F473950

General Info

Members Datasets Scaffolds Average Seq Length
668 514 338 337

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0005090|Ga0496125_0005090_2482_3447
Length 313
Sequence MRQAGRYLPEYRETRAKAGSFLDLCYSPEHAVEVTLQPIRRYGFDAAILFSDILVIPDAMKRNVRFTEGHGPEMDPIDEAGIAGLDGESVVDYLQPVLETVKRLRNELPTETTLLGFCGAPWTVATYMIAGHGTPDQAPARLFAYRHPRAFEYLLMLLADVSADYLVAQIDAGADAVQIFDSWAGVLGEREFEAFAIRPMARMIASIRARFAKGAGYMLKTYRQKTGADAIGLDWSVPLAFAAELQKDGPVQGNLDPMRVVAGGRSLEEGIDDILQALGNGPLIFNLGHGITPQADPENVRLLVDRVRGMRAA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
8 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
9 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
10 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
11 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
12 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
13 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
14 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
15 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
16 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
17 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
18 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
19 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
20 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
21 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
22 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
23 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
24 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
25 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
26 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
27 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
28 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
29 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
30 2519899620 Rhizobium sp. Pop5 Isolate Nodule
31 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
32 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
33 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
34 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
35 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
36 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
37 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
38 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
39 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
40 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
41 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
42 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
43 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
44 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
45 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
46 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
47 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
48 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
49 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
50 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
51 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
52 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
53 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
54 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
55 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
56 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
57 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
58 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
59 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
60 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
61 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
62 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
63 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
64 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
65 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
66 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
67 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
68 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
69 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
70 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
71 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
72 2643221557 Ensifer sp. Root558 Isolate Unclassified
73 2643221558 Rhizobium sp. Root149 Isolate Unclassified
74 2643221582 Rhizobium sp. Root651 Isolate Unclassified
75 2643221599 Rhizobium sp. Root708 Isolate Unclassified
76 2643221607 Rhizobium sp. Root73 Isolate Unclassified
77 2643221610 Ensifer sp. Root74 Isolate Unclassified
78 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
79 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
80 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
81 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
82 2643221668 Ensifer sp. Root423 Isolate Unclassified
83 2643221675 Ensifer sp. Root1298 Isolate Unclassified
84 2643221680 Ensifer sp. Root1312 Isolate Unclassified
85 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
86 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
87 2643221693 Rhizobium sp. Root491 Isolate Unclassified
88 2643221719 Rhizobium sp. Root274 Isolate Unclassified
89 2643221723 Ensifer sp. Root278 Isolate Unclassified
90 2643221726 Ensifer sp. Root954 Isolate Unclassified
91 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
92 2718217882 Rhizobium sp. N741 Isolate Nodule
93 2718217927 Rhizobium sp. N324 Isolate Nodule
94 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
95 2718218009 Rhizobium sp. N561 Isolate Nodule
96 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
97 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
98 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
99 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
100 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
101 2718218363 Rhizobium sp. N113 Isolate Nodule
102 2718218365 Rhizobium sp. N731 Isolate Nodule
103 2718218366 Rhizobium sp. N621 Isolate Nodule
104 2718218423 Rhizobium sp. N941 Isolate Nodule
105 2721755514 Rhizobium sp. N6212 Isolate Nodule
106 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
107 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
108 2721755809 Rhizobium sp. N541 Isolate Nodule
109 2721755810 Rhizobium sp. N871 Isolate Nodule
110 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
111 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
112 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
113 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
114 2728369365 Rhizobium sp. N1341 Isolate Nodule
115 2728369397 Rhizobium sp. N1314 Isolate Nodule
116 2738541293 Rhizobium sp. GV031 Isolate Unclassified
117 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
118 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
119 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
120 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
121 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
122 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
123 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
124 2791355256 Rhizobium sp. M10 Isolate Nodule
125 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
126 2791355260 Rhizobium sp. L9 Isolate Nodule
127 2791355261 Rhizobium sp. J15 Isolate Nodule
128 2791355262 Rhizobium sp. M1 Isolate Nodule
129 2791355263 Rhizobium chutanense C5 Isolate Nodule
130 2791355264 Rhizobium sp. S9 Isolate Nodule
131 2791355265 Rhizobium sp. H4 Isolate Nodule
132 2791355266 Rhizobium sp. L43 Isolate Nodule
133 2791355267 Rhizobium sp. L18 Isolate Nodule
134 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
135 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
136 2802429633 Rhizobium anhuiense J3 Isolate Nodule
137 2802429634 Rhizobium anhuiense S10 Isolate Nodule
138 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
139 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
140 2802429637 Rhizobium anhuiense C15 Isolate Nodule
141 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
142 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
143 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
144 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
145 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
146 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
147 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
148 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
149 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
150 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
151 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
152 2838048938 Rhizobium pisi 27/80 Isolate Nodule
153 2838061910 Rhizobium phaseoli L15 Isolate Nodule
154 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
155 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
156 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
157 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
158 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
159 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
160 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
161 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
162 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
163 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
164 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
165 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
166 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
167 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
168 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
169 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
170 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
171 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
172 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
173 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
174 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
175 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
176 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
177 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
178 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
179 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
180 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
181 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
182 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
183 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
184 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
185 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
186 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
187 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
188 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
189 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
190 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
191 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
192 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
193 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
194 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
195 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
196 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
197 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
198 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
199 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
200 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
201 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
202 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
203 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
204 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
205 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
206 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
207 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
208 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
209 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
210 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
211 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
212 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
213 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
214 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
215 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
216 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
217 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
218 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
219 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
220 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
221 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
222 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
223 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
224 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
225 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
226 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
227 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
228 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
229 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
230 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
231 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
232 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
233 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
234 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
235 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
236 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
237 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
238 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
239 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
240 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
241 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
242 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
243 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
244 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
245 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
246 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
247 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
248 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
249 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
250 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
251 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
252 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
253 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
254 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
255 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
256 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
257 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
258 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
259 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
260 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
261 2933599457 Rhizobium phaseoli M3 Isolate Nodule
262 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
263 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
264 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
265 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
266 2936381700 Rhizobium chutanense C16 Isolate Unclassified
267 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
268 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
269 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
270 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
271 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
272 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
273 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
274 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
275 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
276 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
277 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
278 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
279 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
280 2996887358 Rhizobium sp. R711 Isolate Nodule
281 2996893221 Rhizobium sp. R635 Isolate Nodule
282 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
283 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
284 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
285 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
286 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
287 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
288 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
289 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
290 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
291 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
292 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
293 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
294 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
295 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
296 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
297 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
298 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
299 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
300 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
301 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
302 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
303 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
304 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
305 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
306 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
307 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
308 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
309 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
310 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
311 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
312 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
313 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
314 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
315 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
316 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
317 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
318 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
319 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
320 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
321 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
322 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
323 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
324 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
325 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
326 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
327 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
328 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
329 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
330 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
331 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
332 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
333 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
334 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
335 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
336 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
337 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
338 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
339 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
340 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
341 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
342 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
343 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
344 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
345 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
346 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
347 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
348 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
349 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
350 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
351 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
352 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
353 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
354 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
355 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
356 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
357 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
358 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
359 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
360 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
361 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
362 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
363 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
364 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
365 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
375 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
376 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
377 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
378 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
380 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
381 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
382 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
383 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
384 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
385 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
386 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
387 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
388 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
389 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
390 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
391 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
392 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
393 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
394 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
395 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
396 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
397 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
398 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
399 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
400 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
401 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
402 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
403 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
404 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
405 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
406 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
407 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
408 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
409 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
410 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
411 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
412 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
413 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
414 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
415 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
416 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
417 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
418 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
419 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
420 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
421 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
422 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
423 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
424 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
425 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
426 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
427 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
428 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
429 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
430 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
431 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
432 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
433 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
434 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
435 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
436 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
437 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
438 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
439 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
440 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
441 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
442 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
443 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
446 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
447 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
448 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
449 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
450 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
451 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
452 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
453 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
454 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
455 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
456 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
457 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
458 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
459 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
460 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
461 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
462 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
463 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
464 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
465 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
466 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
467 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
468 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
469 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
471 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
472 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
473 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
474 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
475 8005258706 Rhizobium sp. R693 Isolate Nodule
476 8005275841 Rhizobium sp. N4311 Isolate Nodule
477 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
478 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
479 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
480 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
481 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
482 8005321885 Rhizobium sp. R72 Isolate Nodule
483 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
484 8005382845 Rhizobium sp. R634 Isolate Nodule
485 8005395548 Rhizobium sp. R339 Isolate Nodule
486 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
487 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
488 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
489 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
490 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
491 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
492 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
493 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
494 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
495 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
496 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
497 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
498 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
499 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
500 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
501 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
502 8018176218 Rhizobium sp. N122 Isolate Nodule
503 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
504 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
505 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
506 8024501048 Rhizobium sp. H4 Isolate Nodule
507 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
508 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
509 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
510 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
511 8056382006 Rhizobium croatiense 13T Isolate Nodule
512 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
513 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
514 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 50.3
Metatranscriptomes 0.15
Isolates 49.55

Biome Distribution

Category Percentage (%)
Aerial Root 0.75
Bulb 0
Endosphere 19.16
Nodule 32.34
Rhizoplane 3.29
Rhizosphere 20.66
Stem 0
Stem Tuber 0
Unclassified 23.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000018 3300002704 Bacteria 157606
2 JGI25156J39149_1000055 3300002705 Bacteria 87733
3 JGI25162J39368_1000903 3300002737 Bacteria 19226
4 JGI25154J39366_1000069 3300002738 Bacteria 96438
5 JGI25158J39367_1000191 3300002739 Bacteria 14579
6 JGI25157J39369_1000076 3300002741 Bacteria 87678
7 JGI25152J39213_1000169 3300002773 Bacteria 44325
8 JGI25152J39213_1004374 3300002773 Bacteria 4468
9 JGI25150J39212_1000018 3300002774 Bacteria 146535
10 JGI25150J39212_1009701 3300002774 Bacteria 1821
11 JGI25159J45721_1000486 3300002987 Bacteria 18238
12 JGI25159J45721_1002910 3300002987 Bacteria 6247
13 JGI25151J46595_10000034 3300003187 Bacteria 192271
14 JGI25165J46597_1000974 3300003214 Bacteria 19236
15 JGI25165J46597_1002402 3300003214 Bacteria 6170
16 JGI25153J46596_10002149 3300003215 Bacteria 11526
17 JGI25153J46596_10023547 3300003215 Bacteria 2241
18 JGI25153J46596_10029546 3300003215 Bacteria 1879
19 rootH1_10052842 3300003316 Bacteria 4619
20 rootH2_10016965 3300003320 Bacteria 2112
21 rootH1_10095635 3300003316 Bacteria 3608
22 rootH1_10095635 3300003323 Bacteria 2362
23 JGI25160J50197_1000051 3300003354 Bacteria 132923
24 JGI25161J50226_1000011 3300003374 Bacteria 210140
25 JGI25161J50226_1000214 3300003374 Bacteria 36702
26 Ga0055526_1010755 3300003771 Bacteria 4216
27 Ga0055526_1013485 3300003771 Bacteria 3451
28 Ga0055526_1017527 3300003771 Bacteria 2730
29 Ga0055524_1000962 3300003775 Bacteria 18149
30 Ga0055524_1005939 3300003775 Bacteria 5374
31 Ga0055524_1034625 3300003775 Bacteria 1393
32 Ga0055536_1004552 3300003781 Bacteria 7046
33 Ga0055536_1023578 3300003781 Bacteria 1805
34 Ga0055528_1000452 3300003790 Bacteria 32857
35 Ga0055528_1006339 3300003790 Bacteria 5376
36 Ga0055528_1023092 3300003790 Bacteria 1911
37 Ga0055540_1000597 3300003792 Bacteria 26126
38 Ga0055540_1008997 3300003792 Bacteria 3516
39 Ga0055531_10001167 3300003794 Bacteria 20222
40 Ga0055543_1000041 3300004625 Bacteria 118501
41 Ga0055543_1000330 3300004625 Bacteria 32518
42 Ga0065165_1000303 3300005262 Bacteria 82513
43 Ga0065165_1023748 3300005262 Bacteria 2072
44 Ga0065165_1029954 3300005262 Bacteria 1737
45 Ga0065704_10166280 3300005289 Bacteria 1320
46 Ga0070666_10007959 3300005335 Bacteria 6554
47 Ga0070668_100008156 3300005347 Bacteria 7779
48 Ga0070671_100132672 3300005355 Bacteria 2098
49 Ga0070667_100338664 3300005367 Bacteria 1360
50 Ga0070665_100005296 3300005548 Bacteria 13322
51 Ga0070665_100117083 3300005548 Bacteria 2667
52 Ga0068854_100030834 3300005578 Bacteria 3722
53 Ga0068856_100093783 3300005614 Bacteria 2988
54 Ga0068852_100016523 3300005616 Bacteria 5760
55 Ga0075365_10007891 3300006038 Bacteria 5997
56 Ga0075368_10000331 3300006042 Bacteria 13823
57 Ga0075363_100020723 3300006048 Bacteria 3301
58 Ga0075362_10008613 3300006177 Bacteria 3912
59 Ga0075367_10035020 3300006178 Bacteria 2904
60 Ga0075369_10000392 3300006186 Bacteria 13230
61 Ga0075369_10010550 3300006186 Bacteria 3615
62 Ga0075370_10002288 3300006353 Bacteria 8836
63 Ga0075370_10079776 3300006353 Bacteria 1880
64 Ga0079104_1000310 3300006946 Bacteria 61815
65 Ga0099826_10000813 3300006948 Bacteria 16761
66 Ga0105251_10004120 3300009011 Bacteria 10148
67 Ga0105250_10012077 3300009092 Bacteria 3576
68 Ga0123341_1000071 3300009765 Bacteria 43545
69 Ga0105239_10070590 3300010375 Bacteria 3837
70 Ga0157373_10013927 3300013100 Bacteria 5899
71 Ga0157371_10000071 3300013102 Bacteria 164088
72 Ga0157371_10031236 3300013102 Bacteria 3838
73 Ga0157370_10000079 3300013104 Bacteria 107305
74 Ga0157369_10308338 3300013105 Bacteria 1646
75 Ga0171463_1004 3300013249 Bacteria 437207
76 Ga0157372_10085199 3300013307 Bacteria 3584
77 Ga0163163_10266655 3300014325 Bacteria 1764
78 Ga0182007_10004127 3300015262 Bacteria 6662
79 Ga0214544_1000079 3300021320 Bacteria 121742
80 Ga0214542_1000064 3300021321 Bacteria 127681
81 Ga0214542_1012059 3300021321 Bacteria 11445
82 Ga0214543_1000015 3300021327 Bacteria 305679
83 Ga0214543_1000063 3300021327 Bacteria 127694
84 Ga0209435_100031 3300025206 Bacteria 164115
85 Ga0209436_100013 3300025208 Bacteria 131492
86 Ga0209563_105689 3300025230 Bacteria 2227
87 Ga0209437_100179 3300025233 Bacteria 134210
88 Ga0207425_1000035 3300025245 Bacteria 225942
89 Ga0207425_1009239 3300025245 Bacteria 2465
90 Ga0209646_1000102 3300025246 Bacteria 164115
91 Ga0209026_1000096 3300025250 Bacteria 164115
92 Ga0209677_100353 3300025253 Bacteria 28643
93 Ga0209759_1000090 3300025256 Bacteria 164115
94 Ga0209129_1000029 3300025258 Bacteria 401149
95 Ga0209129_1000050 3300025258 Bacteria 267408
96 Ga0209129_1000826 3300025258 Bacteria 19503
97 Ga0209129_1001114 3300025258 Bacteria 15657
98 Ga0209129_1001662 3300025258 Bacteria 12035
99 Ga0209233_1000185 3300025261 Bacteria 133788
100 Ga0209673_1000033 3300025273 Bacteria 335369
101 Ga0209673_1000050 3300025273 Bacteria 285287
102 Ga0209673_1001321 3300025273 Bacteria 24961
103 Ga0209673_1001329 3300025273 Bacteria 24789
104 Ga0209673_1006760 3300025273 Bacteria 5455
105 Ga0209673_1024489 3300025273 Bacteria 2026
106 Ga0209130_1000009 3300025284 Bacteria 498952
107 Ga0209130_1000058 3300025284 Bacteria 210250
108 Ga0209025_1000042 3300025294 Bacteria 370577
109 Ga0209025_1000132 3300025294 Bacteria 197432
110 Ga0209025_1000815 3300025294 Bacteria 50019
111 Ga0209025_1008730 3300025294 Bacteria 7219
112 Ga0209025_1017618 3300025294 Bacteria 4107
113 Ga0209564_1000227 3300025295 Bacteria 125497
114 Ga0209564_1004168 3300025295 Bacteria 9034
115 Ga0209564_1007892 3300025295 Bacteria 5383
116 Ga0209564_1028940 3300025295 Bacteria 1756
117 Ga0209564_1038108 3300025295 Bacteria 1343
118 Ga0209758_1000299 3300025297 Bacteria 97367
119 Ga0209758_1000406 3300025297 Bacteria 73962
120 Ga0209758_1000864 3300025297 Bacteria 41937
121 Ga0209758_1001462 3300025297 Bacteria 27731
122 Ga0209758_1037152 3300025297 Bacteria 1886
123 Ga0209256_1000286 3300025299 Bacteria 88880
124 Ga0209256_1001479 3300025299 Bacteria 24043
125 Ga0209256_1001610 3300025299 Bacteria 22074
126 Ga0209256_1006504 3300025299 Bacteria 6147
127 Ga0209256_1017619 3300025299 Bacteria 2361
128 Ga0209256_1020044 3300025299 Bacteria 2103
129 Ga0209256_1035975 3300025299 Bacteria 1303
130 Ga0207426_1000131 3300025302 Bacteria 210250
131 Ga0207426_1000450 3300025302 Bacteria 65777
132 Ga0207426_1000682 3300025302 Bacteria 40955
133 Ga0209051_1000118 3300025303 Bacteria 149426
134 Ga0209051_1000547 3300025303 Bacteria 45743
135 Ga0209051_1004006 3300025303 Bacteria 9339
136 Ga0209051_1021614 3300025303 Bacteria 2731
137 Ga0209051_1033630 3300025303 Bacteria 1935
138 Ga0209051_1044210 3300025303 Bacteria 1554
139 Ga0209257_1002918 3300025304 Bacteria 15767
140 Ga0209257_1006107 3300025304 Bacteria 7995
141 Ga0207647_10063583 3300025904 Bacteria 2244
142 Ga0207695_10000234 3300025913 Bacteria 146987
143 Ga0207671_10000234 3300025914 Bacteria 83448
144 Ga0207709_10063143 3300025935 Bacteria 2321
145 Ga0207640_10092132 3300025981 Bacteria 2102
146 Ga0207658_10296609 3300025986 Bacteria 1391
147 Ga0207678_10258271 3300026067 Bacteria 1493
148 Ga0207702_10056535 3300026078 Bacteria 3332
149 Ga0207698_10025061 3300026142 Bacteria 4196
150 Ga0209281_1000028 3300027111 Bacteria 440027
151 Ga0209371_1000037 3300027312 Bacteria 367074
152 Ga0209371_1001411 3300027312 Bacteria 16466
153 Ga0209282_1000695 3300027666 Bacteria 16757
154 Ga0209813_10026416 3300027866 Bacteria 1679
155 Ga0268266_10017319 3300028379 Bacteria 6150
156 Ga0268266_10049742 3300028379 Bacteria 3595
157 Ga0268266_10076760 3300028379 Bacteria 2904
158 Ga0268266_10088034 3300028379 Bacteria 2718
159 Ga0268266_10331095 3300028379 Bacteria 1427
160 Ga0307515_10001099 3300028794 Bacteria 61933
161 Ga0307515_10012908 3300028794 Bacteria 15667
162 Ga0307515_10069879 3300028794 Bacteria 4790
163 Ga0307515_10295348 3300028794 Bacteria 1311
164 Ga0268256_1000039 3300030500 Bacteria 354969
165 Ga0268256_1001490 3300030500 Bacteria 13902
166 Ga0268256_1006162 3300030500 Bacteria 4517
167 Ga0307513_10000998 3300031456 Bacteria 40880
168 Ga0307513_10282324 3300031456 Bacteria 1437
169 Ga0307408_100028873 3300031548 Bacteria 3837
170 Ga0307514_10224815 3300031649 Bacteria 1146
171 Ga0307405_10148418 3300031731 Bacteria 1645
172 Ga0307406_10004352 3300031901 Bacteria 7707
173 Ga0307406_10096826 3300031901 Bacteria 2000
174 Ga0307412_10000412 3300031911 Bacteria 26116
175 Ga0307412_10155397 3300031911 Bacteria 1693
176 Ga0316582_0046199 3300036647 Bacteria 2745
177 Ga0395905_0002522 3300037471 Bacteria 20214
178 Ga0395905_0016023 3300037471 Bacteria 7124
179 Ga0451837_0098499 3300041494 Bacteria 2060
180 Ga0451847_0566208 3300041503 Bacteria 4555
181 Ga0451855_1716850 3300041511 Bacteria 1095
182 Ga0451853_0633043 3300041512 Bacteria 1182
183 Ga0450906_003057 3300042145 Bacteria 3626
184 Ga0450909_017117 3300042185 Bacteria 1073
185 Ga0466957_0100894 3300044842 Bacteria 1819
186 Ga0495638_0000110 3300046460 Bacteria 131410
187 Ga0495605_0007620 3300046474 Bacteria 6138
188 Ga0495605_0119180 3300046474 Bacteria 1197
189 Ga0495585_0017628 3300046492 Bacteria 4124
190 Ga0495585_0018413 3300046492 Bacteria 4028
191 Ga0495585_0028682 3300046492 Bacteria 3173
192 Ga0495585_0062483 3300046492 Bacteria 2046
193 Ga0495607_0030930 3300046501 Bacteria 3281
194 Ga0495583_0009155 3300046506 Bacteria 5951
195 Ga0495583_0027839 3300046506 Bacteria 2785
196 Ga0495610_0000363 3300046512 Bacteria 47378
197 Ga0495610_0116623 3300046512 Bacteria 1176
198 Ga0495616_0037833 3300046513 Bacteria 2480
199 Ga0495620_0038156 3300046515 Bacteria 2134
200 Ga0495620_0038973 3300046515 Bacteria 2105
201 Ga0495631_0019274 3300046518 Bacteria 3200
202 Ga0495632_0038705 3300046519 Bacteria 2413
203 Ga0495643_0031872 3300046522 Bacteria 2930
204 Ga0495643_0151341 3300046522 Bacteria 1149
205 Ga0495648_0059177 3300046524 Bacteria 2287
206 Ga0495654_0000143 3300046530 Bacteria 74495
207 Ga0495609_0040977 3300046538 Bacteria 2083
208 Ga0495611_0014969 3300046648 Bacteria 3315
209 Ga0495625_0023025 3300046660 Bacteria 4764
210 Ga0495588_0031962 3300046674 Bacteria 2652
211 Ga0495671_0022537 3300046692 Bacteria 3299
212 Ga0495649_0048294 3300046694 Bacteria 2313
213 Ga0495660_0034931 3300046810 Bacteria 2811
214 Ga0495672_0140632 3300047320 Bacteria 1261
215 Ga0495673_0047636 3300047469 Bacteria 1893
216 Ga0495681_0039594 3300047470 Bacteria 2300
217 Ga0495686_0001162 3300047472 Bacteria 30927
218 Ga0495686_0002138 3300047472 Bacteria 19314
219 Ga0495686_0012296 3300047472 Bacteria 5994
220 Ga0495686_0072590 3300047472 Bacteria 2116
221 Ga0496101_0150338 3300048904 Bacteria 1781
222 Ga0496101_0155654 3300048904 Bacteria 1750
223 Ga0496102_0041154 3300048905 Bacteria 4183
224 Ga0496103_0091095 3300048906 Bacteria 1924
225 Ga0496104_0023303 3300048907 Bacteria 5691
226 Ga0496105_0022420 3300048908 Bacteria 5114
227 Ga0496107_0334859 3300048910 Bacteria 1126
228 Ga0496109_0173426 3300048912 Bacteria 2024
229 Ga0496110_0026155 3300048913 Bacteria 4991
230 Ga0496111_0000529 3300048914 Bacteria 19781
231 Ga0496111_0049930 3300048914 Bacteria 3016
232 Ga0496113_0024324 3300048916 Bacteria 4303
233 Ga0496114_0276777 3300048917 Bacteria 1479
234 Ga0496114_0339056 3300048917 Bacteria 1329
235 Ga0496116_0002951 3300048919 Bacteria 17324
236 Ga0496117_0000031 3300048920 Bacteria 381048
237 Ga0496117_0005859 3300048920 Bacteria 12714
238 Ga0496117_0006996 3300048920 Bacteria 11181
239 Ga0496117_0010245 3300048920 Bacteria 8588
240 Ga0496117_0051336 3300048920 Bacteria 2916
241 Ga0496117_0172993 3300048920 Bacteria 1251
242 Ga0496118_0000208 3300048921 Bacteria 102645
243 Ga0496118_0008237 3300048921 Bacteria 10813
244 Ga0496118_0008792 3300048921 Bacteria 10353
245 Ga0496118_0026435 3300048921 Bacteria 4946
246 Ga0496118_0026767 3300048921 Bacteria 4903
247 Ga0496118_0199170 3300048921 Bacteria 1188
248 Ga0496119_0008902 3300048922 Bacteria 8729
249 Ga0496119_0015539 3300048922 Bacteria 5850
250 Ga0496119_0070713 3300048922 Bacteria 2046
251 Ga0496120_0000387 3300048923 Bacteria 71224
252 Ga0496120_0008826 3300048923 Bacteria 7237
253 Ga0496120_0056066 3300048923 Bacteria 2226
254 Ga0496121_0000034 3300048924 Bacteria 377095
255 Ga0496121_0006665 3300048924 Bacteria 14205
256 Ga0496121_0011216 3300048924 Bacteria 9985
257 Ga0496121_0067785 3300048924 Bacteria 2890
258 Ga0496121_0091583 3300048924 Bacteria 2373
259 Ga0496121_0124164 3300048924 Bacteria 1944
260 Ga0496121_0146731 3300048924 Bacteria 1742
261 Ga0496121_0149267 3300048924 Bacteria 1722
262 Ga0496121_0203093 3300048924 Bacteria 1411
263 Ga0496121_0204837 3300048924 Bacteria 1403
264 Ga0496122_0000023 3300048925 Bacteria 381035
265 Ga0496122_0000082 3300048925 Bacteria 209159
266 Ga0496122_0000308 3300048925 Bacteria 107960
267 Ga0496122_0009867 3300048925 Bacteria 9953
268 Ga0496122_0015840 3300048925 Bacteria 7180
269 Ga0496122_0019377 3300048925 Bacteria 6218
270 Ga0496122_0020473 3300048925 Bacteria 5975
271 Ga0496122_0023049 3300048925 Bacteria 5509
272 Ga0496122_0041403 3300048925 Bacteria 3642
273 Ga0496122_0069645 3300048925 Bacteria 2518
274 Ga0496123_0000027 3300048926 Bacteria 306773
275 Ga0496123_0000066 3300048926 Bacteria 210327
276 Ga0496123_0000067 3300048926 Bacteria 209159
277 Ga0496123_0004280 3300048926 Bacteria 15189
278 Ga0496123_0018773 3300048926 Bacteria 5481
279 Ga0496123_0031587 3300048926 Bacteria 3850
280 Ga0496123_0059994 3300048926 Bacteria 2455
281 Ga0496123_0071116 3300048926 Bacteria 2172
282 Ga0496123_0098834 3300048926 Bacteria 1705
283 Ga0496124_0001215 3300048927 Bacteria 39879
284 Ga0496124_0003574 3300048927 Bacteria 18903
285 Ga0496124_0011810 3300048927 Bacteria 8701
286 Ga0496124_0018926 3300048927 Bacteria 6429
287 Ga0496124_0019169 3300048927 Bacteria 6381
288 Ga0496124_0027404 3300048927 Bacteria 5114
289 Ga0496124_0031109 3300048927 Bacteria 4728
290 Ga0496124_0036348 3300048927 Bacteria 4297
291 Ga0496124_0053082 3300048927 Bacteria 3439
292 Ga0496124_0192459 3300048927 Bacteria 1559
293 Ga0496124_0200285 3300048927 Bacteria 1519
294 Ga0496125_0000030 3300048928 Bacteria 375023
295 Ga0496125_0000288 3300048928 Bacteria 99681
296 Ga0496125_0004702 3300048928 Bacteria 15559
297 Ga0496125_0005090 3300048928 Bacteria 14802
298 Ga0496125_0134582 3300048928 Bacteria 1731
299 Ga0496125_0178102 3300048928 Bacteria 1420
300 Ga0496126_0000258 3300048929 Bacteria 113843
301 Ga0496126_0024648 3300048929 Bacteria 5804
302 Ga0496126_0100054 3300048929 Bacteria 2538
303 Ga0496126_0200475 3300048929 Bacteria 1686
304 Ga0495678_024671 3300049459 Bacteria 2593
305 Ga0501031_0040846 3300049568 Bacteria 3028
306 Ga0501033_0012136 3300049570 Bacteria 6577
307 Ga0501280_000593 3300049776 Bacteria 8368
308 Ga0501035_0002574 3300049822 Bacteria 17734
309 nmdc:mga00v17_15_c1 3300050491 Bacteria 126234
310 nmdc:mga0yw44_4777_c2 3300050492 Bacteria 5532
311 nmdc:mga0yw44_71493_c1 3300050492 Bacteria 2154
312 nmdc:mga06z11_78565_c1 3300050494 Bacteria 1764
313 nmdc:mga04h51_2783_c1 3300050495 Bacteria 4173
314 nmdc:mga07m45_124317_c1 3300050496 Bacteria 1491
315 nmdc:mga0sz30_2785_c1 3300050516 Bacteria 6238
316 nmdc:mga0sz30_735_c1 3300050516 Bacteria 11987
317 nmdc:mga0sz30_97391_c1 3300050516 Bacteria 1283
318 Ga0500610_0126583 3300053079 Bacteria 1303
319 Ga0500560_001162 3300053107 Bacteria 4359
320 Ga0500569_004466 3300053109 Bacteria 2942
321 Ga0500594_0007198 3300053118 Bacteria 2515
322 Ga0500618_000513 3300053125 Bacteria 24523
323 Ga0500618_000701 3300053125 Bacteria 19679
324 Ga0500628_013313 3300053129 Bacteria 1534
325 Ga0500655_000659 3300053133 Bacteria 6845
326 Ga0500658_0010054 3300053134 Bacteria 3492
327 Ga0500559_0012131 3300053136 Bacteria 3669
328 Ga0500561_0004664 3300053137 Bacteria 2491
329 Ga0500568_0000247 3300053139 Bacteria 45994
330 Ga0500573_0000793 3300053140 Bacteria 14234
331 Ga0500616_0000448 3300053153 Bacteria 53998
332 Ga0500616_0002118 3300053153 Bacteria 17230
333 Ga0500622_0000169 3300053156 Bacteria 70224
334 Ga0500622_0000441 3300053156 Bacteria 39445
335 Ga0500622_0045920 3300053156 Bacteria 2260
336 Ga0500624_000633 3300053157 Bacteria 9342
337 Ga0500645_029337 3300053730 Bacteria 1661
338 Ga0587090_006764 3300059510 Bacteria 1485

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300015262 Ga0182007_10004127 Ga0182007_100041274 308
2 3300048924 Ga0496121_0006665 Ga0496121_0006665_8839_9801 308
3 3300048925 Ga0496122_0009867 Ga0496122_0009867_8337_9299 308
4 3300048926 Ga0496123_0098834 Ga0496123_0098834_556_1518 308
5 3300048921 Ga0496118_0026767 Ga0496118_0026767_2577_3542 311
6 3300048926 Ga0496123_0059994 Ga0496123_0059994_1190_2155 311
7 3300048926 Ga0496123_0071116 Ga0496123_0071116_38_1000 311
8 3300048928 Ga0496125_0005090 Ga0496125_0005090_2482_3447 311
9 3300025913 Ga0207695_10000234 Ga0207695_1000023478 313
10 3300013102 Ga0157371_10031236 Ga0157371_100312364 315
11 3300013307 Ga0157372_10085199 Ga0157372_100851993 315
12 iso_pu_bacteria 2838661181 2838668143 316
13 3300005289 Ga0065704_10166280 Ga0065704_101662801 319
14 3300013249 Ga0171463_1004 Ga0171463_1004322 319
15 3300041494 Ga0451837_0098499 Ga0451837_0098499_563_1537 319
16 3300041503 Ga0451847_0566208 Ga0451847_0566208_170_1144 319
17 3300041511 Ga0451855_1716850 Ga0451855_1716850_92_1051 319
18 3300041512 Ga0451853_0633043 Ga0451853_0633043_25_999 319
19 3300046460 Ga0495638_0000110 Ga0495638_0000110_70196_71158 319
20 3300046474 Ga0495605_0007620 Ga0495605_0007620_2663_3625 319
21 3300046474 Ga0495605_0119180 Ga0495605_0119180_53_1027 319
22 3300046492 Ga0495585_0017628 Ga0495585_0017628_2854_3816 319
23 3300046492 Ga0495585_0018413 Ga0495585_0018413_61_1035 319
24 3300046492 Ga0495585_0028682 Ga0495585_0028682_1794_2756 319
25 3300046492 Ga0495585_0062483 Ga0495585_0062483_137_1099 319
26 3300046506 Ga0495583_0027839 Ga0495583_0027839_791_1756 319
27 3300046512 Ga0495610_0116623 Ga0495610_0116623_97_1062 319
28 3300046515 Ga0495620_0038973 Ga0495620_0038973_295_1257 319
29 3300046518 Ga0495631_0019274 Ga0495631_0019274_830_1792 319
30 3300046524 Ga0495648_0059177 Ga0495648_0059177_94_1068 319
31 3300046538 Ga0495609_0040977 Ga0495609_0040977_342_1316 319
32 3300046648 Ga0495611_0014969 Ga0495611_0014969_32_994 319
33 3300046694 Ga0495649_0048294 Ga0495649_0048294_1028_1993 319
34 3300047320 Ga0495672_0140632 Ga0495672_0140632_26_988 319
35 3300047470 Ga0495681_0039594 Ga0495681_0039594_189_1151 319
36 3300048910 Ga0496107_0334859 Ga0496107_0334859_103_1065 319
37 3300048917 Ga0496114_0339056 Ga0496114_0339056_201_1163 319
38 3300048924 Ga0496121_0149267 Ga0496121_0149267_607_1569 319
39 3300048924 Ga0496121_0204837 Ga0496121_0204837_288_1250 319
40 3300048925 Ga0496122_0069645 Ga0496122_0069645_576_1538 319
41 3300049776 Ga0501280_000593 Ga0501280_000593_1118_2077 319
42 3300053079 Ga0500610_0126583 Ga0500610_0126583_32_994 319
43 3300053129 Ga0500628_013313 Ga0500628_013313_502_1476 319
44 3300053134 Ga0500658_0010054 Ga0500658_0010054_71_1033 319
45 3300053136 Ga0500559_0012131 Ga0500559_0012131_2592_3554 319
46 3300053139 Ga0500568_0000247 Ga0500568_0000247_28100_29062 319
47 3300053153 Ga0500616_0002118 Ga0500616_0002118_1631_2593 319
48 3300053730 Ga0500645_029337 Ga0500645_029337_158_1120 319
49 3300009011 Ga0105251_10004120 Ga0105251_100041205 320
50 3300009092 Ga0105250_10012077 Ga0105250_100120773 320
51 3300013105 Ga0157369_10308338 Ga0157369_103083382 320
52 3300042185 Ga0450909_017117 Ga0450909_017117_24_986 320
53 3300046674 Ga0495588_0031962 Ga0495588_0031962_1542_2504 320
54 3300047472 Ga0495686_0072590 Ga0495686_0072590_435_1397 320
55 3300048905 Ga0496102_0041154 Ga0496102_0041154_27_989 320
56 3300048906 Ga0496103_0091095 Ga0496103_0091095_170_1132 320
57 3300048907 Ga0496104_0023303 Ga0496104_0023303_130_1092 320
58 3300048908 Ga0496105_0022420 Ga0496105_0022420_3374_4336 320
59 3300048912 Ga0496109_0173426 Ga0496109_0173426_810_1772 320
60 3300048913 Ga0496110_0026155 Ga0496110_0026155_3227_4189 320
61 3300048914 Ga0496111_0049930 Ga0496111_0049930_777_1739 320
62 3300048916 Ga0496113_0024324 Ga0496113_0024324_956_1918 320
63 3300048917 Ga0496114_0276777 Ga0496114_0276777_335_1297 320
64 3300048920 Ga0496117_0006996 Ga0496117_0006996_8998_9960 320
65 3300048920 Ga0496117_0172993 Ga0496117_0172993_254_1216 320
66 3300048921 Ga0496118_0026435 Ga0496118_0026435_2813_3781 320
67 3300048922 Ga0496119_0015539 Ga0496119_0015539_4090_5052 320
68 3300048924 Ga0496121_0124164 Ga0496121_0124164_777_1739 320
69 3300048924 Ga0496121_0203093 Ga0496121_0203093_191_1153 320
70 3300048925 Ga0496122_0041403 Ga0496122_0041403_1907_2869 320
71 3300048927 Ga0496124_0018926 Ga0496124_0018926_4325_5287 320
72 3300048927 Ga0496124_0027404 Ga0496124_0027404_2374_3336 320
73 3300048927 Ga0496124_0053082 Ga0496124_0053082_1303_2265 320
74 3300048928 Ga0496125_0000288 Ga0496125_0000288_74610_75572 320
75 3300048929 Ga0496126_0000258 Ga0496126_0000258_66312_67274 320
76 3300048929 Ga0496126_0024648 Ga0496126_0024648_843_1805 320
77 3300048929 Ga0496126_0100054 Ga0496126_0100054_1154_2116 320
78 3300050492 nmdc:mga0yw44_71493_c1 nmdc:mga0yw44_71493_c1_477_1439 320
79 3300053137 Ga0500561_0004664 Ga0500561_0004664_1006_1974 320
80 iso_pu_bacteria 2842140634 2842145778 323
81 3300031911 Ga0307412_10000412 Ga0307412_1000041214 324
82 iso_pu_bacteria 2582581308 2585279624 324
83 iso_pu_bacteria 2582581315 2585327461 324
84 iso_pu_bacteria 2582581316 2585334000 324
85 iso_pu_bacteria 2585427527 2585535703 324
86 iso_pu_bacteria 2585427530 2585551081 324
87 iso_pu_bacteria 2615840626 2616306411 324
88 iso_pu_bacteria 2818991453 2819638479 324
89 iso_pu_bacteria 2842298080 2842302635 324
90 iso_pu_bacteria 2842357229 2842358863 324
91 3300025245 Ga0207425_1000035 Ga0207425_1000035149 326
92 3300025258 Ga0209129_1000029 Ga0209129_1000029149 326
93 3300025273 Ga0209673_1006760 Ga0209673_10067606 326
94 3300025294 Ga0209025_1000132 Ga0209025_100013257 326
95 3300025297 Ga0209758_1000299 Ga0209758_100029936 326
96 3300025303 Ga0209051_1044210 Ga0209051_10442101 326
97 3300028379 Ga0268266_10331095 Ga0268266_103310951 327
98 3300031731 Ga0307405_10148418 Ga0307405_101484182 327
99 3300031901 Ga0307406_10004352 Ga0307406_100043525 327
100 3300003214 JGI25165J46597_1002402 JGI25165J46597_10024022 328
101 3300025253 Ga0209677_100353 Ga0209677_10035321 328
102 3300005578 Ga0068854_100030834 Ga0068854_1000308343 329
103 3300005616 Ga0068852_100016523 Ga0068852_1000165235 329
104 3300010375 Ga0105239_10070590 Ga0105239_100705903 329
105 3300025914 Ga0207671_10000234 Ga0207671_1000023412 329
106 3300025981 Ga0207640_10092132 Ga0207640_100921322 329
107 3300026142 Ga0207698_10025061 Ga0207698_100250613 329
108 3300028379 Ga0268266_10017319 Ga0268266_100173195 329
109 3300006353 Ga0075370_10002288 Ga0075370_100022889 330
110 iso_pu_bacteria 2582581304 2585257167 330
111 3300002773 JGI25152J39213_1000169 JGI25152J39213_100016923 331
112 3300002774 JGI25150J39212_1000018 JGI25150J39212_100001852 331
113 3300003187 JGI25151J46595_10000034 JGI25151J46595_10000034126 331
114 3300003215 JGI25153J46596_10002149 JGI25153J46596_100021498 331
115 3300048904 Ga0496101_0150338 Ga0496101_0150338_711_1736 331
116 3300048920 Ga0496117_0005859 Ga0496117_0005859_11618_12643 331
117 3300048921 Ga0496118_0199170 Ga0496118_0199170_33_1058 331
118 3300048924 Ga0496121_0011216 Ga0496121_0011216_125_1150 331
119 3300048925 Ga0496122_0015840 Ga0496122_0015840_124_1149 331
120 3300048926 Ga0496123_0004280 Ga0496123_0004280_5347_6372 331
121 3300048927 Ga0496124_0003574 Ga0496124_0003574_17754_18779 331
122 3300048928 Ga0496125_0004702 Ga0496125_0004702_9879_10904 331
123 iso_pu_bacteria 2510917030 2511194249 331
124 iso_pu_bacteria 2582581298 2585224115 331
125 iso_pu_bacteria 2582581299 2585231865 331
126 iso_pu_bacteria 2585427529 2585549815 331
127 iso_pu_bacteria 2585427594 2585845069 331
128 iso_pu_bacteria 2643221599 2644002651 331
129 iso_pu_bacteria 2643221634 2644194642 331
130 iso_pu_bacteria 2718217882 2719183138 331
131 iso_pu_bacteria 2718218009 2719733855 331
132 iso_pu_bacteria 2718218363 2721149250 331
133 iso_pu_bacteria 2718218365 2721160652 331
134 iso_pu_bacteria 2718218366 2721166063 331
135 iso_pu_bacteria 2721755514 2722842233 331
136 iso_pu_bacteria 2721755810 2724046611 331
137 iso_pu_bacteria 2728369365 2730166373 331
138 iso_pu_bacteria 2728369397 2730300284 331
139 iso_pu_bacteria 2738541293 2738801016 331
140 iso_pu_bacteria 2791355260 2793324571 331
141 iso_pu_bacteria 2791355264 2793346774 331
142 iso_pu_bacteria 2838022645 2838023828 331
143 iso_pu_bacteria 2842163707 2842166893 331
144 iso_pu_bacteria 2842198810 2842201183 331
145 iso_pu_bacteria 2842217011 2842221965 331
146 iso_pu_bacteria 2842285085 2842290356 331
147 iso_pu_bacteria 2842304105 2842305636 331
148 iso_pu_bacteria 2842402390 2842408190 331
149 iso_pu_bacteria 2842409023 2842414952 331
150 iso_pu_bacteria 2842415677 2842421539 331
151 iso_pu_bacteria 3005452660 3005456143 331
152 iso_pu_bacteria 8005301065 8005306132 331
153 iso_pu_bacteria 8005688590 8005694171 331
154 3300048904 Ga0496101_0155654 Ga0496101_0155654_117_1142 332
155 3300048919 Ga0496116_0002951 Ga0496116_0002951_4559_5584 332
156 3300048921 Ga0496118_0008792 Ga0496118_0008792_8150_9175 332
157 3300048925 Ga0496122_0019377 Ga0496122_0019377_4307_5332 332
158 3300048927 Ga0496124_0019169 Ga0496124_0019169_4539_5564 332
159 3300048927 Ga0496124_0031109 Ga0496124_0031109_3614_4639 332
160 3300048929 Ga0496126_0200475 Ga0496126_0200475_308_1333 332
161 iso_pu_bacteria 2510917028 2511185221 332
162 iso_pu_bacteria 2513237088 2513597842 332
163 iso_pu_bacteria 2513237138 2513865121 332
164 iso_pu_bacteria 2513237144 2513912909 332
165 iso_pu_bacteria 2513237146 2513929502 332
166 iso_pu_bacteria 2524023209 2524461191 332
167 iso_pu_bacteria 2534681796 2535519220 332
168 iso_pu_bacteria 2582581294 2585201544 332
169 iso_pu_bacteria 2582581867 2585399947 332
170 iso_pu_bacteria 2585427590 2585821036 332
171 iso_pu_bacteria 2838035591 2838042006 332
172 iso_pu_bacteria 2923556063 2923559963 332
173 iso_pu_bacteria 2978969890 2978972752 332
174 iso_pu_bacteria 2984587000 2984591004 332
175 iso_pu_bacteria 2996887358 2996890465 332
176 iso_pu_bacteria 3005409236 3005415968 332
177 iso_pu_bacteria 8005258706 8005262652 332
178 iso_pu_bacteria 8005321885 8005324992 332
179 iso_pu_bacteria 8005542996 8005546877 332
180 iso_pu_bacteria 8024486573 8024491020 332
181 iso_pu_bacteria 8046767195 8046768364 332
182 3300002739 JGI25158J39367_1000191 JGI25158J39367_100019111 335
183 3300002773 JGI25152J39213_1004374 JGI25152J39213_10043742 335
184 3300002774 JGI25150J39212_1009701 JGI25150J39212_10097012 335
185 3300002987 JGI25159J45721_1002910 JGI25159J45721_10029106 335
186 3300003215 JGI25153J46596_10029546 JGI25153J46596_100295461 335
187 3300003374 JGI25161J50226_1000214 JGI25161J50226_100021411 335
188 3300003771 Ga0055526_1010755 Ga0055526_10107554 335
189 3300003771 Ga0055526_1013485 Ga0055526_10134854 335
190 3300003775 Ga0055524_1005939 Ga0055524_10059396 335
191 3300003775 Ga0055524_1034625 Ga0055524_10346251 335
192 3300003790 Ga0055528_1000452 Ga0055528_100045213 335
193 3300003790 Ga0055528_1006339 Ga0055528_10063394 335
194 3300003790 Ga0055528_1023092 Ga0055528_10230921 335
195 3300004625 Ga0055543_1000330 Ga0055543_100033018 335
196 3300005262 Ga0065165_1023748 Ga0065165_10237482 335
197 3300005262 Ga0065165_1029954 Ga0065165_10299542 335
198 3300009765 Ga0123341_1000071 Ga0123341_100007136 335
199 3300021320 Ga0214544_1000079 Ga0214544_100007963 335
200 3300021321 Ga0214542_1000064 Ga0214542_100006468 335
201 3300021327 Ga0214543_1000063 Ga0214543_100006344 335
202 3300025208 Ga0209436_100013 Ga0209436_10001362 335
203 3300025245 Ga0207425_1009239 Ga0207425_10092393 335
204 3300025258 Ga0209129_1000050 Ga0209129_100005060 335
205 3300025258 Ga0209129_1001114 Ga0209129_10011144 335
206 3300025258 Ga0209129_1001662 Ga0209129_10016623 335
207 3300025273 Ga0209673_1000033 Ga0209673_100003358 335
208 3300025273 Ga0209673_1001321 Ga0209673_10013215 335
209 3300025284 Ga0209130_1000009 Ga0209130_100000961 335
210 3300025294 Ga0209025_1000815 Ga0209025_100081519 335
211 3300025294 Ga0209025_1017618 Ga0209025_10176184 335
212 3300025295 Ga0209564_1007892 Ga0209564_10078922 335
213 3300025295 Ga0209564_1038108 Ga0209564_10381082 335
214 3300025297 Ga0209758_1000864 Ga0209758_100086417 335
215 3300025297 Ga0209758_1001462 Ga0209758_100146220 335
216 3300025297 Ga0209758_1037152 Ga0209758_10371522 335
217 3300025299 Ga0209256_1001479 Ga0209256_100147919 335
218 3300025299 Ga0209256_1006504 Ga0209256_10065045 335
219 3300025302 Ga0207426_1000450 Ga0207426_10004503 335
220 3300025303 Ga0209051_1021614 Ga0209051_10216141 335
221 3300025303 Ga0209051_1033630 Ga0209051_10336303 335
222 3300026067 Ga0207678_10258271 Ga0207678_102582711 335
223 3300028379 Ga0268266_10088034 Ga0268266_100880343 335
224 3300031649 Ga0307514_10224815 Ga0307514_102248151 335
225 3300037471 Ga0395905_0016023 Ga0395905_0016023_5285_6295 335
226 3300046506 Ga0495583_0009155 Ga0495583_0009155_4248_5258 335
227 3300046512 Ga0495610_0000363 Ga0495610_0000363_14024_15034 335
228 3300046513 Ga0495616_0037833 Ga0495616_0037833_922_1932 335
229 3300046515 Ga0495620_0038156 Ga0495620_0038156_706_1716 335
230 3300046519 Ga0495632_0038705 Ga0495632_0038705_584_1594 335
231 3300046522 Ga0495643_0031872 Ga0495643_0031872_466_1479 335
232 3300046660 Ga0495625_0023025 Ga0495625_0023025_2204_3214 335
233 3300046810 Ga0495660_0034931 Ga0495660_0034931_918_1928 335
234 3300047469 Ga0495673_0047636 Ga0495673_0047636_548_1558 335
235 3300047472 Ga0495686_0002138 Ga0495686_0002138_13726_14736 335
236 3300048921 Ga0496118_0008237 Ga0496118_0008237_1235_2242 335
237 3300048924 Ga0496121_0091583 Ga0496121_0091583_515_1528 335
238 3300048927 Ga0496124_0200285 Ga0496124_0200285_456_1466 335
239 3300049459 Ga0495678_024671 Ga0495678_024671_216_1226 335
240 3300050496 nmdc:mga07m45_124317_c1 nmdc:mga07m45_124317_c1_185_1192 335
241 3300053109 Ga0500569_004466 Ga0500569_004466_248_1258 335
242 3300053118 Ga0500594_0007198 Ga0500594_0007198_116_1126 335
243 3300053156 Ga0500622_0000169 Ga0500622_0000169_35340_36353 335
244 3300053156 Ga0500622_0045920 Ga0500622_0045920_602_1612 335
245 iso_pu_bacteria 2995392953 2995394302 335
246 3300002987 JGI25159J45721_1000486 JGI25159J45721_100048615 336
247 3300003316 rootH1_10052842 rootH1_100528422 336
248 3300003320 rootH2_10016965 rootH2_100169652 336
249 3300003323 rootH1_10095635 rootH1_100956352 336
250 3300003354 JGI25160J50197_1000051 JGI25160J50197_100005160 336
251 3300003374 JGI25161J50226_1000011 JGI25161J50226_1000011134 336
252 3300003771 Ga0055526_1017527 Ga0055526_10175272 336
253 3300004625 Ga0055543_1000041 Ga0055543_100004145 336
254 3300005262 Ga0065165_1000303 Ga0065165_100030314 336
255 3300005335 Ga0070666_10007959 Ga0070666_100079592 336
256 3300005347 Ga0070668_100008156 Ga0070668_1000081566 336
257 3300005355 Ga0070671_100132672 Ga0070671_1001326722 336
258 3300005367 Ga0070667_100338664 Ga0070667_1003386641 336
259 3300006186 Ga0075369_10010550 Ga0075369_100105504 336
260 3300014325 Ga0163163_10266655 Ga0163163_102666552 336
261 3300025258 Ga0209129_1000826 Ga0209129_100082613 336
262 3300025273 Ga0209673_1001329 Ga0209673_100132928 336
263 3300025273 Ga0209673_1024489 Ga0209673_10244892 336
264 3300025284 Ga0209130_1000058 Ga0209130_100005860 336
265 3300025294 Ga0209025_1008730 Ga0209025_10087305 336
266 3300025295 Ga0209564_1004168 Ga0209564_10041687 336
267 3300025295 Ga0209564_1028940 Ga0209564_10289402 336
268 3300025299 Ga0209256_1017619 Ga0209256_10176193 336
269 3300025299 Ga0209256_1020044 Ga0209256_10200442 336
270 3300025302 Ga0207426_1000131 Ga0207426_100013160 336
271 3300025302 Ga0207426_1000682 Ga0207426_100068223 336
272 3300025303 Ga0209051_1004006 Ga0209051_10040066 336
273 3300025904 Ga0207647_10063583 Ga0207647_100635831 336
274 3300025986 Ga0207658_10296609 Ga0207658_102966091 336
275 3300028794 Ga0307515_10295348 Ga0307515_102953481 336
276 3300048923 Ga0496120_0056066 Ga0496120_0056066_851_1861 336
277 3300048924 Ga0496121_0067785 Ga0496121_0067785_1200_2210 336
278 3300048925 Ga0496122_0023049 Ga0496122_0023049_1632_2648 336
279 3300048928 Ga0496125_0178102 Ga0496125_0178102_91_1101 336
280 3300053156 Ga0500622_0000441 Ga0500622_0000441_15560_16573 336
281 3300053157 Ga0500624_000633 Ga0500624_000633_8094_9128 336
282 iso_pu_bacteria 2721755823 2724112178 336
283 iso_pu_bacteria 2929138655 2929142008 336
284 iso_pu_bacteria 2558860983 2561468557 337
285 iso_pu_bacteria 2537561587 2537874466 338
286 iso_pu_bacteria 2554235003 2554248996 338
287 iso_pu_bacteria 2558860242 2559296084 338
288 iso_pu_bacteria 2599185210 2599603123 338
289 iso_pu_bacteria 2600255279 2601610972 338
290 iso_pu_bacteria 2600255308 2601747746 338
291 iso_pu_bacteria 2643221582 2643921608 338
292 iso_pu_bacteria 2643221693 2644521662 338
293 iso_pu_bacteria 2808606387 2808988090 338
294 iso_pu_bacteria 2818991272 2819244458 338
295 iso_pu_bacteria 2818991439 2819561094 338
296 iso_pu_bacteria 2821123053 2821129201 338
297 iso_pu_bacteria 2838675328 2838678535 338
298 iso_pu_bacteria 2838714209 2838718377 338
299 iso_pu_bacteria 2838719591 2838722831 338
300 iso_pu_bacteria 2838724970 2838728443 338
301 iso_pu_bacteria 2838736955 2838742218 338
302 iso_pu_bacteria 2841840854 2841846074 338
303 iso_pu_bacteria 2841846520 2841850387 338
304 iso_pu_bacteria 2841859092 2841863360 338
305 iso_pu_bacteria 2842124991 2842129103 338
306 iso_pu_bacteria 2842130223 2842133428 338
307 iso_pu_bacteria 2842152218 2842155661 338
308 iso_pu_bacteria 2842170452 2842174381 338
309 iso_pu_bacteria 2842175837 2842179042 338
310 iso_pu_bacteria 2842187318 2842190801 338
311 iso_pu_bacteria 2842211629 2842214875 338
312 iso_pu_bacteria 2842224351 2842227596 338
313 iso_pu_bacteria 2842515876 2842519903 338
314 iso_pu_bacteria 2857531043 2857536142 338
315 iso_pu_bacteria 2899792073 2899794812 338
316 iso_pu_bacteria 2899845264 2899849435 338
317 iso_pu_bacteria 2919114240 2919118366 338
318 iso_pu_bacteria 2926754445 2926754895 338
319 iso_pu_bacteria 2926760298 2926762060 338
320 iso_pu_bacteria 2933006813 2933010493 338
321 iso_pu_bacteria 2933011516 2933015835 338
322 iso_pu_bacteria 2933594066 2933597427 338
323 iso_pu_bacteria 2979089926 2979092671 338
324 iso_pu_bacteria 2979095461 2979099938 338
325 iso_pu_bacteria 2979100975 2979104643 338
326 iso_pu_bacteria 2984509177 2984513560 338
327 iso_pu_bacteria 2984518228 2984522860 338
328 iso_pu_bacteria 2984537506 2984542168 338
329 iso_pu_bacteria 2984601300 2984601596 338
330 iso_pu_bacteria 3003930520 3003931148 338
331 iso_pu_bacteria 8003570095 8003573638 338
332 iso_pu_bacteria 2508501122 2509108855 339
333 iso_pu_bacteria 2509276019 2509377985 339
334 iso_pu_bacteria 2509276021 2509389228 339
335 iso_pu_bacteria 2510065019 2510135427 339
336 iso_pu_bacteria 2510461069 2510839195 339
337 iso_pu_bacteria 2510461076 2510896886 339
338 iso_pu_bacteria 2513237084 2513572874 339
339 iso_pu_bacteria 2513237085 2513580407 339
340 iso_pu_bacteria 2513237093 2513634909 339
341 iso_pu_bacteria 2513237103 2513711530 339
342 iso_pu_bacteria 2513237162 2514023176 339
343 iso_pu_bacteria 2515075009 2515114599 339
344 iso_pu_bacteria 2515154113 2515634981 339
345 iso_pu_bacteria 2515154114 2515644455 339
346 iso_pu_bacteria 2515154116 2515660968 339
347 iso_pu_bacteria 2515154134 2515741782 339
348 iso_pu_bacteria 2516653077 2517038242 339
349 iso_pu_bacteria 2516653085 2517078520 339
350 iso_pu_bacteria 2517093000 2517097259 339
351 iso_pu_bacteria 2517287029 2517408352 339
352 iso_pu_bacteria 2519899620 2520379803 339
353 iso_pu_bacteria 2529292951 2530647175 339
354 iso_pu_bacteria 2558860100 2558867514 339
355 iso_pu_bacteria 2585427526 2585529181 339
356 iso_pu_bacteria 2585427593 2585839233 339
357 iso_pu_bacteria 2599185156 2599335743 339
358 iso_pu_bacteria 2599185236 2599722644 339
359 iso_pu_bacteria 2643221557 2643807933 339
360 iso_pu_bacteria 2643221610 2644068876 339
361 iso_pu_bacteria 2643221653 2644299682 339
362 iso_pu_bacteria 2643221668 2644378398 339
363 iso_pu_bacteria 2643221675 2644419947 339
364 iso_pu_bacteria 2643221680 2644453303 339
365 iso_pu_bacteria 2643221719 2644657910 339
366 iso_pu_bacteria 2643221723 2644675102 339
367 iso_pu_bacteria 2643221726 2644688670 339
368 iso_pu_bacteria 2718217927 2719387858 339
369 iso_pu_bacteria 2718217997 2719667478 339
370 iso_pu_bacteria 2718218199 2720493898 339
371 iso_pu_bacteria 2718218232 2720615359 339
372 iso_pu_bacteria 2718218233 2720622147 339
373 iso_pu_bacteria 2718218235 2720633501 339
374 iso_pu_bacteria 2718218269 2720777199 339
375 iso_pu_bacteria 2718218423 2721401491 339
376 iso_pu_bacteria 2721755684 2723562410 339
377 iso_pu_bacteria 2721755685 2723569106 339
378 iso_pu_bacteria 2721755809 2724040305 339
379 iso_pu_bacteria 2721755819 2724091806 339
380 iso_pu_bacteria 2721755822 2724106371 339
381 iso_pu_bacteria 2724679232 2725945789 339
382 iso_pu_bacteria 2738541333 2739037693 339
383 iso_pu_bacteria 2765235942 2766064076 339
384 iso_pu_bacteria 2775507049 2776915667 339
385 iso_pu_bacteria 2791355082 2792582346 339
386 iso_pu_bacteria 2791355256 2793295455 339
387 iso_pu_bacteria 2791355259 2793317953 339
388 iso_pu_bacteria 2791355261 2793329614 339
389 iso_pu_bacteria 2791355262 2793332410 339
390 iso_pu_bacteria 2791355263 2793339004 339
391 iso_pu_bacteria 2791355265 2793356790 339
392 iso_pu_bacteria 2791355266 2793359198 339
393 iso_pu_bacteria 2791355267 2793366078 339
394 iso_pu_bacteria 2802429605 2805930917 339
395 iso_pu_bacteria 2802429606 2805936766 339
396 iso_pu_bacteria 2802429633 2806047762 339
397 iso_pu_bacteria 2802429634 2806055338 339
398 iso_pu_bacteria 2802429635 2806062219 339
399 iso_pu_bacteria 2802429636 2806070022 339
400 iso_pu_bacteria 2802429637 2806076678 339
401 iso_pu_bacteria 2838016132 2838018148 339
402 iso_pu_bacteria 2838042994 2838046764 339
403 iso_pu_bacteria 2838048938 2838050993 339
404 iso_pu_bacteria 2838061910 2838062759 339
405 iso_pu_bacteria 2838068647 2838072304 339
406 iso_pu_bacteria 2838668709 2838674237 339
407 iso_pu_bacteria 2838680041 2838683700 339
408 iso_pu_bacteria 2838686498 2838693353 339
409 iso_pu_bacteria 2838694306 2838698228 339
410 iso_pu_bacteria 2838701080 2838706640 339
411 iso_pu_bacteria 2838707686 2838711343 339
412 iso_pu_bacteria 2838729681 2838735347 339
413 iso_pu_bacteria 2838742623 2838748104 339
414 iso_pu_bacteria 2841851746 2841857419 339
415 iso_pu_bacteria 2841864319 2841867577 339
416 iso_pu_bacteria 2842077413 2842081144 339
417 iso_pu_bacteria 2842110456 2842116604 339
418 iso_pu_bacteria 2842118031 2842122079 339
419 iso_pu_bacteria 2842146304 2842148969 339
420 iso_pu_bacteria 2842156927 2842162406 339
421 iso_pu_bacteria 2842180545 2842186046 339
422 iso_pu_bacteria 2842192696 2842194710 339
423 iso_pu_bacteria 2842205361 2842207591 339
424 iso_pu_bacteria 2842229732 2842235505 339
425 iso_pu_bacteria 2842237096 2842241093 339
426 iso_pu_bacteria 2842243621 2842249212 339
427 iso_pu_bacteria 2842250916 2842256431 339
428 iso_pu_bacteria 2842257432 2842263167 339
429 iso_pu_bacteria 2842264693 2842269268 339
430 iso_pu_bacteria 2842271015 2842277821 339
431 iso_pu_bacteria 2842278818 2842280698 339
432 iso_pu_bacteria 2842291075 2842294801 339
433 iso_pu_bacteria 2842311132 2842311596 339
434 iso_pu_bacteria 2842317721 2842323656 339
435 iso_pu_bacteria 2842341865 2842346878 339
436 iso_pu_bacteria 2842363717 2842366091 339
437 iso_pu_bacteria 2842370503 2842375181 339
438 iso_pu_bacteria 2842377471 2842381199 339
439 iso_pu_bacteria 2842384541 2842388270 339
440 iso_pu_bacteria 2842395702 2842395760 339
441 iso_pu_bacteria 2842422224 2842425936 339
442 iso_pu_bacteria 2842428310 2842433448 339
443 iso_pu_bacteria 2842434925 2842439497 339
444 iso_pu_bacteria 2842441272 2842446195 339
445 iso_pu_bacteria 2842447887 2842448566 339
446 iso_pu_bacteria 2842462802 2842467697 339
447 iso_pu_bacteria 2842469257 2842474339 339
448 iso_pu_bacteria 2842489311 2842491348 339
449 iso_pu_bacteria 2842495871 2842501917 339
450 iso_pu_bacteria 2842922631 2842926469 339
451 iso_pu_bacteria 2844454524 2844456798 339
452 iso_pu_bacteria 2850079185 2850082759 339
453 iso_pu_bacteria 2857516855 2857519768 339
454 iso_pu_bacteria 2913295892 2913300292 339
455 iso_pu_bacteria 2919100787 2919107951 339
456 iso_pu_bacteria 2920822456 2920826064 339
457 iso_pu_bacteria 2933570622 2933572143 339
458 iso_pu_bacteria 2933586486 2933592790 339
459 iso_pu_bacteria 2933599457 2933602844 339
460 iso_pu_bacteria 2935894831 2935898118 339
461 iso_pu_bacteria 2935901341 2935903440 339
462 iso_pu_bacteria 2936367885 2936370086 339
463 iso_pu_bacteria 2936375103 2936379262 339
464 iso_pu_bacteria 2936381700 2936381761 339
465 iso_pu_bacteria 2989776772 2989780257 339
466 iso_pu_bacteria 2996893221 2996896203 339
467 iso_pu_bacteria 3005445848 3005449852 339
468 iso_pu_bacteria 639633055 639645858 339
469 iso_pu_bacteria 8005246636 8005249418 339
470 iso_pu_bacteria 8005275841 8005282616 339
471 iso_pu_bacteria 8005282627 8005286569 339
472 iso_pu_bacteria 8005289223 8005291993 339
473 iso_pu_bacteria 8005307578 8005309706 339
474 iso_pu_bacteria 8005376324 8005381384 339
475 iso_pu_bacteria 8005382845 8005387594 339
476 iso_pu_bacteria 8005395548 8005398430 339
477 iso_pu_bacteria 8005430974 8005431969 339
478 iso_pu_bacteria 8005460587 8005465294 339
479 iso_pu_bacteria 8005497431 8005497872 339
480 iso_pu_bacteria 8005556819 8005561359 339
481 iso_pu_bacteria 8005563573 8005565981 339
482 iso_pu_bacteria 8005570704 8005572030 339
483 iso_pu_bacteria 8005619151 8005623606 339
484 iso_pu_bacteria 8005626139 8005630833 339
485 iso_pu_bacteria 8005668836 8005669278 339
486 iso_pu_bacteria 8005695170 8005695817 339
487 iso_pu_bacteria 8018127388 8018128662 339
488 iso_pu_bacteria 8018163183 8018164904 339
489 iso_pu_bacteria 8018176218 8018177656 339
490 iso_pu_bacteria 8023680758 8023686737 339
491 iso_pu_bacteria 8024479707 8024484556 339
492 iso_pu_bacteria 8024501048 8024504029 339
493 iso_pu_bacteria 8049293176 8049296403 339
494 iso_pu_bacteria 8056375014 8056380590 339
495 iso_pu_bacteria 8056382006 8056383350 339
496 iso_pu_bacteria 8056875544 8056878367 339
497 iso_pu_bacteria 8057874678 8057879475 339
498 3300028794 Ga0307515_10012908 Ga0307515_100129089 340
499 3300048914 Ga0496111_0000529 Ga0496111_0000529_11361_12383 340
500 3300048920 Ga0496117_0010245 Ga0496117_0010245_4886_5914 340
501 3300048923 Ga0496120_0008826 Ga0496120_0008826_245_1273 340
502 3300048924 Ga0496121_0000034 Ga0496121_0000034_59775_60803 340
503 3300048924 Ga0496121_0146731 Ga0496121_0146731_316_1341 340
504 3300048926 Ga0496123_0018773 Ga0496123_0018773_374_1396 340
505 3300048927 Ga0496124_0001215 Ga0496124_0001215_34067_35089 340
506 3300048927 Ga0496124_0011810 Ga0496124_0011810_6332_7360 340
507 3300048928 Ga0496125_0000030 Ga0496125_0000030_314136_315164 340
508 iso_pu_bacteria 2510917022 2511135839 340
509 iso_pu_bacteria 2510917026 2511168434 340
510 iso_pu_bacteria 2513237159 2514001713 340
511 iso_pu_bacteria 2582581283 2585166498 340
512 iso_pu_bacteria 2582581307 2585272071 340
513 iso_pu_bacteria 2585427531 2585563384 340
514 iso_pu_bacteria 2585427608 2585897195 340
515 iso_pu_bacteria 2585427609 2585909109 340
516 iso_pu_bacteria 2585427633 2585998083 340
517 iso_pu_bacteria 2585427634 2586002662 340
518 iso_pu_bacteria 2585428125 2587984523 340
519 iso_pu_bacteria 2599185170 2599419956 340
520 iso_pu_bacteria 2600254933 2600377448 340
521 iso_pu_bacteria 2615840698 2616551101 340
522 iso_pu_bacteria 2617270742 2617382332 340
523 iso_pu_bacteria 2643221558 2643814893 340
524 iso_pu_bacteria 2643221607 2644052448 340
525 iso_pu_bacteria 2643221636 2644201169 340
526 iso_pu_bacteria 2643221643 2644240307 340
527 iso_pu_bacteria 2643221686 2644484726 340
528 iso_pu_bacteria 2643221689 2644501246 340
529 iso_pu_bacteria 2667528174 2671116020 340
530 iso_pu_bacteria 2738541317 2738947105 340
531 iso_pu_bacteria 2775507266 2778179225 340
532 iso_pu_bacteria 2791355253 2793281839 340
533 iso_pu_bacteria 2818991448 2819611981 340
534 iso_pu_bacteria 2818991461 2819688369 340
535 iso_pu_bacteria 2842475841 2842480904 340
536 iso_pu_bacteria 2842482326 2842485289 340
537 iso_pu_bacteria 2842502639 2842507485 340
538 iso_pu_bacteria 2842509118 2842514683 340
539 iso_pu_bacteria 2842521101 2842527064 340
540 iso_pu_bacteria 2854896431 2854897785 340
541 iso_pu_bacteria 2854916844 2854922321 340
542 iso_pu_bacteria 2891373044 2891377785 340
543 iso_pu_bacteria 2899803654 2899805013 340
544 iso_pu_bacteria 2913308742 2913312066 340
545 iso_pu_bacteria 2919171160 2919176877 340
546 iso_pu_bacteria 2919408235 2919411462 340
547 iso_pu_bacteria 2933016740 2933017808 340
548 iso_pu_bacteria 2989349275 2989355080 340
549 iso_pu_bacteria 2989771324 2989771765 340
550 iso_pu_bacteria 3005416602 3005416880 340
551 iso_pu_bacteria 643692032 643827533 340
552 iso_pu_bacteria 8005314921 8005315916 340
553 iso_pu_bacteria 8005645114 8005645200 340
554 iso_pu_bacteria 8005682033 8005687354 340
555 iso_pu_bacteria 8055431914 8055432963 340
556 iso_pu_bacteria 8057575449 8057581967 340
557 3300046530 Ga0495654_0000143 Ga0495654_0000143_56500_57534 341
558 3300047472 Ga0495686_0012296 Ga0495686_0012296_3329_4363 341
559 3300053125 Ga0500618_000701 Ga0500618_000701_16926_17960 341
560 3300005548 Ga0070665_100005296 Ga0070665_10000529613 342
561 3300006042 Ga0075368_10000331 Ga0075368_100003312 342
562 3300006048 Ga0075363_100020723 Ga0075363_1000207233 342
563 3300006177 Ga0075362_10008613 Ga0075362_100086134 342
564 3300006178 Ga0075367_10035020 Ga0075367_100350202 342
565 3300006186 Ga0075369_10000392 Ga0075369_100003927 342
566 3300006948 Ga0099826_10000813 Ga0099826_1000081310 342
567 3300013100 Ga0157373_10013927 Ga0157373_100139274 342
568 3300013102 Ga0157371_10000071 Ga0157371_1000007198 342
569 3300013104 Ga0157370_10000079 Ga0157370_1000007946 342
570 3300025935 Ga0207709_10063143 Ga0207709_100631432 342
571 3300027312 Ga0209371_1000037 Ga0209371_1000037275 342
572 3300027312 Ga0209371_1001411 Ga0209371_10014118 342
573 3300027666 Ga0209282_1000695 Ga0209282_100069510 342
574 3300027866 Ga0209813_10026416 Ga0209813_100264161 342
575 3300028379 Ga0268266_10049742 Ga0268266_100497422 342
576 3300030500 Ga0268256_1000039 Ga0268256_100003933 342
577 3300030500 Ga0268256_1001490 Ga0268256_100149012 342
578 3300036647 Ga0316582_0046199 Ga0316582_0046199_202_1230 342
579 3300046692 Ga0495671_0022537 Ga0495671_0022537_971_2005 342
580 3300048920 Ga0496117_0000031 Ga0496117_0000031_322901_323935 342
581 3300048920 Ga0496117_0051336 Ga0496117_0051336_908_1942 342
582 3300048921 Ga0496118_0000208 Ga0496118_0000208_67302_68336 342
583 3300048922 Ga0496119_0070713 Ga0496119_0070713_189_1217 342
584 3300048923 Ga0496120_0000387 Ga0496120_0000387_49899_50933 342
585 3300048925 Ga0496122_0000023 Ga0496122_0000023_322889_323923 342
586 3300048925 Ga0496122_0000308 Ga0496122_0000308_67250_68278 342
587 3300048926 Ga0496123_0000027 Ga0496123_0000027_57113_58147 342
588 3300048926 Ga0496123_0000066 Ga0496123_0000066_67017_68045 342
589 3300048927 Ga0496124_0036348 Ga0496124_0036348_1097_2131 342
590 3300048928 Ga0496125_0134582 Ga0496125_0134582_489_1523 342
591 3300050491 nmdc:mga00v17_15_c1 nmdc:mga00v17_15_c1_70972_72006 342
592 3300050494 nmdc:mga06z11_78565_c1 nmdc:mga06z11_78565_c1_453_1487 342
593 3300050495 nmdc:mga04h51_2783_c1 nmdc:mga04h51_2783_c1_2887_3921 342
594 3300050516 nmdc:mga0sz30_2785_c1 nmdc:mga0sz30_2785_c1_2387_3421 342
595 3300050516 nmdc:mga0sz30_735_c1 nmdc:mga0sz30_735_c1_6061_7095 342
596 3300050516 nmdc:mga0sz30_97391_c1 nmdc:mga0sz30_97391_c1_160_1194 342
597 3300053107 Ga0500560_001162 Ga0500560_001162_1811_2845 342
598 3300059510 Ga0587090_006764 Ga0587090_006764_231_1265 342
599 3300003775 Ga0055524_1000962 Ga0055524_100096210 343
600 3300003781 Ga0055536_1023578 Ga0055536_10235782 343
601 3300003792 Ga0055540_1000597 Ga0055540_100059712 343
602 3300006353 Ga0075370_10079776 Ga0075370_100797761 343
603 3300006946 Ga0079104_1000310 Ga0079104_100031025 343
604 3300021321 Ga0214542_1012059 Ga0214542_10120598 343
605 3300021327 Ga0214543_1000015 Ga0214543_1000015195 343
606 3300025273 Ga0209673_1000050 Ga0209673_1000050201 343
607 3300025295 Ga0209564_1000227 Ga0209564_100022767 343
608 3300025299 Ga0209256_1000286 Ga0209256_100028611 343
609 3300025299 Ga0209256_1001610 Ga0209256_100161015 343
610 3300025299 Ga0209256_1035975 Ga0209256_10359752 343
611 3300025303 Ga0209051_1000118 Ga0209051_100011813 343
612 3300025304 Ga0209257_1002918 Ga0209257_10029184 343
613 3300027111 Ga0209281_1000028 Ga0209281_1000028244 343
614 3300028794 Ga0307515_10001099 Ga0307515_1000109922 343
615 3300031456 Ga0307513_10000998 Ga0307513_1000099844 343
616 3300031456 Ga0307513_10282324 Ga0307513_102823242 343
617 3300048927 Ga0496124_0192459 Ga0496124_0192459_472_1506 343
618 3300049570 Ga0501033_0012136 Ga0501033_0012136_1011_2048 343
619 3300049822 Ga0501035_0002574 Ga0501035_0002574_1040_2077 343
620 3300002704 JGI25155J39150_1000018 JGI25155J39150_100001884 344
621 3300002705 JGI25156J39149_1000055 JGI25156J39149_100005557 344
622 3300002737 JGI25162J39368_1000903 JGI25162J39368_10009032 344
623 3300002738 JGI25154J39366_1000069 JGI25154J39366_100006941 344
624 3300002741 JGI25157J39369_1000076 JGI25157J39369_100007657 344
625 3300003214 JGI25165J46597_1000974 JGI25165J46597_10009742 344
626 3300003215 JGI25153J46596_10023547 JGI25153J46596_100235472 344
627 3300003781 Ga0055536_1004552 Ga0055536_10045525 344
628 3300003792 Ga0055540_1008997 Ga0055540_10089976 344
629 3300003794 Ga0055531_10001167 Ga0055531_100011674 344
630 3300005548 Ga0070665_100117083 Ga0070665_1001170832 344
631 3300005614 Ga0068856_100093783 Ga0068856_1000937832 344
632 3300006038 Ga0075365_10007891 Ga0075365_100078914 344
633 3300025206 Ga0209435_100031 Ga0209435_10003186 344
634 3300025230 Ga0209563_105689 Ga0209563_1056891 344
635 3300025233 Ga0209437_100179 Ga0209437_10017963 344
636 3300025246 Ga0209646_1000102 Ga0209646_100010286 344
637 3300025250 Ga0209026_1000096 Ga0209026_100009686 344
638 3300025256 Ga0209759_1000090 Ga0209759_100009086 344
639 3300025261 Ga0209233_1000185 Ga0209233_100018562 344
640 3300025294 Ga0209025_1000042 Ga0209025_100004287 344
641 3300025297 Ga0209758_1000406 Ga0209758_100040650 344
642 3300025303 Ga0209051_1000547 Ga0209051_10005473 344
643 3300025304 Ga0209257_1006107 Ga0209257_10061073 344
644 3300026078 Ga0207702_10056535 Ga0207702_100565353 344
645 3300028379 Ga0268266_10076760 Ga0268266_100767603 344
646 3300028794 Ga0307515_10069879 Ga0307515_100698792 344
647 3300030500 Ga0268256_1006162 Ga0268256_10061624 344
648 3300031548 Ga0307408_100028873 Ga0307408_1000288733 344
649 3300031901 Ga0307406_10096826 Ga0307406_100968263 344
650 3300031911 Ga0307412_10155397 Ga0307412_101553972 344
651 3300037471 Ga0395905_0002522 Ga0395905_0002522_13867_14904 344
652 3300042145 Ga0450906_003057 Ga0450906_003057_2455_3489 344
653 3300044842 Ga0466957_0100894 Ga0466957_0100894_118_1158 344
654 3300046501 Ga0495607_0030930 Ga0495607_0030930_943_1977 344
655 3300046522 Ga0495643_0151341 Ga0495643_0151341_15_1049 344
656 3300047472 Ga0495686_0001162 Ga0495686_0001162_14617_15657 344
657 3300048922 Ga0496119_0008902 Ga0496119_0008902_6998_8032 344
658 3300048925 Ga0496122_0000082 Ga0496122_0000082_147107_148156 344
659 3300048925 Ga0496122_0020473 Ga0496122_0020473_2798_3832 344
660 3300048926 Ga0496123_0000067 Ga0496123_0000067_61004_62053 344
661 3300048926 Ga0496123_0031587 Ga0496123_0031587_567_1601 344
662 3300049568 Ga0501031_0040846 Ga0501031_0040846_176_1210 344
663 3300050492 nmdc:mga0yw44_4777_c2 nmdc:mga0yw44_4777_c2_3410_4444 344
664 3300053125 Ga0500618_000513 Ga0500618_000513_11721_12758 344
665 3300053133 Ga0500655_000659 Ga0500655_000659_4212_5246 344
666 3300053140 Ga0500573_0000793 Ga0500573_0000793_12220_13254 344
667 3300053153 Ga0500616_0000448 Ga0500616_0000448_17382_18416 344
668 iso_pu_bacteria 650716007 650741300 344

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01208

URO-D

Uroporphyrinogen decarboxylase (URO-D)

1

310

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r3q-assembly1.cif.gz_A uroporphyrinogen decarboxylase in complex with coproporphyrinogen-i 0.9536 7 340
3gw0-assembly1.cif.gz_A-2 urod mutant g318r 0.9535 7 339
1r3s-assembly1.cif.gz_A uroporphyrinogen decarboxylase single mutant d86g in complex with coproporphyrinogen-i 0.9533 7 340
3gvv-assembly1.cif.gz_A single-chain urod y164g (gy) mutation 0.9527 7 340
1r3r-assembly1.cif.gz_A-2 uroporphyrinogen decarboxylase with mutation d86n 0.9524 7 340
ID Description Score Start End Superfamily
1r3sA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9533 7 340 3.20.20.210
af_C6TEE8_35_387_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.945 10 344 3.20.20.210
af_P32347_4_362_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9341 4 339 3.20.20.210
1r3sA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9237 7 340 3.20.20.210
af_C6TEE8_35_387_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9186 10 344 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A529PY46-F1-model_v4 Uroporphyrinogen decarboxylase 0.9969 186 291 GO:0004853
GO:0005829
GO:0019353
AF-A0A1H8Q5Q3-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.9883 10 344 GO:0004853
GO:0005829
GO:0019353
AF-A0A120FGA1-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.988 10 344 GO:0004853
GO:0005829
GO:0019353
AF-A0A528C6M9-F1-model_v4 Uroporphyrinogen decarboxylase 0.9865 189 343 GO:0004853
GO:0005829
GO:0019353
AF-A0A530A317-F1-model_v4 deleted 0.9861 145 343

Feature Viewer

pLDDT pTM Quality
92.16 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map