Ga0105237_10774443
835 Ga0105237_11303554
836 Ga0105238_10865971
837 Ga0105249_10029690
838 Ga0099796_10363605
839 Ga0105239_11631535
840 Ga0105246_10085877
841 Ga0105246_10543380
842 Ga0157328_1022443
843 Ga0157339_1002666
844 Ga0157326_1040834
845 Ga0157338_1002501
846 Ga0157373_10222256
847 Ga0157373_10555648
848 Ga0157371_10101909
849 Ga0157370_10169747
850 Ga0157369_10239005
851 Ga0157374_11190424
852 Ga0157378_11296882
853 Ga0163162_10042065
854 Ga0163162_10816766
855 Ga0157372_10478347
856 Ga0157375_11095280
857 Ga0157375_12600365
858 Ga0157375_12857384
859 Ga0163163_10186551
860 Ga0163163_12992319
861 Ga0157380_10016449
862 Ga0157380_10433728
863 Ga0157380_12315990
864 Ga0182008_10051548
865 Ga0157377_10349128
866 Ga0157379_10978499
867 Ga0157379_12307829
868 Ga0157376_10124403
869 Ga0157376_10721288
870 Ga0157376_11148906
871 Ga0163161_11808455
872 Ga0206356_11142786
873 Ga0206354_11416015
874 Ga0206353_11964218
875 Ga0213876_10589304
876 Ga0213875_10197125
877 Ga0224712_10068032
878 Ga0207653_10254887
879 Ga0207692_10000516
880 Ga0207692_10003266
881 Ga0207692_10009181
882 Ga0207692_10126281
883 Ga0207692_10599141
884 Ga0207692_10950949
885 Ga0207688_10018534
886 Ga0207680_10371383
887 Ga0207647_10242209
888 Ga0207685_10001304
889 Ga0207685_10021515
890 Ga0207685_10411756
891 Ga0207699_10005025
892 Ga0207699_10006331
893 Ga0207699_10190659
894 Ga0207699_10829875
895 Ga0207645_10315613
896 Ga0207643_10151117
897 Ga0207643_10284345
898 Ga0207643_10363010
899 Ga0207705_10283235
900 Ga0207684_11270316
901 Ga0207707_10823061
902 Ga0207695_11140546
903 Ga0207671_10303869
904 Ga0207693_10006195
905 Ga0207693_10034572
906 Ga0207693_10127732
907 Ga0207693_10300961
908 Ga0207693_10451086
909 Ga0207663_10075004
910 Ga0207663_10265521
911 Ga0207663_10373075
912 Ga0207663_11062481
913 Ga0207663_11062959
914 Ga0207660_10728211
915 Ga0207660_11125624
916 Ga0207662_10003184
917 Ga0207657_10041532
918 Ga0207649_11119969
919 Ga0207652_10408937
920 Ga0207646_10175996
921 Ga0207646_10253227
922 Ga0207681_10014402
923 Ga0207681_11121804
924 Ga0207650_10079370
925 Ga0207659_11589341
926 Ga0207700_10013313
927 Ga0207700_10028057
928 Ga0207700_10365850
929 Ga0207700_10587930
930 Ga0207700_11902607
931 Ga0207664_10005270
932 Ga0207664_10010793
933 Ga0207664_10185556
934 Ga0207664_10219485
935 Ga0207644_10236877
936 Ga0207644_11530445
937 Ga0207690_11784624
938 Ga0207706_10018518
939 Ga0207706_10071500
940 Ga0207706_10353717
941 Ga0207709_10526287
942 Ga0207669_10284603
943 Ga0207665_10000965
944 Ga0207665_10001409
945 Ga0207665_10015829
946 Ga0207665_10024415
947 Ga0207665_10119777
948 Ga0207665_10406103
949 Ga0207691_10164220
950 Ga0207691_10328903
951 Ga0207711_10206406
952 Ga0207711_10675071
953 Ga0207689_10096944
954 Ga0207689_11300668
955 Ga0207679_11037961
956 Ga0207679_11330975
957 Ga0207667_10272065
958 Ga0207667_11034372
959 Ga0207651_10170329
960 Ga0207712_10011961
961 Ga0207668_11441842
962 Ga0207640_12125479
963 Ga0207658_10651999
964 Ga0207677_11600309
965 Ga0207639_10362304
966 Ga0207639_11963033
967 Ga0207678_10001978
968 Ga0207708_10203026
969 Ga0207708_10859966
970 Ga0207708_11323004
971 Ga0207702_10180591
972 Ga0207641_11351953
973 Ga0207648_10038436
974 Ga0207648_10516891
975 Ga0207648_11725591
976 Ga0207676_11028594
977 Ga0207676_11163523
978 Ga0207674_10000575
979 Ga0207674_10022775
980 Ga0207674_11000060
981 Ga0207675_100012053
982 Ga0207675_100085736
983 Ga0207675_101298819
984 Ga0207683_10001492
985 Ga0207683_10408871
986 Ga0207428_10856702
987 Ga0207428_11161122
988 Ga0268266_10370707
989 Ga0268265_10007264
990 Ga0268265_10518132
991 Ga0307512_10035060
992 Ga0307508_10438072
993 Ga0307413_10366257
994 Ga0307410_10417402
995 Ga0307412_10757505
996 Ga0307409_100327990
997 Ga0307409_102208607
998 Ga0307414_12107261
999 Ga0307411_12072222
1000 Ga0373930_0032304
1001 Ga0373948_0047412
1002 Ga0373948_0057338
1003 Ga0373950_0008490
1004 Ga0373938_0005814
1005 Ga0373938_0217969
1006 Ga0373926_0003421
1007 Ga0373926_0022088
1008 Ga0373928_0007899
1009 Ga0373928_0033487
1010 Ga0373929_0025586
1011 Ga0373929_0240087
1012 Ga0373934_0009155
1013 Ga0373934_0021869
1014 Ga0373934_0058973
1015 Ga0373934_0422132
1016 Ga0373940_0005254
1017 Ga0373944_0002838
1018 Ga0373944_0006088
1019 Ga0373949_0003896
1020 Ga0373951_0223628
1021 Ga0373952_0063717
1022 Ga0373952_0218077
1023 Ga0373923_0009153
1024 Ga0373923_0009769
1025 Ga0373923_0393351
1026 Ga0373932_0025057
1027 Ga0373932_0055511
1028 Ga0373936_0003295
1029 Ga0373936_0018536
1030 Ga0373936_0051648
1031 Ga0373936_0145719
1032 Ga0373939_0128913
1033 Ga0373941_0068471
1034 Ga0373945_0000807
1035 Ga0373945_0007249
1036 Ga0373953_0117885
1037 Ga0373954_0045889
1038 Ga0373954_0290188
1039 Ga0373954_0420552
1040 Ga0373956_0009789
1041 Ga0373957_0012545
1042 Ga0373957_0348565
1043 Ga0373960_0002730
1044 Ga0373960_0093362
1045 Ga0373943_0000935
1046 Ga0373943_0029068
1047 Ga0373946_0000200
1048 Ga0373946_0034635
1049 Ga0373955_0017179
1050 Ga0373955_0252453
1051 Ga0373942_0003359
1052 Ga0373942_0006244
1053 Ga0373961_0406825
1054 Ga0373962_0068187
1055 Ga0373924_0002451
1056 Ga0373924_0002777
1057 Ga0373924_0217349
1058 Ga0373931_0039346
1059 Ga0373935_0039220
1060 Ga0373935_0043893
1061 Ga0373935_0210009
1062 Ga0373935_0944719
1063 Ga0373935_1012600
1064 Ga0373927_0001422
1065 Ga0373927_0023137
1066 Ga0373927_0516803
1067 Ga0373927_0549276
1068 Ga0373933_0002802
1069 Ga0373933_0002922
1070 Ga0373933_0056646
1071 Ga0373947_0009282
1072 Ga0373947_0135629
1073 Ga0373947_0251706
1074 Ga0373937_0002675
1075 Ga0373937_0135375
1076 Ga0373937_0265123
1077 Ga0373937_0603807
1078 Ga0373925_0013179
1079 Ga0373925_0017046
1080 Ga0373925_0115143
1081 Ga0373925_0300704
1082 Ga0436364_0217374
1083 Ga0436364_1445614
1084 Ga0242420_135191
1085 Ga0436365_0843559
1086 Ga0436365_1450088
1087 Ga0436365_1826404
1088 Ga0439465_0048631
1089 Ga0451851_0087590
1090 Ga0451853_0613802
1091 Ga0466969_0460774
1092 Ga0466959_1092913
1093 Ga0466967_0129695
1094 Ga0466967_0324639
1095 Ga0466967_0655766
1096 Ga0495592_0196930
1097 Ga0495592_0256119
1098 Ga0495603_0110158
1099 Ga0495603_0553859
1100 Ga0495629_0008068
1101 Ga0495629_0298349
1102 Ga0495641_0009313
1103 Ga0495641_0018109
1104 Ga0495641_0083092
1105 Ga0495651_0026946
1106 Ga0495651_0029437
1107 Ga0495651_0042541
1108 Ga0495651_0080263
1109 Ga0495651_0187652
1110 Ga0495651_0228359
1111 Ga0495653_0006274
1112 Ga0495653_0008853
1113 Ga0495653_0016305
1114 Ga0495653_0086831
1115 Ga0495653_0155135
1116 Ga0495580_0009659
1117 Ga0495582_0107913
1118 Ga0495639_0006854
1119 Ga0495639_0037370
1120 Ga0495639_0252273
1121 Ga0495662_0030369
1122 Ga0495664_0016927
1123 Ga0495594_0061940
1124 Ga0495608_0030126
1125 Ga0495608_0038464
1126 Ga0495608_0105052
1127 Ga0495608_0194249
1128 Ga0495608_0323557
1129 Ga0495618_0027137
1130 Ga0495618_0031379
1131 Ga0495618_0045793
1132 Ga0495618_0228039
1133 Ga0495628_0065703
1134 Ga0495628_0157424
1135 Ga0495628_0465475
1136 Ga0495630_0081325
1137 Ga0495630_0158809
1138 Ga0495666_0004794
1139 Ga0495666_0269218
1140 Ga0495652_0062991
1141 Ga0495652_0097360
1142 Ga0495652_0174621
1143 Ga0495652_0244853
1144 Ga0495652_0703882
1145 Ga0495652_0744259
1146 Ga0495665_0002478
1147 Ga0495665_0013868
1148 Ga0495665_0042846
1149 Ga0495640_0028514
1150 Ga0495640_0037867
1151 Ga0495640_0057785
1152 Ga0495586_0003236
1153 Ga0495586_0204394
1154 Ga0495586_0257205
1155 Ga0495587_0048909
1156 Ga0495587_0050407
1157 Ga0495587_0050482
1158 Ga0495587_0182834
1159 Ga0495587_0183028
1160 Ga0495645_0031745
1161 Ga0495645_0160514
1162 Ga0495667_0023763
1163 Ga0495667_0028239
1164 Ga0495667_0303920
1165 Ga0495667_0419166
1166 Ga0495634_0136437
1167 Ga0495634_0866774
1168 Ga0495635_0003705
1169 Ga0495635_0005109
1170 Ga0495635_0015693
1171 Ga0495635_0083959
1172 Ga0495635_0271075
1173 Ga0495635_0280843
1174 Ga0495635_0962620
1175 Ga0495588_0033876
1176 Ga0495657_0029264
1177 Ga0495657_0060401
1178 Ga0495657_0132016
1179 Ga0495657_0137768
1180 Ga0495657_0309587
1181 Ga0495599_0026110
1182 Ga0495599_0033261
1183 Ga0495599_0094151
1184 Ga0495599_0248152
1185 Ga0495599_0554701
1186 Ga0495623_0026135
1187 Ga0495623_0122349
1188 Ga0495623_0681142
1189 Ga0495646_0032605
1190 Ga0495647_0023289
1191 Ga0495647_0164044
1192 Ga0495658_0010635
1193 Ga0495613_0141100
1194 Ga0495613_0616066
1195 Ga0495624_0184239
1196 Ga0495600_0054353
1197 Ga0495600_0077236
1198 Ga0495600_0192725
1199 Ga0495600_0192728
1200 Ga0495600_0444409
1201 Ga0495581_0006465
1202 Ga0495581_0075278
1203 Ga0495581_0139805
1204 Ga0495581_0585459
1205 Ga0495604_0028216
1206 Ga0495604_0676848
1207 Ga0495604_0738607
1208 Ga0495674_0004138
1209 Ga0495674_0096391
1210 Ga0495674_0244883
1211 Ga0495674_0538717
1212 Ga0495674_0613830
1213 Ga0495674_0912432
1214 Ga0495676_0003741
1215 Ga0495676_0074749
1216 Ga0495676_0545012
1217 Ga0495680_0004413
1218 Ga0495680_0026269
1219 Ga0495680_0028999
1220 Ga0495680_0072317
1221 Ga0495675_0091500
1222 Ga0495675_0092683
1223 Ga0495675_0224953
1224 Ga0495684_0028869
1225 Ga0495684_0036436
1226 Ga0495684_0036852
1227 Ga0495684_0051562
1228 Ga0495684_0088602
1229 Ga0495684_0213553
1230 Ga0495593_0045643
1231 Ga0495593_0279986
1232 Ga0495602_0051278
1233 Ga0495602_0076796
1234 Ga0495602_0126122
1235 Ga0495602_0153066
1236 Ga0495602_0451297
1237 Ga0495614_0299785
1238 Ga0496100_0008258
1239 Ga0496100_0898523
1240 Ga0496101_0003684
1241 Ga0496101_0268900
1242 Ga0496102_0152718
1243 Ga0496102_0781052
1244 Ga0496104_0038396
1245 Ga0496104_0413776
1246 Ga0496104_0437330
1247 Ga0496104_1126450
1248 Ga0496105_0012631
1249 Ga0496105_0222698
1250 Ga0496106_0103832
1251 Ga0496106_0489093
1252 Ga0496106_0875637
1253 Ga0496107_0133092
1254 Ga0496107_0146425
1255 Ga0496108_0198990
1256 Ga0496109_0150987
1257 Ga0496109_2064414
1258 Ga0496110_0353999
1259 Ga0496111_0084120
1260 Ga0496111_0950640
1261 Ga0496112_0138711
1262 Ga0496112_0195086
1263 Ga0496112_0698221
1264 Ga0496113_0475075
1265 Ga0496113_0545015
1266 Ga0496114_0024992
1267 Ga0496114_0889360
1268 Ga0496115_0001929
1269 Ga0496115_0109402
1270 Ga0496126_0288529
1271 Ga0501038_0240949
1272 Ga0501040_0776744
1273 Ga0501068_0182314
1274 Ga0501070_0000637
1275 Ga0501070_0122536
1276 Ga0501072_0772038
1277 Ga0501073_0559315
1278 Ga0501074_0145312
1279 Ga0501075_0962908
1280 Ga0501077_0769086
1281 Ga0501079_0777583
1282 Ga0501081_0505499
1283 Ga0501083_0469575
1284 Ga0501035_0656162
1285 Ga0501045_0099657
1286 nmdc:mga06z11_529930_c1
1287 nmdc:mga07m45_34924_c2
1288 nmdc:mga05p37_1651410_c1
1289 nmdc:mga05p37_1976367_c1
1290 nmdc:mga05p37_297012_c1
1291 nmdc:mga05p37_530741_c1
1292 nmdc:mga05p37_942279_c1
1293 nmdc:mga08y16_56631_c1
1294 nmdc:mga08y16_570618_c1
1295 nmdc:mga0n895_416005_c1
1296 nmdc:mga0n895_54619_c1
1297 nmdc:mga0n895_7786_c1
1298 nmdc:mga0n895_806938_c1
1299 nmdc:mga0n895_95999_c1
1300 nmdc:mga0rr50_257285_c1
1301 nmdc:mga0rr50_392444_c1
1302 nmdc:mga0rr50_526663_c1
1303 nmdc:mga08x19_159514_c1
1304 nmdc:mga08x19_22661_c1
1305 nmdc:mga08x19_7206_c1
1306 nmdc:mga0a205_105188_c2
1307 nmdc:mga0a205_15490_c1
1308 nmdc:mga0a205_314510_c1
1309 Ga0495601_0037942
1310 Ga0495612_0021191
1311 Ga0495612_0031118
1312 Ga0495612_0071949
1313 Ga0495595_0057682
1314 Ga0495595_0070509
1315 Ga0495619_0096964
1316 Ga0495619_0101446
1317 Ga0500568_0289327
1318 Ga0500616_0157262
1319 Ga0501084_0864488
1320 Ga0501082_0260956
1321 Ga0530510_0073033
1322 2515757696
1323 2516091277
1324 2837270612
1325 2855680802
1326 2858849563
1327 2858892868
1328 2858895785
1329 2866617699
1330 2868089638
1331 2869049031
1332 2880491051
1333 2880501437
1334 2929229924
1335 8003874426
1336 8054706456
1337 8054730206
1338 8054738227

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

7

60

0.97

PF01022

HTH_5

Bacterial regulatory protein, arsR family

9

59

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9046 3 87
1p6r-assembly1.cif.gz_A solution structure of the dna binding domain of the repressor blai. 0.8815 9 71
6dk4-assembly1.cif.gz_B-2 crystal structure of campylobacter jejuni peroxide stress regulator 0.8801 15 73
7ne9-assembly1.cif.gz_CCC a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8764 9 70
6o8o-assembly2.cif.gz_D crystal structure of c9s disulfide state of sulfide-responsive transcriptional repressor (sqrr) from rhodobacter capsulatus. 0.8715 4 71
ID Description Score Start End Superfamily
1sd6A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9423 9 71 1.10.10.10
1sd6A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.915 9 71 1.10.10.10
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.907 9 71 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.903 4 82 1.10.10.10
af_O53838_4_115_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9004 4 78 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7K0D091-F1-model_v4 HTH arsR-type domain-containing protein 0.9715 3 84 GO:0003700
AF-A0A524CEX0-F1-model_v4 ArsR family transcriptional regulator 0.966 5 70
AF-A0A016QPP2-F1-model_v4 Uncharacterized protein 0.9596 8 71
AF-A0A7Y9DR86-F1-model_v4 DNA-binding transcriptional ArsR family regulator 0.9571 4 84 GO:0003677
GO:0003700
AF-A0A2W6WJK1-F1-model_v4 HTH arsR-type domain-containing protein 0.9552 1 86 GO:0003700

Map