F473926

General Info

Members Datasets Scaffolds Average Seq Length
668 312 1336 148

Family's Representative Sequence

Representative Sequence 3300025924|Ga0207694_11059134|Ga0207694_110591341
Length 173
Sequence MSIEQNKAVVGRWFTEFWGPDFNPAVIDELAAPDIRFEYSLHAPCRGRDEVRAFATTFRAAFPDLAFGGTADLIAEGDYVVGQWIGGGTQTGDAFDDMPIGELPAGSGKSMRFTGTSVLKVVDGLITEEIGLDDGVTVLQQLGLIPAAVIFFGTIAFGVWYFNREAPRIAEAL

Samples

Sample ID Description Type Environment
1 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
127 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
128 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
193 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
194 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
195 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
196 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
197 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
198 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
203 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
204 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
205 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
210 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
229 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
230 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
231 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
232 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
233 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
234 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
235 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
236 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
243 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
247 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
251 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
252 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
253 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
254 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
257 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
258 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
259 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
260 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
261 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
264 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
272 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
273 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
277 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
278 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
298 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
299 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
302 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
303 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
304 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
305 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
306 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
307 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
308 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
309 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
310 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
311 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
312 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.3
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 6.44
Rhizosphere 90.72
Stem 0
Stem Tuber 0
Unclassified 3.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207694_11059134 3300025924 Unclassified 686
2 LJNas_1013637 3300000546 Bacteria 867
3 JGI24747J21853_1009624 3300001978 Bacteria 959
4 JGI24747J21853_1022322 3300001978 Bacteria 695
5 JGI24739J22299_10198312 3300001989 Bacteria 589
6 JGI24737J22298_10049398 3300001990 Bacteria 1279
7 JGI24743J22301_10035502 3300001991 Bacteria 991
8 JGI24743J22301_10145016 3300001991 Bacteria 530
9 JGI24735J21928_10071363 3300002067 Bacteria 995
10 JGI24750J21931_1018257 3300002070 Bacteria 965
11 JGI24750J21931_1049848 3300002070 Bacteria 652
12 JGI24745J21846_1020092 3300002073 Bacteria 782
13 JGI24748J21848_1033813 3300002074 Bacteria 638
14 JGI24738J21930_10073874 3300002075 Bacteria 709
15 JGI24738J21930_10119568 3300002075 Bacteria 572
16 JGI24744J21845_10001964 3300002077 Bacteria 4155
17 JGI24744J21845_10004780 3300002077 Bacteria 2801
18 JGI24034J26672_10001183 3300002239 Bacteria 3418
19 JGI24034J26672_10031776 3300002239 Bacteria 863
20 JGI24742J22300_10014268 3300002244 Bacteria 1335
21 JGI24742J22300_10029005 3300002244 Bacteria 962
22 Ga0070676_10061991 3300005328 Unclassified 2224
23 Ga0070676_10282708 3300005328 Bacteria 1119
24 Ga0070683_100131840 3300005329 Bacteria 2365
25 Ga0070690_100255763 3300005330 Bacteria 1240
26 Ga0070690_101083358 3300005330 Bacteria 635
27 Ga0068869_100032243 3300005334 Bacteria 3691
28 Ga0070666_10034138 3300005335 Bacteria 3371
29 Ga0070666_10052732 3300005335 Bacteria 2742
30 Ga0070680_100243124 3300005336 Unclassified 1521
31 Ga0070682_100007922 3300005337 Bacteria 5978
32 Ga0070682_100328444 3300005337 Bacteria 1132
33 Ga0068868_100040330 3300005338 Bacteria 3634
34 Ga0068868_100049065 3300005338 Bacteria 3313
35 Ga0070689_100006549 3300005340 Bacteria 8073
36 Ga0070689_100203488 3300005340 Bacteria 1617
37 Ga0070691_10004967 3300005341 Bacteria 6053
38 Ga0070691_10167458 3300005341 Bacteria 1136
39 Ga0070661_100888178 3300005344 Bacteria 735
40 Ga0070692_10131532 3300005345 Bacteria 1407
41 Ga0070668_100020436 3300005347 Bacteria 4997
42 Ga0070668_100074913 3300005347 Bacteria 2641
43 Ga0070669_100037334 3300005353 Bacteria 3525
44 Ga0070669_100518475 3300005353 Bacteria 991
45 Ga0070675_100238037 3300005354 Bacteria 1590
46 Ga0070675_100305434 3300005354 Bacteria 1403
47 Ga0070671_100124824 3300005355 Unclassified 2167
48 Ga0070671_100829305 3300005355 Bacteria 806
49 Ga0070674_100045302 3300005356 Bacteria 3005
50 Ga0070674_100503323 3300005356 Bacteria 1009
51 Ga0070673_100075532 3300005364 Bacteria 2718
52 Ga0070673_100439370 3300005364 Unclassified 1172
53 Ga0070688_100029998 3300005365 Bacteria 3260
54 Ga0070688_100085110 3300005365 Bacteria 2055
55 Ga0070659_100048125 3300005366 Bacteria 3348
56 Ga0070659_100148576 3300005366 Bacteria 1910
57 Ga0070667_100057655 3300005367 Plasmid 3283
58 Ga0070667_100747167 3300005367 Bacteria 907
59 Ga0070703_10257203 3300005406 Bacteria 711
60 Ga0070709_10027415 3300005434 Bacteria 3386
61 Ga0070709_10056987 3300005434 Bacteria 2473
62 Ga0070709_10296054 3300005434 Bacteria 1180
63 Ga0070709_10337234 3300005434 Bacteria 1111
64 Ga0070709_10977116 3300005434 Bacteria 673
65 Ga0070714_100008067 3300005435 Bacteria 8210
66 Ga0070714_100074824 3300005435 Bacteria 2937
67 Ga0070714_100151709 3300005435 Bacteria 2089
68 Ga0070714_100387675 3300005435 Bacteria 1318
69 Ga0070714_100388230 3300005435 Bacteria 1317
70 Ga0070714_100851085 3300005435 Bacteria 884
71 Ga0070714_100949713 3300005435 Bacteria 836
72 Ga0070713_100000504 3300005436 Bacteria 24978
73 Ga0070713_100016513 3300005436 Bacteria 5551
74 Ga0070713_100269622 3300005436 Bacteria 1558
75 Ga0070713_100414882 3300005436 Bacteria 1259
76 Ga0070713_102277430 3300005436 Unclassified 524
77 Ga0070710_10000879 3300005437 Bacteria 14392
78 Ga0070710_10003411 3300005437 Bacteria 7528
79 Ga0070710_10016912 3300005437 Bacteria 3722
80 Ga0070710_10033500 3300005437 Bacteria 2790
81 Ga0070710_10060207 3300005437 Bacteria 2159
82 Ga0070710_10204625 3300005437 Bacteria 1248
83 Ga0070710_10725686 3300005437 Bacteria 703
84 Ga0070710_10995304 3300005437 Bacteria 610
85 Ga0070701_10000217 3300005438 Bacteria 18091
86 Ga0070701_10564605 3300005438 Bacteria 748
87 Ga0070711_100015938 3300005439 Bacteria 4763
88 Ga0070711_100021458 3300005439 Bacteria 4176
89 Ga0070711_100140988 3300005439 Bacteria 1807
90 Ga0070711_100198533 3300005439 Bacteria 1546
91 Ga0070711_100202868 3300005439 Bacteria 1531
92 Ga0070711_100497474 3300005439 Bacteria 1005
93 Ga0070711_101133813 3300005439 Bacteria 675
94 Ga0070711_101261801 3300005439 Bacteria 640
95 Ga0070705_100011498 3300005440 Bacteria 4467
96 Ga0070705_100290616 3300005440 Bacteria 1167
97 Ga0070705_101255555 3300005440 Unclassified 612
98 Ga0070700_100001736 3300005441 Bacteria 10956
99 Ga0070700_100312332 3300005441 Bacteria 1152
100 Ga0070694_100014765 3300005444 Bacteria 4894
101 Ga0070694_100175230 3300005444 Bacteria 1583
102 Ga0070694_100314686 3300005444 Bacteria 1203
103 Ga0070708_100021259 3300005445 Bacteria 5484
104 Ga0070708_100238138 3300005445 Bacteria 1709
105 Ga0070708_100243383 3300005445 Bacteria 1689
106 Ga0070708_100398098 3300005445 Bacteria 1298
107 Ga0070663_100040555 3300005455 Bacteria 3260
108 Ga0070663_100133672 3300005455 Bacteria 1887
109 Ga0070663_100518879 3300005455 Bacteria 992
110 Ga0070678_100039173 3300005456 Bacteria 3341
111 Ga0070678_100300165 3300005456 Bacteria 1364
112 Ga0070662_100031240 3300005457 Bacteria 3736
113 Ga0070662_100940226 3300005457 Bacteria 739
114 Ga0070681_11270601 3300005458 Bacteria 659
115 Ga0068867_100402627 3300005459 Bacteria 1155
116 Ga0070685_10117597 3300005466 Bacteria 1647
117 Ga0070685_10248205 3300005466 Bacteria 1178
118 Ga0070706_100021285 3300005467 Bacteria 5973
119 Ga0070707_100155161 3300005468 Bacteria 2230
120 Ga0070707_100668411 3300005468 Bacteria 1001
121 Ga0070698_100011759 3300005471 Bacteria 9286
122 Ga0070698_100049742 3300005471 Bacteria 4277
123 Ga0070698_100094393 3300005471 Bacteria 2971
124 Ga0070699_100005208 3300005518 Bacteria 11429
125 Ga0070699_100033518 3300005518 Bacteria 4437
126 Ga0070679_100562535 3300005530 Bacteria 1084
127 Ga0070697_100007959 3300005536 Bacteria 8261
128 Ga0070697_101014569 3300005536 Bacteria 738
129 Ga0068853_100077671 3300005539 Bacteria 2901
130 Ga0070672_100211425 3300005543 Bacteria 1624
131 Ga0070686_100023481 3300005544 Bacteria 3685
132 Ga0070695_100014832 3300005545 Bacteria 4701
133 Ga0070695_100150542 3300005545 Bacteria 1623
134 Ga0070696_100156751 3300005546 Bacteria 1675
135 Ga0070693_100109051 3300005547 Bacteria 1700
136 Ga0070665_100042013 3300005548 Bacteria 4595
137 Ga0070665_100287482 3300005548 Bacteria 1646
138 Ga0070665_100395292 3300005548 Bacteria 1390
139 Ga0070665_100731828 3300005548 Bacteria 1002
140 Ga0070704_100026995 3300005549 Bacteria 3801
141 Ga0070704_100446706 3300005549 Bacteria 1112
142 Ga0070704_100840072 3300005549 Bacteria 823
143 Ga0068855_100431636 3300005563 Bacteria 1440
144 Ga0070664_100414625 3300005564 Bacteria 1233
145 Ga0068854_100029339 3300005578 Bacteria 3808
146 Ga0068856_100010788 3300005614 Bacteria 8873
147 Ga0068856_100073806 3300005614 Bacteria 3378
148 Ga0070702_100001436 3300005615 Bacteria 9744
149 Ga0070702_100067088 3300005615 Bacteria 2106
150 Ga0068852_100079356 3300005616 Bacteria 2907
151 Ga0068852_102656605 3300005616 Bacteria 520
152 Ga0068859_100099023 3300005617 Bacteria 2970
153 Ga0068859_100303347 3300005617 Bacteria 1690
154 Ga0068864_100074235 3300005618 Bacteria 2967
155 Ga0068864_100316783 3300005618 Bacteria 1464
156 Ga0068864_101236471 3300005618 Bacteria 746
157 Ga0068866_10051292 3300005718 Bacteria 2099
158 Ga0068866_11194355 3300005718 Bacteria 549
159 Ga0068861_100054707 3300005719 Plasmid 3041
160 Ga0068861_100386885 3300005719 Bacteria 1237
161 Ga0068861_102211140 3300005719 Bacteria 551
162 Ga0068870_10163606 3300005840 Bacteria 1322
163 Ga0068863_100121326 3300005841 Bacteria 2493
164 Ga0068863_100214132 3300005841 Bacteria 1855
165 Ga0068858_100079034 3300005842 Bacteria 3056
166 Ga0068858_100079553 3300005842 Bacteria 3046
167 Ga0068858_100581308 3300005842 Bacteria 1085
168 Ga0068858_100581640 3300005842 Bacteria 1085
169 Ga0068860_100208705 3300005843 Bacteria 1894
170 Ga0068862_100056462 3300005844 Bacteria 3364
171 Ga0081455_10025298 3300005937 Bacteria 5483
172 Ga0081538_10008343 3300005981 Bacteria 8818
173 Ga0081538_10145484 3300005981 Bacteria 1084
174 Ga0081540_1104354 3300005983 Bacteria 1213
175 Ga0081540_1161970 3300005983 Unclassified 866
176 Ga0070717_10000913 3300006028 Bacteria 19627
177 Ga0070717_10132511 3300006028 Bacteria 2144
178 Ga0070717_10143565 3300006028 Bacteria 2060
179 Ga0070717_10179176 3300006028 Bacteria 1846
180 Ga0070717_10460846 3300006028 Bacteria 1146
181 Ga0070717_10723733 3300006028 Bacteria 904
182 Ga0070717_11061053 3300006028 Bacteria 738
183 Ga0070717_11950628 3300006028 Bacteria 529
184 Ga0070715_10003867 3300006163 Bacteria 4839
185 Ga0070715_10008431 3300006163 Bacteria 3592
186 Ga0070715_10019989 3300006163 Bacteria 2576
187 Ga0070715_10027630 3300006163 Bacteria 2268
188 Ga0070716_100000544 3300006173 Bacteria 15787
189 Ga0070716_100039196 3300006173 Plasmid 2628
190 Ga0070716_100059928 3300006173 Bacteria 2196
191 Ga0070716_100336954 3300006173 Bacteria 1063
192 Ga0070716_100350521 3300006173 Bacteria 1045
193 Ga0070716_101286820 3300006173 Bacteria 590
194 Ga0070712_100002065 3300006175 Bacteria 12314
195 Ga0070712_100035177 3300006175 Bacteria 3399
196 Ga0070712_100152747 3300006175 Bacteria 1774
197 Ga0070712_100172939 3300006175 Bacteria 1677
198 Ga0070712_100557443 3300006175 Bacteria 966
199 Ga0070712_101102816 3300006175 Bacteria 689
200 Ga0070712_101772899 3300006175 Bacteria 540
201 Ga0075427_10098474 3300006194 Bacteria 542
202 Ga0097621_100024550 3300006237 Bacteria 4708
203 Ga0097621_100119197 3300006237 Bacteria 2237
204 Ga0068871_100015360 3300006358 Bacteria 5727
205 Ga0068871_100102452 3300006358 Unclassified 2400
206 Ga0068871_100617930 3300006358 Bacteria 987
207 Ga0068871_100990781 3300006358 Bacteria 782
208 Ga0075428_100994697 3300006844 Bacteria 888
209 Ga0075434_101023872 3300006871 Bacteria 839
210 Ga0068865_100027445 3300006881 Bacteria 3762
211 Ga0097620_100099035 3300006931 Bacteria 2970
212 Ga0097620_100303369 3300006931 Bacteria 1690
213 Ga0075435_100948548 3300007076 Bacteria 751
214 Ga0099794_10071674 3300007265 Bacteria 1698
215 Ga0099794_10164817 3300007265 Bacteria 1128
216 Ga0105251_10314866 3300009011 Bacteria 711
217 Ga0105250_10017659 3300009092 Bacteria 2899
218 Ga0105245_10056921 3300009098 Bacteria 3515
219 Ga0105245_10064163 3300009098 Bacteria 3319
220 Ga0105245_10091866 3300009098 Bacteria 2794
221 Ga0105245_10350202 3300009098 Bacteria 1463
222 Ga0105245_11857653 3300009098 Bacteria 655
223 Ga0105247_10022888 3300009101 Bacteria 3763
224 Ga0105247_10101049 3300009101 Bacteria 1843
225 Ga0105243_10048229 3300009148 Bacteria 3357
226 Ga0105243_10510126 3300009148 Bacteria 1141
227 Ga0105243_10672467 3300009148 Bacteria 1006
228 Ga0105243_12475708 3300009148 Bacteria 558
229 Ga0105241_10023302 3300009174 Bacteria 4590
230 Ga0105241_11062750 3300009174 Bacteria 760
231 Ga0105242_10007068 3300009176 Bacteria 8670
232 Ga0105242_10081505 3300009176 Bacteria 2706
233 Ga0105242_10214262 3300009176 Bacteria 1718
234 Ga0105242_12585239 3300009176 Bacteria 557
235 Ga0105248_10076443 3300009177 Bacteria 3763
236 Ga0105248_10083213 3300009177 Bacteria 3600
237 Ga0105248_10445788 3300009177 Bacteria 1458
238 Ga0105237_10000716 3300009545 Bacteria 45907
239 Ga0105237_10079853 3300009545 Bacteria 3261
240 Ga0105237_10090099 3300009545 Plasmid 3057
241 Ga0105237_10094197 3300009545 Bacteria 2984
242 Ga0105238_10461249 3300009551 Bacteria 1268
243 Ga0105238_10889605 3300009551 Bacteria 909
244 Ga0105238_11058615 3300009551 Bacteria 833
245 Ga0105249_10009001 3300009553 Bacteria 8723
246 Ga0105249_11311017 3300009553 Bacteria 796
247 Ga0099796_10060032 3300010159 Bacteria 1345
248 Ga0105239_10000720 3300010375 Bacteria 46948
249 Ga0105239_10007791 3300010375 Bacteria 12254
250 Ga0105239_10093577 3300010375 Bacteria 3318
251 Ga0105239_10732821 3300010375 Bacteria 1131
252 Ga0105239_11455569 3300010375 Unclassified 791
253 Ga0105246_10135845 3300011119 Bacteria 1843
254 Ga0105246_10533018 3300011119 Bacteria 1003
255 Ga0105246_10871369 3300011119 Bacteria 805
256 Ga0105246_11238223 3300011119 Bacteria 689
257 Ga0157370_10165669 3300013104 Bacteria 2055
258 Ga0157369_10177166 3300013105 Bacteria 2244
259 Ga0157369_11303088 3300013105 Bacteria 740
260 Ga0157369_11513351 3300013105 Bacteria 683
261 Ga0157374_10029958 3300013296 Bacteria 4937
262 Ga0157374_10075054 3300013296 Bacteria 3195
263 Ga0157374_11618934 3300013296 Bacteria 672
264 Ga0157378_10043966 3300013297 Bacteria 3965
265 Ga0157378_10222760 3300013297 Bacteria 1794
266 Ga0163162_10025467 3300013306 Bacteria 5845
267 Ga0163162_10031769 3300013306 Bacteria 5239
268 Ga0163162_10245107 3300013306 Bacteria 1924
269 Ga0163162_10424054 3300013306 Bacteria 1462
270 Ga0163162_11288674 3300013306 Bacteria 830
271 Ga0157372_10035512 3300013307 Bacteria 5488
272 Ga0157372_10095945 3300013307 Bacteria 3379
273 Ga0157372_10104234 3300013307 Plasmid 3242
274 Ga0157375_10006872 3300013308 Bacteria 9924
275 Ga0157375_10037547 3300013308 Bacteria 4643
276 Ga0157375_10113375 3300013308 Bacteria 2812
277 Ga0157375_10309743 3300013308 Bacteria 1743
278 Ga0157375_10590137 3300013308 Bacteria 1271
279 Ga0157375_11177750 3300013308 Bacteria 899
280 Ga0163163_10101492 3300014325 Bacteria 2899
281 Ga0163163_10180668 3300014325 Bacteria 2157
282 Ga0163163_10335669 3300014325 Bacteria 1566
283 Ga0157380_10180201 3300014326 Bacteria 1855
284 Ga0157377_10129084 3300014745 Bacteria 1542
285 Ga0157379_10004168 3300014968 Bacteria 12343
286 Ga0157379_10075576 3300014968 Bacteria 3016
287 Ga0157376_10038219 3300014969 Bacteria 3904
288 Ga0157376_10835993 3300014969 Bacteria 935
289 Ga0157376_11112812 3300014969 Bacteria 816
290 Ga0163161_10041188 3300017792 Bacteria 3319
291 Ga0213876_10004318 3300021384 Bacteria 7966
292 Ga0224572_1003769 3300024225 Bacteria 2587
293 Ga0228598_1037424 3300024227 Bacteria 957
294 Ga0207696_1129528 3300025711 Bacteria 678
295 Ga0207692_10000112 3300025898 Bacteria 24171
296 Ga0207692_10002307 3300025898 Bacteria 7324
297 Ga0207692_10024882 3300025898 Bacteria 2790
298 Ga0207692_10053705 3300025898 Bacteria 2053
299 Ga0207692_10148374 3300025898 Bacteria 1341
300 Ga0207692_10311822 3300025898 Bacteria 960
301 Ga0207692_10827744 3300025898 Bacteria 606
302 Ga0207642_10029582 3300025899 Bacteria 2270
303 Ga0207642_10273904 3300025899 Bacteria 968
304 Ga0207710_10016956 3300025900 Bacteria 3085
305 Ga0207710_10018562 3300025900 Bacteria 2960
306 Ga0207688_10002636 3300025901 Bacteria 9707
307 Ga0207688_10276145 3300025901 Bacteria 1023
308 Ga0207680_10035220 3300025903 Plasmid 2872
309 Ga0207680_10117929 3300025903 Bacteria 1732
310 Ga0207647_10075392 3300025904 Bacteria 2030
311 Ga0207685_10001987 3300025905 Bacteria 4541
312 Ga0207685_10002509 3300025905 Bacteria 4226
313 Ga0207685_10017487 3300025905 Bacteria 2320
314 Ga0207685_10633639 3300025905 Bacteria 577
315 Ga0207699_10000296 3300025906 Bacteria 26722
316 Ga0207699_10018942 3300025906 Bacteria 3658
317 Ga0207699_10023169 3300025906 Bacteria 3376
318 Ga0207699_10548488 3300025906 Bacteria 838
319 Ga0207645_10009553 3300025907 Bacteria 6703
320 Ga0207645_10185319 3300025907 Bacteria 1366
321 Ga0207643_10179938 3300025908 Bacteria 1279
322 Ga0207684_10001750 3300025910 Bacteria 22937
323 Ga0207684_10164008 3300025910 Bacteria 1914
324 Ga0207684_10307337 3300025910 Bacteria 1367
325 Ga0207654_10012763 3300025911 Bacteria 4310
326 Ga0207695_11577632 3300025913 Unclassified 537
327 Ga0207671_10014877 3300025914 Bacteria 6121
328 Ga0207671_10192713 3300025914 Unclassified 1590
329 Ga0207671_10206150 3300025914 Bacteria 1537
330 Ga0207671_10221808 3300025914 Bacteria 1481
331 Ga0207693_10000718 3300025915 Bacteria 29815
332 Ga0207693_10001067 3300025915 Bacteria 24551
333 Ga0207693_10059850 3300025915 Bacteria 2984
334 Ga0207693_10133539 3300025915 Bacteria 1951
335 Ga0207693_10139969 3300025915 Bacteria 1903
336 Ga0207693_10167796 3300025915 Bacteria 1728
337 Ga0207693_10508832 3300025915 Bacteria 940
338 Ga0207693_11146765 3300025915 Bacteria 588
339 Ga0207663_10003753 3300025916 Bacteria 7489
340 Ga0207663_10012851 3300025916 Bacteria 4537
341 Ga0207663_10216829 3300025916 Bacteria 1390
342 Ga0207660_10069818 3300025917 Bacteria 2552
343 Ga0207657_10302183 3300025919 Bacteria 1267
344 Ga0207657_10308541 3300025919 Bacteria 1253
345 Ga0207652_10108783 3300025921 Unclassified 2457
346 Ga0207646_10000731 3300025922 Bacteria 42637
347 Ga0207646_10069080 3300025922 Bacteria 3155
348 Ga0207646_10101724 3300025922 Bacteria 2576
349 Ga0207681_10092386 3300025923 Bacteria 2163
350 Ga0207694_10189382 3300025924 Bacteria 1671
351 Ga0207659_10081271 3300025926 Bacteria 2396
352 Ga0207659_10192694 3300025926 Bacteria 1623
353 Ga0207687_10014963 3300025927 Bacteria 5081
354 Ga0207687_10016150 3300025927 Bacteria 4901
355 Ga0207687_10122373 3300025927 Bacteria 1948
356 Ga0207700_10000421 3300025928 Bacteria 24943
357 Ga0207700_10014276 3300025928 Bacteria 5198
358 Ga0207700_10022106 3300025928 Bacteria 4357
359 Ga0207700_10771891 3300025928 Bacteria 859
360 Ga0207664_10000343 3300025929 Bacteria 34318
361 Ga0207664_10018680 3300025929 Bacteria 5109
362 Ga0207664_10142608 3300025929 Bacteria 2028
363 Ga0207664_10195264 3300025929 Bacteria 1744
364 Ga0207664_10323011 3300025929 Bacteria 1362
365 Ga0207664_10728140 3300025929 Bacteria 892
366 Ga0207664_11155235 3300025929 Bacteria 691
367 Ga0207664_11257325 3300025929 Bacteria 659
368 Ga0207690_10054788 3300025932 Plasmid 2683
369 Ga0207706_10008610 3300025933 Bacteria 9401
370 Ga0207706_10136804 3300025933 Bacteria 2155
371 Ga0207686_10024703 3300025934 Bacteria 3485
372 Ga0207709_10010591 3300025935 Bacteria 5080
373 Ga0207709_10532400 3300025935 Bacteria 921
374 Ga0207709_11383437 3300025935 Bacteria 583
375 Ga0207670_10010994 3300025936 Bacteria 5233
376 Ga0207669_10001358 3300025937 Bacteria 10418
377 Ga0207669_10226015 3300025937 Bacteria 1377
378 Ga0207704_10014099 3300025938 Bacteria 4026
379 Ga0207665_10000172 3300025939 Bacteria 43653
380 Ga0207665_10004070 3300025939 Bacteria 9766
381 Ga0207665_10125186 3300025939 Bacteria 1819
382 Ga0207691_10160086 3300025940 Bacteria 1975
383 Ga0207689_10072769 3300025942 Bacteria 2823
384 Ga0207661_10184080 3300025944 Bacteria 1827
385 Ga0207667_10335890 3300025949 Bacteria 1542
386 Ga0207651_10323775 3300025960 Bacteria 1289
387 Ga0207651_10385816 3300025960 Unclassified 1188
388 Ga0207712_10091522 3300025961 Unclassified 2241
389 Ga0207712_10886987 3300025961 Bacteria 788
390 Ga0207668_10264336 3300025972 Unclassified 1403
391 Ga0207668_11134826 3300025972 Unclassified 701
392 Ga0207640_10004988 3300025981 Bacteria 7214
393 Ga0207658_10032551 3300025986 Bacteria 3711
394 Ga0207677_10004119 3300026023 Bacteria 7775
395 Ga0207677_10015069 3300026023 Bacteria 4535
396 Ga0207677_10557716 3300026023 Bacteria 999
397 Ga0207677_11038858 3300026023 Bacteria 745
398 Ga0207703_10046362 3300026035 Bacteria 3500
399 Ga0207703_10333403 3300026035 Bacteria 1392
400 Ga0207639_10798503 3300026041 Bacteria 879
401 Ga0207678_10057258 3300026067 Bacteria 3354
402 Ga0207678_10219514 3300026067 Bacteria 1627
403 Ga0207678_10279005 3300026067 Bacteria 1434
404 Ga0207708_10006455 3300026075 Bacteria 8691
405 Ga0207702_10051668 3300026078 Bacteria 3475
406 Ga0207702_10583713 3300026078 Bacteria 1096
407 Ga0207641_12390046 3300026088 Bacteria 527
408 Ga0207648_10003339 3300026089 Bacteria 16863
409 Ga0207648_10754193 3300026089 Bacteria 904
410 Ga0207676_10231245 3300026095 Unclassified 1653
411 Ga0207676_11218395 3300026095 Bacteria 746
412 Ga0207674_10199845 3300026116 Bacteria 1948
413 Ga0207674_11472548 3300026116 Bacteria 650
414 Ga0207675_100068777 3300026118 Bacteria 3309
415 Ga0207675_101678157 3300026118 Bacteria 655
416 Ga0207683_10047989 3300026121 Bacteria 3739
417 Ga0207683_10488038 3300026121 Bacteria 1137
418 Ga0207698_10041091 3300026142 Bacteria 3442
419 Ga0207698_10867790 3300026142 Bacteria 908
420 Ga0207698_11422846 3300026142 Bacteria 708
421 Ga0207698_12146074 3300026142 Bacteria 572
422 Ga0209588_1223609 3300027671 Bacteria 581
423 Ga0268266_10047632 3300028379 Bacteria 3674
424 Ga0268266_10175027 3300028379 Bacteria 1950
425 Ga0268266_10221242 3300028379 Bacteria 1740
426 Ga0268266_10592794 3300028379 Bacteria 1064
427 Ga0268266_10782017 3300028379 Bacteria 922
428 Ga0268265_10092251 3300028380 Unclassified 2423
429 Ga0268264_10021670 3300028381 Bacteria 5246
430 Ga0265760_10087692 3300031090 Bacteria 971
431 Ga0307513_10111565 3300031456 Bacteria 2727
432 Ga0307513_10161493 3300031456 Bacteria 2133
433 Ga0307408_102464423 3300031548 Bacteria 506
434 Ga0307415_100117297 3300032126 Bacteria 1988
435 Ga0373948_0064114 3300034817 Bacteria 812
436 Ga0373958_0057467 3300034819 Bacteria 835
437 Ga0373926_0000983 3300035083 Bacteria 8292
438 Ga0373926_0234302 3300035083 Bacteria 710
439 Ga0373934_0005251 3300035086 Bacteria 4788
440 Ga0373934_0198895 3300035086 Bacteria 825
441 Ga0373944_0263110 3300035089 Bacteria 639
442 Ga0373951_0003035 3300035091 Bacteria 4156
443 Ga0373951_0075487 3300035091 Bacteria 865
444 Ga0373923_0001230 3300035111 Bacteria 7181
445 Ga0373923_0129026 3300035111 Bacteria 1135
446 Ga0373932_0062386 3300035112 Bacteria 1136
447 Ga0373936_0001230 3300035113 Bacteria 9231
448 Ga0373945_0004836 3300035116 Bacteria 4290
449 Ga0373953_0003188 3300035117 Bacteria 5076
450 Ga0373953_0068693 3300035117 Bacteria 1459
451 Ga0373954_0023093 3300035118 Bacteria 2825
452 Ga0373956_0005373 3300035119 Bacteria 5128
453 Ga0373956_0245411 3300035119 Bacteria 851
454 Ga0373957_0000641 3300035120 Bacteria 8973
455 Ga0373957_0171029 3300035120 Bacteria 898
456 Ga0373943_0009642 3300035170 Bacteria 4326
457 Ga0373943_0574648 3300035170 Bacteria 662
458 Ga0373946_0003521 3300035171 Bacteria 5559
459 Ga0373946_0312031 3300035171 Bacteria 780
460 Ga0373955_0005027 3300035172 Bacteria 5911
461 Ga0373955_0229246 3300035172 Bacteria 1111
462 Ga0373955_0347607 3300035172 Bacteria 898
463 Ga0373942_0248285 3300035207 Bacteria 604
464 Ga0373924_0001992 3300035410 Bacteria 6794
465 Ga0373931_0026884 3300035691 Bacteria 2933
466 Ga0373931_0262991 3300035691 Bacteria 1053
467 Ga0373935_0006915 3300035692 Bacteria 6771
468 Ga0373927_0062972 3300035695 Bacteria 2398
469 Ga0373933_0043149 3300035724 Bacteria 2667
470 Ga0373933_0053734 3300035724 Bacteria 2412
471 Ga0373933_0163065 3300035724 Bacteria 1416
472 Ga0373947_0005683 3300035725 Bacteria 7275
473 Ga0373947_0975989 3300035725 Bacteria 578
474 Ga0373937_0015246 3300036401 Bacteria 6795
475 Ga0373937_0022056 3300036401 Bacteria 5720
476 Ga0373937_0076263 3300036401 Bacteria 3096
477 Ga0372808_018593 3300036459 Bacteria 998
478 Ga0373925_0013178 3300037068 Bacteria 5984
479 Ga0373925_0472200 3300037068 Bacteria 1028
480 Ga0373925_1145652 3300037068 Bacteria 639
481 Ga0436364_0771334 3300037853 Bacteria 607
482 Ga0395901_1871505 3300038443 Bacteria 548
483 Ga0436365_1155520 3300039437 Bacteria 4727
484 Ga0436363_1132145 3300039450 Bacteria 1279
485 Ga0466967_1936562 3300045976 Bacteria 586
486 Ga0495592_0063498 3300046454 Bacteria 2708
487 Ga0495592_0318633 3300046454 Bacteria 1005
488 Ga0495603_0003484 3300046455 Bacteria 9357
489 Ga0495629_0002385 3300046459 Bacteria 14462
490 Ga0495629_0682343 3300046459 Bacteria 683
491 Ga0495638_0002268 3300046460 Bacteria 15912
492 Ga0495638_0004981 3300046460 Bacteria 9964
493 Ga0495641_0005642 3300046461 Bacteria 8352
494 Ga0495641_0147039 3300046461 Bacteria 1053
495 Ga0495651_0010315 3300046462 Bacteria 7179
496 Ga0495651_0010792 3300046462 Bacteria 7022
497 Ga0495651_0299737 3300046462 Bacteria 1078
498 Ga0495653_0046340 3300046463 Bacteria 3367
499 Ga0495653_0050634 3300046463 Bacteria 3193
500 Ga0495653_0098838 3300046463 Bacteria 2118
501 Ga0495653_0222321 3300046463 Unclassified 1269
502 Ga0495580_0028930 3300046472 Bacteria 4025
503 Ga0495582_0002898 3300046473 Bacteria 9590
504 Ga0495639_0058084 3300046475 Bacteria 1768
505 Ga0495664_0006276 3300046477 Bacteria 6563
506 Ga0495664_0561127 3300046477 Bacteria 680
507 Ga0495584_0477616 3300046491 Bacteria 635
508 Ga0495594_0026153 3300046499 Bacteria 3138
509 Ga0495606_0149012 3300046507 Bacteria 1375
510 Ga0495608_0002320 3300046511 Bacteria 13733
511 Ga0495608_0024314 3300046511 Bacteria 4144
512 Ga0495608_0025622 3300046511 Bacteria 4026
513 Ga0495618_0023920 3300046514 Bacteria 3782
514 Ga0495628_0014161 3300046516 Bacteria 6692
515 Ga0495628_0217605 3300046516 Bacteria 1435
516 Ga0495628_0403867 3300046516 Bacteria 997
517 Ga0495630_0001308 3300046517 Bacteria 17127
518 Ga0495630_0001615 3300046517 Bacteria 15689
519 Ga0495630_0624607 3300046517 Bacteria 825
520 Ga0495630_0704808 3300046517 Bacteria 772
521 Ga0495631_0155034 3300046518 Bacteria 983
522 Ga0495644_0463541 3300046523 Bacteria 505
523 Ga0495666_0006361 3300046526 Bacteria 5946
524 Ga0495652_0050141 3300046529 Bacteria 3570
525 Ga0495652_0095702 3300046529 Bacteria 2419
526 Ga0495652_0257311 3300046529 Bacteria 1290
527 Ga0495652_0459035 3300046529 Bacteria 890
528 Ga0495652_0807580 3300046529 Bacteria 624
529 Ga0495665_0002106 3300046531 Bacteria 10775
530 Ga0495640_0023987 3300046533 Bacteria 4437
531 Ga0495640_0111573 3300046533 Bacteria 1787
532 Ga0495640_0187251 3300046533 Bacteria 1317
533 Ga0495640_0293622 3300046533 Bacteria 1010
534 Ga0495586_0024146 3300046535 Bacteria 3247
535 Ga0495587_0004692 3300046536 Bacteria 8972
536 Ga0495587_0069578 3300046536 Bacteria 2049
537 Ga0495587_0087887 3300046536 Bacteria 1798
538 Ga0495609_0407137 3300046538 Bacteria 544
539 Ga0495645_0014164 3300046543 Bacteria 5652
540 Ga0495645_0034021 3300046543 Bacteria 3718
541 Ga0495645_0348587 3300046543 Bacteria 954
542 Ga0495667_0000254 3300046559 Bacteria 34663
543 Ga0495667_0001165 3300046559 Bacteria 17157
544 Ga0495667_0030035 3300046559 Bacteria 3654
545 Ga0495656_0212404 3300046615 Bacteria 965
546 Ga0495634_0019286 3300046642 Bacteria 4846
547 Ga0495634_0321509 3300046642 Bacteria 931
548 Ga0495635_0003320 3300046663 Bacteria 11125
549 Ga0495635_0011288 3300046663 Bacteria 6265
550 Ga0495635_0351914 3300046663 Bacteria 982
551 Ga0495588_0046962 3300046674 Bacteria 2216
552 Ga0495657_0004610 3300046675 Bacteria 11007
553 Ga0495657_0026009 3300046675 Bacteria 4150
554 Ga0495599_0000852 3300046678 Bacteria 17100
555 Ga0495599_0008197 3300046678 Bacteria 6348
556 Ga0495599_0153634 3300046678 Bacteria 1424
557 Ga0495623_0073181 3300046679 Bacteria 2130
558 Ga0495623_0140656 3300046679 Bacteria 1436
559 Ga0495623_0482456 3300046679 Bacteria 656
560 Ga0495646_0034177 3300046680 Bacteria 3158
561 Ga0495646_0051869 3300046680 Bacteria 2481
562 Ga0495647_0060739 3300046681 Bacteria 1491
563 Ga0495658_0160286 3300046683 Bacteria 1387
564 Ga0495658_0170797 3300046683 Bacteria 1345
565 Ga0495613_0003122 3300046689 Bacteria 12404
566 Ga0495613_0450456 3300046689 Bacteria 872
567 Ga0495624_0009879 3300046690 Bacteria 6600
568 Ga0495624_0221794 3300046690 Bacteria 1146
569 Ga0495600_0010016 3300046809 Bacteria 5875
570 Ga0495600_0054846 3300046809 Bacteria 2603
571 Ga0495600_0086269 3300046809 Bacteria 2048
572 Ga0495581_0013324 3300047315 Bacteria 4766
573 Ga0495604_0113014 3300047317 Bacteria 1977
574 Ga0495604_0243209 3300047317 Bacteria 1229
575 Ga0495604_0395040 3300047317 Bacteria 911
576 Ga0495674_0016752 3300047319 Bacteria 6837
577 Ga0495674_0101188 3300047319 Bacteria 2451
578 Ga0495674_1147623 3300047319 Bacteria 589
579 Ga0495672_0283329 3300047320 Bacteria 791
580 Ga0495676_0007867 3300047321 Bacteria 9777
581 Ga0495676_0499888 3300047321 Bacteria 798
582 Ga0495676_0550922 3300047321 Bacteria 754
583 Ga0495680_0023042 3300047322 Bacteria 5182
584 Ga0495680_0058566 3300047322 Bacteria 2976
585 Ga0495680_0390411 3300047322 Bacteria 962
586 Ga0495675_0016204 3300047444 Bacteria 4714
587 Ga0495675_0035726 3300047444 Bacteria 3173
588 Ga0495677_0318392 3300047445 Bacteria 613
589 Ga0495684_0001429 3300047471 Bacteria 19141
590 Ga0495684_0010764 3300047471 Bacteria 7068
591 Ga0495684_0041542 3300047471 Bacteria 3524
592 Ga0495686_0018196 3300047472 Bacteria 4720
593 Ga0495593_0005072 3300047673 Bacteria 7784
594 Ga0495602_0008969 3300048088 Bacteria 10423
595 Ga0495602_0021839 3300048088 Bacteria 6283
596 Ga0495602_0393083 3300048088 Bacteria 990
597 Ga0495614_0019904 3300048089 Bacteria 2903
598 Ga0496100_0293370 3300048903 Bacteria 1215
599 Ga0496100_0568689 3300048903 Bacteria 878
600 Ga0496100_1280789 3300048903 Bacteria 578
601 Ga0496101_0010132 3300048904 Bacteria 6215
602 Ga0496101_0205013 3300048904 Bacteria 1526
603 Ga0496102_0003334 3300048905 Bacteria 13621
604 Ga0496102_0119983 3300048905 Bacteria 2455
605 Ga0496102_0778482 3300048905 Bacteria 879
606 Ga0496102_1163448 3300048905 Unclassified 691
607 Ga0496103_0001931 3300048906 Bacteria 13432
608 Ga0496103_0205815 3300048906 Bacteria 1265
609 Ga0496104_0002929 3300048907 Bacteria 14701
610 Ga0496104_0054798 3300048907 Bacteria 3769
611 Ga0496104_1264724 3300048907 Bacteria 641
612 Ga0496105_0017219 3300048908 Bacteria 5789
613 Ga0496105_0019244 3300048908 Bacteria 5506
614 Ga0496105_0201129 3300048908 Bacteria 1626
615 Ga0496106_0002776 3300048909 Bacteria 12973
616 Ga0496106_0388049 3300048909 Bacteria 1122
617 Ga0496106_1340335 3300048909 Bacteria 554
618 Ga0496107_0024101 3300048910 Bacteria 4303
619 Ga0496108_0001367 3300048911 Bacteria 19174
620 Ga0496108_0001442 3300048911 Bacteria 18781
621 Ga0496108_0031106 3300048911 Bacteria 4426
622 Ga0496108_0862152 3300048911 Bacteria 779
623 Ga0496109_0041637 3300048912 Bacteria 4160
624 Ga0496109_0062633 3300048912 Bacteria 3402
625 Ga0496109_1006973 3300048912 Bacteria 771
626 Ga0496110_0012258 3300048913 Bacteria 7045
627 Ga0496110_0143598 3300048913 Bacteria 2158
628 Ga0496110_1002557 3300048913 Bacteria 742
629 Ga0496111_0047009 3300048914 Bacteria 3108
630 Ga0496111_0307178 3300048914 Bacteria 1175
631 Ga0496112_0018159 3300048915 Bacteria 6619
632 Ga0496112_0046162 3300048915 Bacteria 4272
633 Ga0496112_0357331 3300048915 Bacteria 1403
634 Ga0496113_0043084 3300048916 Bacteria 3338
635 Ga0496113_0079680 3300048916 Bacteria 2508
636 Ga0496114_0025268 3300048917 Bacteria 4854
637 Ga0496114_0223018 3300048917 Bacteria 1655
638 Ga0496115_0064040 3300048918 Bacteria 2967
639 Ga0496115_0411810 3300048918 Bacteria 1096
640 Ga0496115_0841568 3300048918 Bacteria 711
641 Ga0496126_0056619 3300048929 Bacteria 3543
642 Ga0496126_0117165 3300048929 Bacteria 2314
643 Ga0496126_0169208 3300048929 Bacteria 1863
644 Ga0501042_0181478 3300049578 Bacteria 1518
645 Ga0501045_0374088 3300049824 Bacteria 1060
646 nmdc:mga06r32_1340756_c1 3300050510 Bacteria 658
647 nmdc:mga08y16_943420_c1 3300050511 Archaea 846
648 nmdc:mga0n895_745095_c1 3300050512 Bacteria 973
649 Ga0495601_0007081 3300053077 Bacteria 6570
650 Ga0495601_0017015 3300053077 Bacteria 4411
651 Ga0495601_0405011 3300053077 Bacteria 884
652 Ga0495612_0002551 3300053078 Bacteria 7512
653 Ga0495612_0207675 3300053078 Bacteria 865
654 Ga0495595_0040052 3300053084 Bacteria 2140
655 Ga0495595_0128599 3300053084 Bacteria 1237
656 Ga0495619_0041927 3300053085 Bacteria 2995
657 Ga0495619_0046213 3300053085 Bacteria 2862
658 Ga0495619_0217458 3300053085 Bacteria 1323
659 Ga0500643_004979 3300053087 Bacteria 5838
660 Ga0500650_0171202 3300053098 Bacteria 998
661 Ga0500556_0003563 3300053104 Bacteria 4548
662 Ga0500616_0000081 3300053153 Bacteria 199653
663 Ga0500616_0013652 3300053153 Bacteria 4706
664 Ga0500616_0060058 3300053153 Bacteria 1972
665 Ga0500645_079287 3300053730 Bacteria 938
666 2558910642 2558860112 Bacteria 9931328
667 2870787441 2870782633 Bacteria 9624083
668 2939588718 2939582691 Bacteria 7088898
669 Ga0207694_11059134
670 LJNas_1013637
671 JGI24747J21853_1009624
672 JGI24747J21853_1022322
673 JGI24739J22299_10198312
674 JGI24737J22298_10049398
675 JGI24743J22301_10035502
676 JGI24743J22301_10145016
677 JGI24735J21928_10071363
678 JGI24750J21931_1018257
679 JGI24750J21931_1049848
680 JGI24745J21846_1020092
681 JGI24748J21848_1033813
682 JGI24738J21930_10073874
683 JGI24738J21930_10119568
684 JGI24744J21845_10001964
685 JGI24744J21845_10004780
686 JGI24034J26672_10001183
687 JGI24034J26672_10031776
688 JGI24742J22300_10014268
689 JGI24742J22300_10029005
690 Ga0070676_10061991
691 Ga0070676_10282708
692 Ga0070683_100131840
693 Ga0070690_100255763
694 Ga0070690_101083358
695 Ga0068869_100032243
696 Ga0070666_10034138
697 Ga0070666_10052732
698 Ga0070680_100243124
699 Ga0070682_100007922
700 Ga0070682_100328444
701 Ga0068868_100040330
702 Ga0068868_100049065
703 Ga0070689_100006549
704 Ga0070689_100203488
705 Ga0070691_10004967
706 Ga0070691_10167458
707 Ga0070661_100888178
708 Ga0070692_10131532
709 Ga0070668_100020436
710 Ga0070668_100074913
711 Ga0070669_100037334
712 Ga0070669_100518475
713 Ga0070675_100238037
714 Ga0070675_100305434
715 Ga0070671_100124824
716 Ga0070671_100829305
717 Ga0070674_100045302
718 Ga0070674_100503323
719 Ga0070673_100075532
720 Ga0070673_100439370
721 Ga0070688_100029998
722 Ga0070688_100085110
723 Ga0070659_100048125
724 Ga0070659_100148576
725 Ga0070667_100057655
726 Ga0070667_100747167
727 Ga0070703_10257203
728 Ga0070709_10027415
729 Ga0070709_10056987
730 Ga0070709_10296054
731 Ga0070709_10337234
732 Ga0070709_10977116
733 Ga0070714_100008067
734 Ga0070714_100074824
735 Ga0070714_100151709
736 Ga0070714_100387675
737 Ga0070714_100388230
738 Ga0070714_100851085
739 Ga0070714_100949713
740 Ga0070713_100000504
741 Ga0070713_100016513
742 Ga0070713_100269622
743 Ga0070713_100414882
744 Ga0070713_102277430
745 Ga0070710_10000879
746 Ga0070710_10003411
747 Ga0070710_10016912
748 Ga0070710_10033500
749 Ga0070710_10060207
750 Ga0070710_10204625
751 Ga0070710_10725686
752 Ga0070710_10995304
753 Ga0070701_10000217
754 Ga0070701_10564605
755 Ga0070711_100015938
756 Ga0070711_100021458
757 Ga0070711_100140988
758 Ga0070711_100198533
759 Ga0070711_100202868
760 Ga0070711_100497474
761 Ga0070711_101133813
762 Ga0070711_101261801
763 Ga0070705_100011498
764 Ga0070705_100290616
765 Ga0070705_101255555
766 Ga0070700_100001736
767 Ga0070700_100312332
768 Ga0070694_100014765
769 Ga0070694_100175230
770 Ga0070694_100314686
771 Ga0070708_100021259
772 Ga0070708_100238138
773 Ga0070708_100243383
774 Ga0070708_100398098
775 Ga0070663_100040555
776 Ga0070663_100133672
777 Ga0070663_100518879
778 Ga0070678_100039173
779 Ga0070678_100300165
780 Ga0070662_100031240
781 Ga0070662_100940226
782 Ga0070681_11270601
783 Ga0068867_100402627
784 Ga0070685_10117597
785 Ga0070685_10248205
786 Ga0070706_100021285
787 Ga0070707_100155161
788 Ga0070707_100668411
789 Ga0070698_100011759
790 Ga0070698_100049742
791 Ga0070698_100094393
792 Ga0070699_100005208
793 Ga0070699_100033518
794 Ga0070679_100562535
795 Ga0070697_100007959
796 Ga0070697_101014569
797 Ga0068853_100077671
798 Ga0070672_100211425
799 Ga0070686_100023481
800 Ga0070695_100014832
801 Ga0070695_100150542
802 Ga0070696_100156751
803 Ga0070693_100109051
804 Ga0070665_100042013
805 Ga0070665_100287482
806 Ga0070665_100395292
807 Ga0070665_100731828
808 Ga0070704_100026995
809 Ga0070704_100446706
810 Ga0070704_100840072
811 Ga0068855_100431636
812 Ga0070664_100414625
813 Ga0068854_100029339
814 Ga0068856_100010788
815 Ga0068856_100073806
816 Ga0070702_100001436
817 Ga0070702_100067088
818 Ga0068852_100079356
819 Ga0068852_102656605
820 Ga0068859_100099023
821 Ga0068859_100303347
822 Ga0068864_100074235
823 Ga0068864_100316783
824 Ga0068864_101236471
825 Ga0068866_10051292
826 Ga0068866_11194355
827 Ga0068861_100054707
828 Ga0068861_100386885
829 Ga0068861_102211140
830 Ga0068870_10163606
831 Ga0068863_100121326
832 Ga0068863_100214132
833 Ga0068858_100079034
834 Ga0068858_100079553
835 Ga0068858_100581308
836 Ga0068858_100581640
837 Ga0068860_100208705
838 Ga0068862_100056462
839 Ga0081455_10025298
840 Ga0081538_10008343
841 Ga0081538_10145484
842 Ga0081540_1104354
843 Ga0081540_1161970
844 Ga0070717_10000913
845 Ga0070717_10132511
846 Ga0070717_10143565
847 Ga0070717_10179176
848 Ga0070717_10460846
849 Ga0070717_10723733
850 Ga0070717_11061053
851 Ga0070717_11950628
852 Ga0070715_10003867
853 Ga0070715_10008431
854 Ga0070715_10019989
855 Ga0070715_10027630
856 Ga0070716_100000544
857 Ga0070716_100039196
858 Ga0070716_100059928
859 Ga0070716_100336954
860 Ga0070716_100350521
861 Ga0070716_101286820
862 Ga0070712_100002065
863 Ga0070712_100035177
864 Ga0070712_100152747
865 Ga0070712_100172939
866 Ga0070712_100557443
867 Ga0070712_101102816
868 Ga0070712_101772899
869 Ga0075427_10098474
870 Ga0097621_100024550
871 Ga0097621_100119197
872 Ga0068871_100015360
873 Ga0068871_100102452
874 Ga0068871_100617930
875 Ga0068871_100990781
876 Ga0075428_100994697
877 Ga0075434_101023872
878 Ga0068865_100027445
879 Ga0097620_100099035
880 Ga0097620_100303369
881 Ga0075435_100948548
882 Ga0099794_10071674
883 Ga0099794_10164817
884 Ga0105251_10314866
885 Ga0105250_10017659
886 Ga0105245_10056921
887 Ga0105245_10064163
888 Ga0105245_10091866
889 Ga0105245_10350202
890 Ga0105245_11857653
891 Ga0105247_10022888
892 Ga0105247_10101049
893 Ga0105243_10048229
894 Ga0105243_10510126
895 Ga0105243_10672467
896 Ga0105243_12475708
897 Ga0105241_10023302
898 Ga0105241_11062750
899 Ga0105242_10007068
900 Ga0105242_10081505
901 Ga0105242_10214262
902 Ga0105242_12585239
903 Ga0105248_10076443
904 Ga0105248_10083213
905 Ga0105248_10445788
906 Ga0105237_10000716
907 Ga0105237_10079853
908 Ga0105237_10090099
909 Ga0105237_10094197
910 Ga0105238_10461249
911 Ga0105238_10889605
912 Ga0105238_11058615
913 Ga0105249_10009001
914 Ga0105249_11311017
915 Ga0099796_10060032
916 Ga0105239_10000720
917 Ga0105239_10007791
918 Ga0105239_10093577
919 Ga0105239_10732821
920 Ga0105239_11455569
921 Ga0105246_10135845
922 Ga0105246_10533018
923 Ga0105246_10871369
924 Ga0105246_11238223
925 Ga0157370_10165669
926 Ga0157369_10177166
927 Ga0157369_11303088
928 Ga0157369_11513351
929 Ga0157374_10029958
930 Ga0157374_10075054
931 Ga0157374_11618934
932 Ga0157378_10043966
933 Ga0157378_10222760
934 Ga0163162_10025467
935 Ga0163162_10031769
936 Ga0163162_10245107
937 Ga0163162_10424054
938 Ga0163162_11288674
939 Ga0157372_10035512
940 Ga0157372_10095945
941 Ga0157372_10104234
942 Ga0157375_10006872
943 Ga0157375_10037547
944 Ga0157375_10113375
945 Ga0157375_10309743
946 Ga0157375_10590137
947 Ga0157375_11177750
948 Ga0163163_10101492
949 Ga0163163_10180668
950 Ga0163163_10335669
951 Ga0157380_10180201
952 Ga0157377_10129084
953 Ga0157379_10004168
954 Ga0157379_10075576
955 Ga0157376_10038219
956 Ga0157376_10835993
957 Ga0157376_11112812
958 Ga0163161_10041188
959 Ga0213876_10004318
960 Ga0224572_1003769
961 Ga0228598_1037424
962 Ga0207696_1129528
963 Ga0207692_10000112
964 Ga0207692_10002307
965 Ga0207692_10024882
966 Ga0207692_10053705
967 Ga0207692_10148374
968 Ga0207692_10311822
969 Ga0207692_10827744
970 Ga0207642_10029582
971 Ga0207642_10273904
972 Ga0207710_10016956
973 Ga0207710_10018562
974 Ga0207688_10002636
975 Ga0207688_10276145
976 Ga0207680_10035220
977 Ga0207680_10117929
978 Ga0207647_10075392
979 Ga0207685_10001987
980 Ga0207685_10002509
981 Ga0207685_10017487
982 Ga0207685_10633639
983 Ga0207699_10000296
984 Ga0207699_10018942
985 Ga0207699_10023169
986 Ga0207699_10548488
987 Ga0207645_10009553
988 Ga0207645_10185319
989 Ga0207643_10179938
990 Ga0207684_10001750
991 Ga0207684_10164008
992 Ga0207684_10307337
993 Ga0207654_10012763
994 Ga0207695_11577632
995 Ga0207671_10014877
996 Ga0207671_10192713
997 Ga0207671_10206150
998 Ga0207671_10221808
999 Ga0207693_10000718
1000 Ga0207693_10001067
1001 Ga0207693_10059850
1002 Ga0207693_10133539
1003 Ga0207693_10139969
1004 Ga0207693_10167796
1005 Ga0207693_10508832
1006 Ga0207693_11146765
1007 Ga0207663_10003753
1008 Ga0207663_10012851
1009 Ga0207663_10216829
1010 Ga0207660_10069818
1011 Ga0207657_10302183
1012 Ga0207657_10308541
1013 Ga0207652_10108783
1014 Ga0207646_10000731
1015 Ga0207646_10069080
1016 Ga0207646_10101724
1017 Ga0207681_10092386
1018 Ga0207694_10189382
1019 Ga0207659_10081271
1020 Ga0207659_10192694
1021 Ga0207687_10014963
1022 Ga0207687_10016150
1023 Ga0207687_10122373
1024 Ga0207700_10000421
1025 Ga0207700_10014276
1026 Ga0207700_10022106
1027 Ga0207700_10771891
1028 Ga0207664_10000343
1029 Ga0207664_10018680
1030 Ga0207664_10142608
1031 Ga0207664_10195264
1032 Ga0207664_10323011
1033 Ga0207664_10728140
1034 Ga0207664_11155235
1035 Ga0207664_11257325
1036 Ga0207690_10054788
1037 Ga0207706_10008610
1038 Ga0207706_10136804
1039 Ga0207686_10024703
1040 Ga0207709_10010591
1041 Ga0207709_10532400
1042 Ga0207709_11383437
1043 Ga0207670_10010994
1044 Ga0207669_10001358
1045 Ga0207669_10226015
1046 Ga0207704_10014099
1047 Ga0207665_10000172
1048 Ga0207665_10004070
1049 Ga0207665_10125186
1050 Ga0207691_10160086
1051 Ga0207689_10072769
1052 Ga0207661_10184080
1053 Ga0207667_10335890
1054 Ga0207651_10323775
1055 Ga0207651_10385816
1056 Ga0207712_10091522
1057 Ga0207712_10886987
1058 Ga0207668_10264336
1059 Ga0207668_11134826
1060 Ga0207640_10004988
1061 Ga0207658_10032551
1062 Ga0207677_10004119
1063 Ga0207677_10015069
1064 Ga0207677_10557716
1065 Ga0207677_11038858
1066 Ga0207703_10046362
1067 Ga0207703_10333403
1068 Ga0207639_10798503
1069 Ga0207678_10057258
1070 Ga0207678_10219514
1071 Ga0207678_10279005
1072 Ga0207708_10006455
1073 Ga0207702_10051668
1074 Ga0207702_10583713
1075 Ga0207641_12390046
1076 Ga0207648_10003339
1077 Ga0207648_10754193
1078 Ga0207676_10231245
1079 Ga0207676_11218395
1080 Ga0207674_10199845
1081 Ga0207674_11472548
1082 Ga0207675_100068777
1083 Ga0207675_101678157
1084 Ga0207683_10047989
1085 Ga0207683_10488038
1086 Ga0207698_10041091
1087 Ga0207698_10867790
1088 Ga0207698_11422846
1089 Ga0207698_12146074
1090 Ga0209588_1223609
1091 Ga0268266_10047632
1092 Ga0268266_10175027
1093 Ga0268266_10221242
1094 Ga0268266_10592794
1095 Ga0268266_10782017
1096 Ga0268265_10092251
1097 Ga0268264_10021670
1098 Ga0265760_10087692
1099 Ga0307513_10111565
1100 Ga0307513_10161493
1101 Ga0307408_102464423
1102 Ga0307415_100117297
1103 Ga0373948_0064114
1104 Ga0373958_0057467
1105 Ga0373926_0000983
1106 Ga0373926_0234302
1107 Ga0373934_0005251
1108 Ga0373934_0198895
1109 Ga0373944_0263110
1110 Ga0373951_0003035
1111 Ga0373951_0075487
1112 Ga0373923_0001230
1113 Ga0373923_0129026
1114 Ga0373932_0062386
1115 Ga0373936_0001230
1116 Ga0373945_0004836
1117 Ga0373953_0003188
1118 Ga0373953_0068693
1119 Ga0373954_0023093
1120 Ga0373956_0005373
1121 Ga0373956_0245411
1122 Ga0373957_0000641
1123 Ga0373957_0171029
1124 Ga0373943_0009642
1125 Ga0373943_0574648
1126 Ga0373946_0003521
1127 Ga0373946_0312031
1128 Ga0373955_0005027
1129 Ga0373955_0229246
1130 Ga0373955_0347607
1131 Ga0373942_0248285
1132 Ga0373924_0001992
1133 Ga0373931_0026884
1134 Ga0373931_0262991
1135 Ga0373935_0006915
1136 Ga0373927_0062972
1137 Ga0373933_0043149
1138 Ga0373933_0053734
1139 Ga0373933_0163065
1140 Ga0373947_0005683
1141 Ga0373947_0975989
1142 Ga0373937_0015246
1143 Ga0373937_0022056
1144 Ga0373937_0076263
1145 Ga0372808_018593
1146 Ga0373925_0013178
1147 Ga0373925_0472200
1148 Ga0373925_1145652
1149 Ga0436364_0771334
1150 Ga0395901_1871505
1151 Ga0436365_1155520
1152 Ga0436363_1132145
1153 Ga0466967_1936562
1154 Ga0495592_0063498
1155 Ga0495592_0318633
1156 Ga0495603_0003484
1157 Ga0495629_0002385
1158 Ga0495629_0682343
1159 Ga0495638_0002268
1160 Ga0495638_0004981
1161 Ga0495641_0005642
1162 Ga0495641_0147039
1163 Ga0495651_0010315
1164 Ga0495651_0010792
1165 Ga0495651_0299737
1166 Ga0495653_0046340
1167 Ga0495653_0050634
1168 Ga0495653_0098838
1169 Ga0495653_0222321
1170 Ga0495580_0028930
1171 Ga0495582_0002898
1172 Ga0495639_0058084
1173 Ga0495664_0006276
1174 Ga0495664_0561127
1175 Ga0495584_0477616
1176 Ga0495594_0026153
1177 Ga0495606_0149012
1178 Ga0495608_0002320
1179 Ga0495608_0024314
1180 Ga0495608_0025622
1181 Ga0495618_0023920
1182 Ga0495628_0014161
1183 Ga0495628_0217605
1184 Ga0495628_0403867
1185 Ga0495630_0001308
1186 Ga0495630_0001615
1187 Ga0495630_0624607
1188 Ga0495630_0704808
1189 Ga0495631_0155034
1190 Ga0495644_0463541
1191 Ga0495666_0006361
1192 Ga0495652_0050141
1193 Ga0495652_0095702
1194 Ga0495652_0257311
1195 Ga0495652_0459035
1196 Ga0495652_0807580
1197 Ga0495665_0002106
1198 Ga0495640_0023987
1199 Ga0495640_0111573
1200 Ga0495640_0187251
1201 Ga0495640_0293622
1202 Ga0495586_0024146
1203 Ga0495587_0004692
1204 Ga0495587_0069578
1205 Ga0495587_0087887
1206 Ga0495609_0407137
1207 Ga0495645_0014164
1208 Ga0495645_0034021
1209 Ga0495645_0348587
1210 Ga0495667_0000254
1211 Ga0495667_0001165
1212 Ga0495667_0030035
1213 Ga0495656_0212404
1214 Ga0495634_0019286
1215 Ga0495634_0321509
1216 Ga0495635_0003320
1217 Ga0495635_0011288
1218 Ga0495635_0351914
1219 Ga0495588_0046962
1220 Ga0495657_0004610
1221 Ga0495657_0026009
1222 Ga0495599_0000852
1223 Ga0495599_0008197
1224 Ga0495599_0153634
1225 Ga0495623_0073181
1226 Ga0495623_0140656
1227 Ga0495623_0482456
1228 Ga0495646_0034177
1229 Ga0495646_0051869
1230 Ga0495647_0060739
1231 Ga0495658_0160286
1232 Ga0495658_0170797
1233 Ga0495613_0003122
1234 Ga0495613_0450456
1235 Ga0495624_0009879
1236 Ga0495624_0221794
1237 Ga0495600_0010016
1238 Ga0495600_0054846
1239 Ga0495600_0086269
1240 Ga0495581_0013324
1241 Ga0495604_0113014
1242 Ga0495604_0243209
1243 Ga0495604_0395040
1244 Ga0495674_0016752
1245 Ga0495674_0101188
1246 Ga0495674_1147623
1247 Ga0495672_0283329
1248 Ga0495676_0007867
1249 Ga0495676_0499888
1250 Ga0495676_0550922
1251 Ga0495680_0023042
1252 Ga0495680_0058566
1253 Ga0495680_0390411
1254 Ga0495675_0016204
1255 Ga0495675_0035726
1256 Ga0495677_0318392
1257 Ga0495684_0001429
1258 Ga0495684_0010764
1259 Ga0495684_0041542
1260 Ga0495686_0018196
1261 Ga0495593_0005072
1262 Ga0495602_0008969
1263 Ga0495602_0021839
1264 Ga0495602_0393083
1265 Ga0495614_0019904
1266 Ga0496100_0293370
1267 Ga0496100_0568689
1268 Ga0496100_1280789
1269 Ga0496101_0010132
1270 Ga0496101_0205013
1271 Ga0496102_0003334
1272 Ga0496102_0119983
1273 Ga0496102_0778482
1274 Ga0496102_1163448
1275 Ga0496103_0001931
1276 Ga0496103_0205815
1277 Ga0496104_0002929
1278 Ga0496104_0054798
1279 Ga0496104_1264724
1280 Ga0496105_0017219
1281 Ga0496105_0019244
1282 Ga0496105_0201129
1283 Ga0496106_0002776
1284 Ga0496106_0388049
1285 Ga0496106_1340335
1286 Ga0496107_0024101
1287 Ga0496108_0001367
1288 Ga0496108_0001442
1289 Ga0496108_0031106
1290 Ga0496108_0862152
1291 Ga0496109_0041637
1292 Ga0496109_0062633
1293 Ga0496109_1006973
1294 Ga0496110_0012258
1295 Ga0496110_0143598
1296 Ga0496110_1002557
1297 Ga0496111_0047009
1298 Ga0496111_0307178
1299 Ga0496112_0018159
1300 Ga0496112_0046162
1301 Ga0496112_0357331
1302 Ga0496113_0043084
1303 Ga0496113_0079680
1304 Ga0496114_0025268
1305 Ga0496114_0223018
1306 Ga0496115_0064040
1307 Ga0496115_0411810
1308 Ga0496115_0841568
1309 Ga0496126_0056619
1310 Ga0496126_0117165
1311 Ga0496126_0169208
1312 Ga0501042_0181478
1313 Ga0501045_0374088
1314 nmdc:mga06r32_1340756_c1
1315 nmdc:mga08y16_943420_c1
1316 nmdc:mga0n895_745095_c1
1317 Ga0495601_0007081
1318 Ga0495601_0017015
1319 Ga0495601_0405011
1320 Ga0495612_0002551
1321 Ga0495612_0207675
1322 Ga0495595_0040052
1323 Ga0495595_0128599
1324 Ga0495619_0041927
1325 Ga0495619_0046213
1326 Ga0495619_0217458
1327 Ga0500643_004979
1328 Ga0500650_0171202
1329 Ga0500556_0003563
1330 Ga0500616_0000081
1331 Ga0500616_0013652
1332 Ga0500616_0060058
1333 Ga0500645_079287
1334 2558910642
1335 2870787441
1336 2939588718

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07366

SnoaL

SnoaL-like polyketide cyclase

8

142

0.94

PF12680

SnoaL_2

SnoaL-like domain

10

129

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dre-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase d38gp39gd99n mutant from pseudomonas testosteroni (tksi) 0.8735 1 131
1gs3-assembly1.cif.gz_A-2 high resolution crystal structure of pi delta-5-3-ketosteroid isomerase mutants y30f/y55f/y115f/d38n (y32f/y57f/y119f/d40n, pi numbering)complexed with equilenin at 2.1 a resolution 0.8702 2 136
3ov4-assembly2.cif.gz_C crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin 0.8622 1 136
6isl-assembly1.cif.gz_B-2 snoal-like cyclase xime with its product xiamenmycin b 0.8601 24 134
6uae-assembly4.cif.gz_D ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.8595 1 131
ID Description Score Start End Superfamily
af_O06820_1_123_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8642 1 140 3.10.450.50
af_P96818_5_130_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8605 5 143 3.10.450.50
3ov4D00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8547 1 131 3.10.450.50
af_Q10083_1_118_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8529 2 132 3.10.450.50
af_O06820_1_123_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8514 1 140 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A1V4PFE5-F1-model_v4 Ester cyclase 1.001 1 147 GO:0030638
AF-A0A3D3ID46-F1-model_v4 Ester cyclase 0.9945 3 147 GO:0030638
AF-A0A2Z5FTT9-F1-model_v4 Putative ester cyclase 0.9944 3 147 GO:0030638
AF-A0A1V4PFE5-F1-model_v4 Ester cyclase 0.9941 1 147 GO:0030638
AF-A0A4Q5PGX3-F1-model_v4 Ester cyclase 0.9906 3 147 GO:0030638

Map