F473833

General Info

Members Datasets Scaffolds Average Seq Length
667 358 602 202

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100894342|Ga0075428_1008943422
Length 222
Sequence MKAIPLSVAFEVASGIAFAQGAADPMAHLRACAVMEQAERLKCLDRLSRDIAVPDRAAGSGDNWIISETTSPVNYMQLRMPRTRGSPSSRPMVTATASSRGGPDGSSMRLAIHCRGGRTELVVSGPAISRRGSEYSITYRVNDDQPLQLPASSPSFGAGAAFTGDIVRLLQSLPEEGHIAVRISPRGGAGQDGHFLLGGLKTAREKLAAACKWPHAIAAPHN

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
4 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
5 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
6 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
7 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
8 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
9 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
10 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
11 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
12 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
13 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
14 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
15 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
16 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
17 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
18 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
19 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
20 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
21 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
22 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
23 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
24 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
25 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
26 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
27 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
28 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
29 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
30 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
31 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
32 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
33 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
34 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
35 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
36 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
37 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
38 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
39 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
40 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
41 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
42 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
43 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
44 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
45 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
46 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
47 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
48 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
49 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
50 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
51 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
54 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
55 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
56 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
59 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
60 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
61 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
64 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
65 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
66 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
67 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
68 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
69 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
70 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
71 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
75 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
76 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
77 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
78 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
79 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
84 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
85 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
86 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
87 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
93 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
94 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
95 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
96 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
107 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
108 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
114 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
115 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
116 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
117 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
118 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
119 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
120 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
121 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
122 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
123 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
124 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
125 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
126 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
128 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
129 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
130 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
131 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
132 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
134 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
135 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
136 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
137 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
138 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
139 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
141 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
142 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
143 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
144 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
145 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
146 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
147 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
148 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
151 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
152 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
153 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
154 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
157 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
158 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
159 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
160 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
161 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
162 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
163 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
164 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
165 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
166 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
168 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
225 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
226 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
227 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
228 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
234 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
235 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
236 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
237 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
238 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
239 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
240 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
241 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
242 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
243 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
244 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
245 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
247 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
248 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
249 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
250 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
251 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
255 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
256 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
257 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
258 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
259 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
260 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
261 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
262 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
263 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
264 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
265 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
266 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
267 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
268 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
269 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
270 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
271 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
272 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
273 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
274 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
275 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
276 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
277 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
278 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
279 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
280 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
281 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
282 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
283 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
284 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
285 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
286 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
287 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
288 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
289 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
292 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
309 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
312 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
313 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
314 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
315 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
316 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
317 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
318 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
323 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
324 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
325 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
326 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
327 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
328 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
329 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
330 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
331 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
332 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
333 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
334 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
335 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
336 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
337 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
338 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
339 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
340 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
341 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
342 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
343 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
344 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
345 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
346 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
347 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
348 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
349 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
350 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
351 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
352 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
353 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
354 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
355 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
356 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
357 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
358 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.25
Metatranscriptomes 0
Isolates 9.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.9
Nodule 7.95
Rhizoplane 7.35
Rhizosphere 68.37
Stem 0
Stem Tuber 0
Unclassified 6.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1003694 3300000549 Bacteria 2034
2 JGI24742J22300_10017981 3300002244 Bacteria 1198
3 JGI25404J52841_10000073 3300003659 Bacteria 9022
4 JGI25404J52841_10018614 3300003659 Bacteria 1505
5 Ga0070658_10087636 3300005327 Bacteria 2562
6 Ga0070676_10321747 3300005328 Bacteria 1055
7 Ga0070683_100228272 3300005329 Bacteria 1770
8 Ga0070683_100353016 3300005329 Bacteria 1400
9 Ga0070690_100094006 3300005330 Bacteria 1978
10 Ga0070690_100218738 3300005330 Bacteria 1334
11 Ga0070690_100384318 3300005330 Bacteria 1027
12 Ga0070670_100080989 3300005331 Bacteria 2790
13 Ga0070670_100303313 3300005331 Bacteria 1397
14 Ga0068869_100070955 3300005334 Bacteria 2578
15 Ga0068869_100272433 3300005334 Bacteria 1359
16 Ga0068869_100326377 3300005334 Bacteria 1246
17 Ga0070666_10086780 3300005335 Bacteria 2145
18 Ga0070680_100088385 3300005336 Bacteria 2563
19 Ga0070680_100710243 3300005336 Bacteria 865
20 Ga0070682_100030872 3300005337 Bacteria 3238
21 Ga0070682_100107936 3300005337 Bacteria 1850
22 Ga0070682_100269681 3300005337 Bacteria 1236
23 Ga0070682_100732652 3300005337 Bacteria 796
24 Ga0068868_100002640 3300005338 Bacteria 12436
25 Ga0068868_100430015 3300005338 Bacteria 1145
26 Ga0068868_100648905 3300005338 Bacteria 940
27 Ga0070660_100069978 3300005339 Bacteria 2737
28 Ga0070689_100480329 3300005340 Bacteria 1061
29 Ga0070691_10062736 3300005341 Bacteria 1790
30 Ga0070691_10218046 3300005341 Bacteria 1010
31 Ga0070661_100075348 3300005344 Bacteria 2486
32 Ga0070661_100080291 3300005344 Bacteria 2408
33 Ga0070661_100119690 3300005344 Bacteria 1971
34 Ga0070668_100016139 3300005347 Bacteria 5589
35 Ga0070668_100017881 3300005347 Bacteria 5319
36 Ga0070668_100040249 3300005347 Bacteria 3576
37 Ga0070668_100084085 3300005347 Bacteria 2499
38 Ga0070668_100242384 3300005347 Bacteria 1494
39 Ga0070668_100474916 3300005347 Bacteria 1079
40 Ga0070669_100319674 3300005353 Bacteria 1253
41 Ga0070675_100152255 3300005354 Bacteria 1984
42 Ga0070675_100260644 3300005354 Bacteria 1519
43 Ga0070671_100013730 3300005355 Bacteria 6533
44 Ga0070674_100287602 3300005356 Bacteria 1305
45 Ga0070674_100344533 3300005356 Bacteria 1202
46 Ga0070674_100366756 3300005356 Bacteria 1168
47 Ga0070674_100426826 3300005356 Bacteria 1089
48 Ga0070674_100748366 3300005356 Bacteria 840
49 Ga0070673_100081240 3300005364 Bacteria 2628
50 Ga0070673_100112266 3300005364 Bacteria 2262
51 Ga0070659_100126673 3300005366 Bacteria 2072
52 Ga0070659_100153865 3300005366 Bacteria 1877
53 Ga0070659_100187774 3300005366 Bacteria 1698
54 Ga0070667_100785051 3300005367 Bacteria 884
55 Ga0070709_10060796 3300005434 Bacteria 2403
56 Ga0070710_10351926 3300005437 Bacteria 975
57 Ga0070711_100348999 3300005439 Bacteria 1189
58 Ga0070700_100090789 3300005441 Bacteria 1993
59 Ga0070694_100520767 3300005444 Bacteria 949
60 Ga0070708_100284274 3300005445 Bacteria 1557
61 Ga0070663_100010586 3300005455 Bacteria 5753
62 Ga0070663_100011200 3300005455 Bacteria 5618
63 Ga0070663_100029062 3300005455 Bacteria 3772
64 Ga0070663_100033325 3300005455 Bacteria 3558
65 Ga0070663_100034596 3300005455 Bacteria 3500
66 Ga0070663_100117018 3300005455 Bacteria 2010
67 Ga0070663_100339823 3300005455 Bacteria 1213
68 Ga0070678_100222692 3300005456 Bacteria 1569
69 Ga0070678_100289729 3300005456 Bacteria 1387
70 Ga0070678_100648841 3300005456 Bacteria 947
71 Ga0070678_100737454 3300005456 Bacteria 890
72 Ga0070662_100041247 3300005457 Bacteria 3292
73 Ga0070662_100177656 3300005457 Bacteria 1676
74 Ga0070662_100215243 3300005457 Bacteria 1530
75 Ga0070681_10061902 3300005458 Bacteria 3716
76 Ga0068867_100090574 3300005459 Bacteria 2320
77 Ga0068867_100152489 3300005459 Bacteria 1816
78 Ga0068867_100153275 3300005459 Bacteria 1812
79 Ga0070685_10719490 3300005466 Bacteria 729
80 Ga0070706_100350994 3300005467 Bacteria 1375
81 Ga0070707_100479566 3300005468 Bacteria 1205
82 Ga0070684_100037005 3300005535 Bacteria 4184
83 Ga0070697_100141672 3300005536 Bacteria 2022
84 Ga0070697_100537843 3300005536 Bacteria 1024
85 Ga0068853_100136426 3300005539 Bacteria 2200
86 Ga0068853_100260398 3300005539 Bacteria 1594
87 Ga0068853_100446633 3300005539 Bacteria 1216
88 Ga0070672_100123736 3300005543 Bacteria 2120
89 Ga0070672_100186388 3300005543 Bacteria 1731
90 Ga0070672_100344825 3300005543 Bacteria 1269
91 Ga0070686_100123848 3300005544 Bacteria 1778
92 Ga0070686_100193888 3300005544 Bacteria 1452
93 Ga0070686_100356323 3300005544 Bacteria 1101
94 Ga0070695_100378451 3300005545 Bacteria 1068
95 Ga0070696_100139962 3300005546 Bacteria 1768
96 Ga0070693_100328556 3300005547 Bacteria 1040
97 Ga0070665_100000907 3300005548 Bacteria 38019
98 Ga0070665_100012477 3300005548 Bacteria 8564
99 Ga0070665_100026407 3300005548 Bacteria 5848
100 Ga0070665_100079071 3300005548 Bacteria 3295
101 Ga0070665_100377182 3300005548 Bacteria 1425
102 Ga0068855_100145101 3300005563 Bacteria 2703
103 Ga0070664_100037752 3300005564 Bacteria 4062
104 Ga0068857_100082333 3300005577 Bacteria 2875
105 Ga0068857_100090725 3300005577 Bacteria 2734
106 Ga0068854_100162464 3300005578 Bacteria 1731
107 Ga0068856_100109763 3300005614 Bacteria 2755
108 Ga0070702_100017245 3300005615 Bacteria 3722
109 Ga0068852_100036443 3300005616 Bacteria 4116
110 Ga0068852_100114739 3300005616 Bacteria 2455
111 Ga0068852_100176400 3300005616 Bacteria 2007
112 Ga0068859_100038727 3300005617 Bacteria 4782
113 Ga0068864_100022449 3300005618 Bacteria 5292
114 Ga0068866_10031988 3300005718 Bacteria 2539
115 Ga0068866_10119239 3300005718 Bacteria 1484
116 Ga0068866_10135098 3300005718 Bacteria 1408
117 Ga0068866_10209068 3300005718 Bacteria 1170
118 Ga0068861_100011149 3300005719 Bacteria 6241
119 Ga0068861_100077725 3300005719 Bacteria 2589
120 Ga0068861_100082171 3300005719 Bacteria 2524
121 Ga0068861_100105212 3300005719 Bacteria 2253
122 Ga0068861_100724529 3300005719 Bacteria 926
123 Ga0068861_100735825 3300005719 Bacteria 920
124 Ga0068870_10014095 3300005840 Bacteria 3770
125 Ga0068863_100024757 3300005841 Bacteria 5725
126 Ga0068858_100162906 3300005842 Bacteria 2100
127 Ga0068858_101134748 3300005842 Bacteria 768
128 Ga0068860_100133926 3300005843 Bacteria 2379
129 Ga0068860_100247061 3300005843 Bacteria 1737
130 Ga0068860_100369245 3300005843 Bacteria 1415
131 Ga0068860_100497713 3300005843 Bacteria 1216
132 Ga0068862_100052693 3300005844 Bacteria 3482
133 Ga0068862_100061636 3300005844 Bacteria 3224
134 Ga0068862_101082315 3300005844 Bacteria 796
135 Ga0081455_10023565 3300005937 Bacteria 5726
136 Ga0081538_10018086 3300005981 Bacteria 5316
137 Ga0081540_1003974 3300005983 Bacteria 11485
138 Ga0081540_1006148 3300005983 Bacteria 8811
139 Ga0081540_1017945 3300005983 Bacteria 4360
140 Ga0081540_1027706 3300005983 Bacteria 3203
141 Ga0081540_1093100 3300005983 Bacteria 1321
142 Ga0075365_10009774 3300006038 Bacteria 5542
143 Ga0075365_10033811 3300006038 Bacteria 3298
144 Ga0075365_10100784 3300006038 Bacteria 1977
145 Ga0075365_10338822 3300006038 Bacteria 1060
146 Ga0075363_100011979 3300006048 Bacteria 4169
147 Ga0075363_100023243 3300006048 Bacteria 3140
148 Ga0075363_100026384 3300006048 Bacteria 2972
149 Ga0075363_100064361 3300006048 Bacteria 1981
150 Ga0075363_100123050 3300006048 Bacteria 1450
151 Ga0075364_10006598 3300006051 Bacteria 6833
152 Ga0075364_10030478 3300006051 Bacteria 3462
153 Ga0075364_10057390 3300006051 Bacteria 2550
154 Ga0070715_10043602 3300006163 Bacteria 1892
155 Ga0070715_10292425 3300006163 Unclassified 868
156 Ga0070716_100101458 3300006173 Bacteria 1765
157 Ga0070712_100394774 3300006175 Bacteria 1141
158 Ga0070712_100448735 3300006175 Bacteria 1073
159 Ga0075362_10110606 3300006177 Bacteria 1293
160 Ga0075367_10027318 3300006178 Bacteria 3245
161 Ga0075367_10095706 3300006178 Bacteria 1811
162 Ga0075367_10157223 3300006178 Bacteria 1413
163 Ga0075369_10021586 3300006186 Bacteria 2648
164 Ga0075366_10094557 3300006195 Bacteria 1792
165 Ga0097621_100015958 3300006237 Bacteria 5664
166 Ga0075370_10014309 3300006353 Bacteria 4231
167 Ga0075370_10072218 3300006353 Bacteria 1975
168 Ga0068871_100053388 3300006358 Bacteria 3275
169 Ga0068871_100097853 3300006358 Bacteria 2454
170 Ga0068871_100849827 3300006358 Bacteria 844
171 Ga0075428_100768388 3300006844 Bacteria 1025
172 Ga0075428_100894342 3300006844 Bacteria 942
173 Ga0075433_10332678 3300006852 Bacteria 1343
174 Ga0068865_100020402 3300006881 Bacteria 4296
175 Ga0068865_100026281 3300006881 Bacteria 3837
176 Ga0068865_100089001 3300006881 Bacteria 2235
177 Ga0068865_100091319 3300006881 Bacteria 2210
178 Ga0068865_100235837 3300006881 Bacteria 1437
179 Ga0068865_100375056 3300006881 Bacteria 1159
180 Ga0097620_100038730 3300006931 Bacteria 4782
181 Ga0099825_1035583 3300006941 Bacteria 1769
182 Ga0099824_1014958 3300006942 Bacteria 7524
183 Ga0099823_1057867 3300006944 Bacteria 2114
184 Ga0075435_100199905 3300007076 Bacteria 1693
185 Ga0099794_10022730 3300007265 Bacteria 2860
186 Ga0105240_10096778 3300009093 Bacteria 3597
187 Ga0105240_10244052 3300009093 Bacteria 2081
188 Ga0105240_10247035 3300009093 Bacteria 2066
189 Ga0105240_10626137 3300009093 Bacteria 1182
190 Ga0111539_10291568 3300009094 Bacteria 1899
191 Ga0111539_10698901 3300009094 Bacteria 1180
192 Ga0111539_11197047 3300009094 Bacteria 882
193 Ga0105245_10043059 3300009098 Bacteria 4027
194 Ga0105245_10052458 3300009098 Bacteria 3658
195 Ga0105245_10094116 3300009098 Bacteria 2761
196 Ga0105245_10194066 3300009098 Bacteria 1947
197 Ga0105245_10903266 3300009098 Bacteria 925
198 Ga0105245_11041984 3300009098 Bacteria 863
199 Ga0105247_10034503 3300009101 Bacteria 3081
200 Ga0105243_10177477 3300009148 Bacteria 1850
201 Ga0105243_10418300 3300009148 Bacteria 1249
202 Ga0105241_10012171 3300009174 Bacteria 6315
203 Ga0105241_10252256 3300009174 Bacteria 1496
204 Ga0105242_10059491 3300009176 Bacteria 3135
205 Ga0105242_10180639 3300009176 Bacteria 1861
206 Ga0105242_10372710 3300009176 Bacteria 1325
207 Ga0105242_10727310 3300009176 Bacteria 974
208 Ga0105248_10010641 3300009177 Bacteria 10144
209 Ga0105237_10004604 3300009545 Bacteria 15907
210 Ga0105237_10013986 3300009545 Bacteria 8398
211 Ga0105237_10062317 3300009545 Bacteria 3729
212 Ga0105237_10124269 3300009545 Bacteria 2575
213 Ga0105238_10011512 3300009551 Bacteria 8914
214 Ga0105238_10025189 3300009551 Bacteria 6063
215 Ga0105238_10124257 3300009551 Bacteria 2560
216 Ga0105238_10278327 3300009551 Bacteria 1654
217 Ga0105249_10114180 3300009553 Bacteria 2557
218 Ga0105249_10218823 3300009553 Bacteria 1873
219 Ga0105249_10362195 3300009553 Bacteria 1472
220 Ga0105249_10374406 3300009553 Bacteria 1448
221 Ga0105239_10000778 3300010375 Bacteria 45211
222 Ga0105239_10029633 3300010375 Bacteria 6017
223 Ga0105239_10034155 3300010375 Bacteria 5583
224 Ga0105239_10038676 3300010375 Bacteria 5228
225 Ga0105239_10072659 3300010375 Bacteria 3782
226 Ga0105239_11021427 3300010375 Unclassified 951
227 Ga0105246_10019408 3300011119 Bacteria 4343
228 Ga0105246_10890668 3300011119 Unclassified 797
229 Ga0157370_10027778 3300013104 Bacteria 5578
230 Ga0157369_10124282 3300013105 Bacteria 2737
231 Ga0157369_10447405 3300013105 Bacteria 1338
232 Ga0157374_10013084 3300013296 Bacteria 7237
233 Ga0157374_10015082 3300013296 Bacteria 6775
234 Ga0157374_10073303 3300013296 Bacteria 3232
235 Ga0157378_10034431 3300013297 Bacteria 4479
236 Ga0157378_10123194 3300013297 Bacteria 2392
237 Ga0157378_10489770 3300013297 Bacteria 1226
238 Ga0163162_10013299 3300013306 Bacteria 8039
239 Ga0163162_10066991 3300013306 Bacteria 3641
240 Ga0163162_10113952 3300013306 Bacteria 2802
241 Ga0163162_10121401 3300013306 Bacteria 2717
242 Ga0163162_10126318 3300013306 Bacteria 2664
243 Ga0163162_10181916 3300013306 Bacteria 2228
244 Ga0163162_10371334 3300013306 Bacteria 1563
245 Ga0163162_10528349 3300013306 Bacteria 1309
246 Ga0163162_10661704 3300013306 Bacteria 1168
247 Ga0163162_10830600 3300013306 Bacteria 1040
248 Ga0157375_10732388 3300013308 Bacteria 1141
249 Ga0157375_11242775 3300013308 Bacteria 874
250 Ga0157375_11628512 3300013308 Bacteria 763
251 Ga0163163_10021051 3300014325 Bacteria 6152
252 Ga0163163_10034261 3300014325 Bacteria 4916
253 Ga0163163_10539807 3300014325 Bacteria 1228
254 Ga0157380_10048416 3300014326 Bacteria 3348
255 Ga0157380_10122627 3300014326 Bacteria 2204
256 Ga0157380_10263149 3300014326 Bacteria 1568
257 Ga0157380_10373276 3300014326 Bacteria 1343
258 Ga0157380_10576415 3300014326 Bacteria 1109
259 Ga0157380_10606505 3300014326 Bacteria 1084
260 Ga0157377_10274558 3300014745 Bacteria 1102
261 Ga0157379_10112244 3300014968 Bacteria 2449
262 Ga0157379_10800050 3300014968 Bacteria 890
263 Ga0157376_10062862 3300014969 Bacteria 3125
264 Ga0157376_10243096 3300014969 Bacteria 1678
265 Ga0157376_10513778 3300014969 Bacteria 1179
266 Ga0163161_10048644 3300017792 Bacteria 3063
267 Ga0163161_10076732 3300017792 Bacteria 2453
268 Ga0163161_10277091 3300017792 Bacteria 1314
269 Ga0214542_1000606 3300021321 Bacteria 66272
270 Ga0214545_1000003 3300021324 Bacteria 720274
271 Ga0214543_1000002 3300021327 Bacteria 712733
272 Ga0209025_1055542 3300025294 Bacteria 1530
273 Ga0209758_1003647 3300025297 Bacteria 13738
274 Ga0209758_1017313 3300025297 Bacteria 3598
275 Ga0207697_10036024 3300025315 Bacteria 2026
276 Ga0207697_10119652 3300025315 Bacteria 1132
277 Ga0207642_10066994 3300025899 Bacteria 1693
278 Ga0207642_10076826 3300025899 Bacteria 1609
279 Ga0207710_10022382 3300025900 Bacteria 2713
280 Ga0207688_10009511 3300025901 Bacteria 5290
281 Ga0207688_10060730 3300025901 Bacteria 2130
282 Ga0207688_10067356 3300025901 Bacteria 2026
283 Ga0207688_10180408 3300025901 Bacteria 1259
284 Ga0207680_10046687 3300025903 Bacteria 2562
285 Ga0207647_10058272 3300025904 Bacteria 2366
286 Ga0207647_10086574 3300025904 Bacteria 1872
287 Ga0207647_10093709 3300025904 Bacteria 1789
288 Ga0207685_10079681 3300025905 Bacteria 1352
289 Ga0207699_10076273 3300025906 Bacteria 2064
290 Ga0207645_10232386 3300025907 Bacteria 1217
291 Ga0207643_10042602 3300025908 Bacteria 2560
292 Ga0207684_10118318 3300025910 Bacteria 2270
293 Ga0207707_10013073 3300025912 Bacteria 7231
294 Ga0207707_10066037 3300025912 Bacteria 3150
295 Ga0207707_10751064 3300025912 Bacteria 816
296 Ga0207695_10241475 3300025913 Bacteria 1708
297 Ga0207695_10450562 3300025913 Bacteria 1170
298 Ga0207671_10006919 3300025914 Bacteria 9994
299 Ga0207671_10205028 3300025914 Bacteria 1541
300 Ga0207693_10370041 3300025915 Bacteria 1121
301 Ga0207693_10541507 3300025915 Bacteria 908
302 Ga0207660_10019729 3300025917 Bacteria 4512
303 Ga0207657_10090075 3300025919 Bacteria 2560
304 Ga0207657_10120755 3300025919 Bacteria 2156
305 Ga0207657_10475179 3300025919 Bacteria 980
306 Ga0207652_10015037 3300025921 Bacteria 6277
307 Ga0207646_10179519 3300025922 Bacteria 1912
308 Ga0207681_10564651 3300025923 Bacteria 938
309 Ga0207694_10058814 3300025924 Bacteria 2990
310 Ga0207694_10078792 3300025924 Bacteria 2583
311 Ga0207694_10772142 3300025924 Unclassified 811
312 Ga0207650_10059961 3300025925 Bacteria 2838
313 Ga0207659_10310545 3300025926 Bacteria 1298
314 Ga0207687_10052096 3300025927 Bacteria 2855
315 Ga0207687_10067996 3300025927 Bacteria 2536
316 Ga0207687_10111332 3300025927 Bacteria 2032
317 Ga0207644_10268448 3300025931 Bacteria 1366
318 Ga0207644_10284676 3300025931 Bacteria 1328
319 Ga0207644_10341011 3300025931 Bacteria 1215
320 Ga0207690_10065385 3300025932 Bacteria 2487
321 Ga0207690_10280199 3300025932 Bacteria 1298
322 Ga0207706_10036435 3300025933 Bacteria 4370
323 Ga0207706_10076849 3300025933 Bacteria 2937
324 Ga0207706_10106148 3300025933 Bacteria 2471
325 Ga0207706_10169767 3300025933 Bacteria 1917
326 Ga0207706_10216289 3300025933 Bacteria 1679
327 Ga0207709_10050861 3300025935 Bacteria 2536
328 Ga0207709_10082288 3300025935 Bacteria 2078
329 Ga0207670_10248416 3300025936 Bacteria 1374
330 Ga0207669_10123134 3300025937 Bacteria 1765
331 Ga0207669_10242644 3300025937 Bacteria 1336
332 Ga0207669_10634325 3300025937 Bacteria 872
333 Ga0207669_10793316 3300025937 Bacteria 785
334 Ga0207704_10036623 3300025938 Bacteria 2825
335 Ga0207704_10239061 3300025938 Bacteria 1356
336 Ga0207665_10126279 3300025939 Bacteria 1811
337 Ga0207665_10128387 3300025939 Bacteria 1797
338 Ga0207691_10073734 3300025940 Bacteria 3079
339 Ga0207691_10129284 3300025940 Bacteria 2232
340 Ga0207691_10135105 3300025940 Bacteria 2176
341 Ga0207691_10256745 3300025940 Bacteria 1507
342 Ga0207691_10542449 3300025940 Bacteria 986
343 Ga0207711_10046563 3300025941 Bacteria 3706
344 Ga0207689_10021863 3300025942 Bacteria 5379
345 Ga0207689_10216795 3300025942 Bacteria 1581
346 Ga0207661_10081831 3300025944 Bacteria 2668
347 Ga0207661_10168564 3300025944 Bacteria 1905
348 Ga0207679_10048458 3300025945 Bacteria 3093
349 Ga0207679_10145791 3300025945 Bacteria 1920
350 Ga0207679_10537008 3300025945 Bacteria 1048
351 Ga0207667_10087440 3300025949 Bacteria 3224
352 Ga0207667_10109389 3300025949 Bacteria 2850
353 Ga0207651_10581454 3300025960 Bacteria 977
354 Ga0207712_10013111 3300025961 Bacteria 5310
355 Ga0207712_10098934 3300025961 Bacteria 2164
356 Ga0207668_10002442 3300025972 Bacteria 10848
357 Ga0207668_10011873 3300025972 Bacteria 5311
358 Ga0207668_10064080 3300025972 Bacteria 2596
359 Ga0207668_10090856 3300025972 Bacteria 2242
360 Ga0207668_10230060 3300025972 Bacteria 1494
361 Ga0207668_10387988 3300025972 Bacteria 1177
362 Ga0207668_10473732 3300025972 Bacteria 1073
363 Ga0207640_10352000 3300025981 Bacteria 1184
364 Ga0207640_10718011 3300025981 Bacteria 859
365 Ga0207658_10681798 3300025986 Bacteria 928
366 Ga0207677_10156196 3300026023 Bacteria 1767
367 Ga0207677_10176710 3300026023 Bacteria 1675
368 Ga0207677_10337662 3300026023 Bacteria 1258
369 Ga0207677_10574981 3300026023 Bacteria 985
370 Ga0207703_10712024 3300026035 Bacteria 955
371 Ga0207639_10029947 3300026041 Bacteria 3989
372 Ga0207639_10186586 3300026041 Bacteria 1768
373 Ga0207678_10009390 3300026067 Bacteria 8607
374 Ga0207678_10011829 3300026067 Bacteria 7662
375 Ga0207678_10017970 3300026067 Bacteria 6212
376 Ga0207678_10030402 3300026067 Bacteria 4715
377 Ga0207678_10060310 3300026067 Bacteria 3263
378 Ga0207678_10063112 3300026067 Bacteria 3184
379 Ga0207678_10160149 3300026067 Bacteria 1922
380 Ga0207678_10393568 3300026067 Bacteria 1199
381 Ga0207708_10042169 3300026075 Bacteria 3479
382 Ga0207708_10082714 3300026075 Bacteria 2468
383 Ga0207708_10179324 3300026075 Bacteria 1682
384 Ga0207702_10086059 3300026078 Bacteria 2740
385 Ga0207641_11245833 3300026088 Unclassified 744
386 Ga0207648_10215168 3300026089 Bacteria 1707
387 Ga0207648_10441599 3300026089 Bacteria 1184
388 Ga0207676_10468673 3300026095 Bacteria 1191
389 Ga0207674_10021202 3300026116 Bacteria 7004
390 Ga0207674_10119773 3300026116 Bacteria 2601
391 Ga0207675_100017302 3300026118 Bacteria 6730
392 Ga0207675_100024265 3300026118 Bacteria 5639
393 Ga0207675_100039743 3300026118 Bacteria 4390
394 Ga0207675_100319449 3300026118 Bacteria 1515
395 Ga0207675_100491665 3300026118 Bacteria 1220
396 Ga0207683_10053206 3300026121 Bacteria 3549
397 Ga0207683_10067081 3300026121 Bacteria 3165
398 Ga0207683_10493321 3300026121 Bacteria 1131
399 Ga0207683_10498581 3300026121 Bacteria 1124
400 Ga0207698_10183415 3300026142 Bacteria 1856
401 Ga0207698_10257474 3300026142 Bacteria 1601
402 Ga0207698_10598959 3300026142 Bacteria 1086
403 Ga0207698_11036254 3300026142 Bacteria 832
404 Ga0209389_1000043 3300027296 Bacteria 123224
405 Ga0209389_1000077 3300027296 Bacteria 91273
406 Ga0209589_1000047 3300027357 Bacteria 118659
407 Ga0209489_100075 3300027361 Bacteria 136991
408 Ga0209489_100251 3300027361 Bacteria 91273
409 Ga0209700_100271 3300027363 Bacteria 91215
410 Ga0209813_10004746 3300027866 Bacteria 3261
411 Ga0207428_10116806 3300027907 Bacteria 2048
412 Ga0268266_10007087 3300028379 Bacteria 10179
413 Ga0268266_10025774 3300028379 Bacteria 5003
414 Ga0268266_10221468 3300028379 Bacteria 1739
415 Ga0268266_10261490 3300028379 Bacteria 1604
416 Ga0268266_10375620 3300028379 Bacteria 1340
417 Ga0268266_10419102 3300028379 Bacteria 1268
418 Ga0268265_10055689 3300028380 Bacteria 3005
419 Ga0268264_10446182 3300028381 Bacteria 1253
420 Ga0307517_10324536 3300028786 Bacteria 850
421 Ga0307515_10516873 3300028794 Unclassified 804
422 Ga0265332_10038748 3300031238 Bacteria 2065
423 Ga0265325_10084672 3300031241 Bacteria 1571
424 Ga0265331_10065277 3300031250 Bacteria 1712
425 Ga0265316_10085124 3300031344 Bacteria 2420
426 Ga0307513_10352747 3300031456 Bacteria 1218
427 Ga0307514_10318034 3300031649 Bacteria 857
428 Ga0265342_10098074 3300031712 Bacteria 1673
429 Ga0307516_10005450 3300031730 Bacteria 15211
430 Ga0307516_10015280 3300031730 Bacteria 8084
431 Ga0307516_10024698 3300031730 Bacteria 6136
432 Ga0307516_10036105 3300031730 Bacteria 4950
433 Ga0307415_100037464 3300032126 Bacteria 3188
434 Ga0307510_10028462 3300033180 Bacteria 6382
435 Ga0307510_10168552 3300033180 Bacteria 1773
436 Ga0373923_0234594 3300035111 Bacteria 856
437 Ga0373932_0108269 3300035112 Bacteria 913
438 Ga0373946_0135808 3300035171 Bacteria 1136
439 Ga0373946_0225657 3300035171 Bacteria 906
440 Ga0373931_0115979 3300035691 Bacteria 1525
441 Ga0373927_0109131 3300035695 Bacteria 1803
442 Ga0373927_0356587 3300035695 Bacteria 964
443 Ga0373927_0387601 3300035695 Bacteria 922
444 Ga0373927_0438726 3300035695 Bacteria 862
445 Ga0373947_0163686 3300035725 Bacteria 1440
446 Ga0373925_0108644 3300037068 Bacteria 2141
447 Ga0395905_0275517 3300037471 Bacteria 1568
448 Ga0395901_0179763 3300038443 Bacteria 2219
449 Ga0451853_2046610 3300041512 Bacteria 3440
450 Ga0466972_0004993 3300044658 Bacteria 6655
451 Ga0466964_0137563 3300044706 Bacteria 1119
452 Ga0466960_0022513 3300044901 Bacteria 2818
453 Ga0495629_0180725 3300046459 Bacteria 1462
454 Ga0495638_0016005 3300046460 Bacteria 5026
455 Ga0495641_0053386 3300046461 Bacteria 1839
456 Ga0495596_0063481 3300046500 Bacteria 1437
457 Ga0495610_0117712 3300046512 Bacteria 1169
458 Ga0495616_0152898 3300046513 Bacteria 1043
459 Ga0495620_0036638 3300046515 Bacteria 2193
460 Ga0495631_0150217 3300046518 Bacteria 1000
461 Ga0495632_0197736 3300046519 Bacteria 917
462 Ga0495644_0091837 3300046523 Bacteria 1146
463 Ga0495644_0185582 3300046523 Bacteria 800
464 Ga0495666_0070668 3300046526 Bacteria 1660
465 Ga0495665_0063420 3300046531 Bacteria 1951
466 Ga0495597_0061929 3300046542 Bacteria 1629
467 Ga0495667_0223745 3300046559 Bacteria 1201
468 Ga0495656_0047402 3300046615 Bacteria 1822
469 Ga0495656_0438943 3300046615 Bacteria 687
470 Ga0495668_0085690 3300046616 Bacteria 1728
471 Ga0495668_0366996 3300046616 Bacteria 790
472 Ga0495611_0052079 3300046648 Bacteria 1846
473 Ga0495625_0056559 3300046660 Bacteria 2792
474 Ga0495625_0224173 3300046660 Bacteria 1230
475 Ga0495625_0498127 3300046660 Bacteria 745
476 Ga0495659_0136332 3300046664 Bacteria 977
477 Ga0495588_0350488 3300046674 Bacteria 776
478 Ga0495658_0113870 3300046683 Bacteria 1629
479 Ga0495669_0005641 3300046684 Bacteria 5223
480 Ga0495671_0213053 3300046692 Bacteria 936
481 Ga0495589_0098065 3300046794 Bacteria 1419
482 Ga0495600_0291532 3300046809 Bacteria 1031
483 Ga0495581_0233647 3300047315 Bacteria 1075
484 Ga0495581_0372224 3300047315 Bacteria 834
485 Ga0495604_0266595 3300047317 Bacteria 1162
486 Ga0495672_0044480 3300047320 Bacteria 2664
487 Ga0495672_0161760 3300047320 Bacteria 1150
488 Ga0495672_0424622 3300047320 Unclassified 604
489 Ga0495676_0316765 3300047321 Bacteria 1049
490 Ga0495677_0026762 3300047445 Bacteria 2092
491 Ga0495673_0069300 3300047469 Bacteria 1488
492 Ga0495673_0081312 3300047469 Bacteria 1342
493 Ga0495686_0082561 3300047472 Bacteria 1961
494 Ga0496101_0046223 3300048904 Bacteria 3121
495 Ga0496101_0337427 3300048904 Bacteria 1183
496 Ga0496101_0839939 3300048904 Bacteria 724
497 Ga0496102_0001939 3300048905 Bacteria 17821
498 Ga0496102_0065140 3300048905 Bacteria 3339
499 Ga0496102_0138363 3300048905 Bacteria 2282
500 Ga0496102_0414688 3300048905 Bacteria 1265
501 Ga0496102_0425365 3300048905 Bacteria 1247
502 Ga0496102_0955953 3300048905 Unclassified 778
503 Ga0496103_0069107 3300048906 Bacteria 2208
504 Ga0496103_0080902 3300048906 Bacteria 2043
505 Ga0496104_0024496 3300048907 Bacteria 5551
506 Ga0496104_0162292 3300048907 Bacteria 2143
507 Ga0496104_0359048 3300048907 Bacteria 1369
508 Ga0496104_0495658 3300048907 Bacteria 1133
509 Ga0496105_0021155 3300048908 Bacteria 5261
510 Ga0496105_0090827 3300048908 Bacteria 2522
511 Ga0496105_0295772 3300048908 Bacteria 1303
512 Ga0496106_0056755 3300048909 Bacteria 2960
513 Ga0496106_0345717 3300048909 Bacteria 1195
514 Ga0496106_0461435 3300048909 Bacteria 1020
515 Ga0496107_0025842 3300048910 Bacteria 4160
516 Ga0496107_0088214 3300048910 Bacteria 2265
517 Ga0496107_0248037 3300048910 Bacteria 1325
518 Ga0496108_0031097 3300048911 Bacteria 4427
519 Ga0496108_0035103 3300048911 Bacteria 4167
520 Ga0496108_0141781 3300048911 Bacteria 2071
521 Ga0496108_0572521 3300048911 Bacteria 985
522 Ga0496109_0107186 3300048912 Bacteria 2595
523 Ga0496109_0122327 3300048912 Bacteria 2425
524 Ga0496109_0661493 3300048912 Bacteria 982
525 Ga0496110_0028344 3300048913 Bacteria 4809
526 Ga0496110_0119295 3300048913 Bacteria 2376
527 Ga0496110_0130483 3300048913 Bacteria 2269
528 Ga0496111_0179222 3300048914 Bacteria 1575
529 Ga0496111_0181419 3300048914 Bacteria 1565
530 Ga0496111_0189917 3300048914 Bacteria 1527
531 Ga0496112_0027948 3300048915 Bacteria 5441
532 Ga0496112_0187957 3300048915 Bacteria 2029
533 Ga0496113_0047378 3300048916 Bacteria 3194
534 Ga0496113_0050393 3300048916 Bacteria 3104
535 Ga0496113_0908895 3300048916 Unclassified 696
536 Ga0496114_0109518 3300048917 Bacteria 2365
537 Ga0496114_0365864 3300048917 Bacteria 1276
538 Ga0496114_0578663 3300048917 Bacteria 991
539 Ga0496114_1173410 3300048917 Bacteria 654
540 Ga0496115_0000422 3300048918 Bacteria 34614
541 Ga0496115_0100362 3300048918 Bacteria 2373
542 Ga0496115_0536623 3300048918 Bacteria 936
543 Ga0496121_0000214 3300048924 Bacteria 127349
544 Ga0496121_0074968 3300048924 Bacteria 2704
545 Ga0496121_0111691 3300048924 Bacteria 2083
546 Ga0496125_0160215 3300048928 Bacteria 1530
547 Ga0496126_0029624 3300048929 Bacteria 5198
548 Ga0496126_0053231 3300048929 Bacteria 3673
549 Ga0496126_0062434 3300048929 Bacteria 3343
550 Ga0496126_0285606 3300048929 Bacteria 1366
551 Ga0495682_0136717 3300049460 Bacteria 876
552 Ga0501067_0175692 3300049583 Bacteria 1193
553 Ga0501071_0117133 3300049587 Bacteria 1972
554 nmdc:mga03n38_182606_c1 3300050490 Bacteria 1076
555 nmdc:mga03n38_245955_c1 3300050490 Bacteria 943
556 nmdc:mga03n38_290332_c1 3300050490 Bacteria 875
557 nmdc:mga03n38_61415_c1 3300050490 Bacteria 1711
558 nmdc:mga00v17_48296_c1 3300050491 Bacteria 2579
559 nmdc:mga00v17_81879_c1 3300050491 Bacteria 2017
560 nmdc:mga0yw44_117199_c1 3300050492 Bacteria 1712
561 nmdc:mga0yw44_144353_c1 3300050492 Bacteria 1549
562 nmdc:mga0yw44_41893_c1 3300050492 Bacteria 1977
563 nmdc:mga0yw44_501039_c1 3300050492 Bacteria 824
564 nmdc:mga0k408_119032_c1 3300050493 Bacteria 1563
565 nmdc:mga0k408_158460_c1 3300050493 Bacteria 1348
566 nmdc:mga0k408_97380_c1 3300050493 Bacteria 1732
567 nmdc:mga06z11_16904_c1 3300050494 Bacteria 3298
568 nmdc:mga06z11_27540_c1 3300050494 Bacteria 2717
569 nmdc:mga06z11_409540_c1 3300050494 Bacteria 817
570 nmdc:mga06z11_426866_c1 3300050494 Bacteria 799
571 nmdc:mga04h51_10656_c1 3300050495 Bacteria 2530
572 nmdc:mga07m45_104853_c1 3300050496 Bacteria 1626
573 nmdc:mga07m45_14191_c1 3300050496 Bacteria 4238
574 nmdc:mga08y16_190837_c1 3300050511 Bacteria 2125
575 nmdc:mga0n895_103107_c1 3300050512 Bacteria 2864
576 nmdc:mga0n895_1441623_c1 3300050512 Bacteria 656
577 nmdc:mga0n895_167091_c1 3300050512 Bacteria 2232
578 nmdc:mga0rr50_79239_c1 3300050513 Bacteria 2529
579 nmdc:mga0a205_291786_c1 3300050515 Bacteria 1505
580 nmdc:mga0sz30_217479_c1 3300050516 Unclassified 849
581 nmdc:mga0sz30_47966_c1 3300050516 Bacteria 1806
582 Ga0495595_0191846 3300053084 Bacteria 1016
583 Ga0500578_0594892 3300053086 Bacteria 609
584 Ga0500643_000058 3300053087 Bacteria 130051
585 Ga0500641_0000956 3300053096 Bacteria 10286
586 Ga0500641_0006010 3300053096 Bacteria 4296
587 Ga0500650_0308924 3300053098 Bacteria 698
588 Ga0500555_004058 3300053103 Bacteria 4162
589 Ga0500556_0003194 3300053104 Bacteria 4883
590 Ga0500562_031276 3300053108 Unclassified 1404
591 Ga0500562_051932 3300053108 Bacteria 1097
592 Ga0500569_001603 3300053109 Bacteria 4294
593 Ga0500595_006714 3300053119 Bacteria 4852
594 Ga0500658_0253378 3300053134 Bacteria 809
595 Ga0500577_0197621 3300053142 Bacteria 867
596 Ga0500588_0009676 3300053146 Bacteria 2301
597 Ga0500589_017471 3300053147 Bacteria 3231
598 Ga0500616_0005330 3300053153 Bacteria 8765
599 Ga0500620_009594 3300053155 Bacteria 2506
600 Ga0500622_0007353 3300053156 Bacteria 6264
601 Ga0500645_023962 3300053730 Bacteria 1868
602 Ga0500599_004318 3300053736 Bacteria 1757

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025972 Ga0207668_10473732 Ga0207668_104737322 161
2 3300026067 Ga0207678_10393568 Ga0207678_103935682 166
3 3300046615 Ga0495656_0438943 Ga0495656_0438943_81_602 173
4 3300035691 Ga0373931_0115979 Ga0373931_0115979_65_589 174
5 3300035695 Ga0373927_0109131 Ga0373927_0109131_28_555 174
6 3300046660 Ga0495625_0224173 Ga0495625_0224173_55_582 174
7 3300046674 Ga0495588_0350488 Ga0495588_0350488_217_744 174
8 3300046809 Ga0495600_0291532 Ga0495600_0291532_80_604 174
9 3300048904 Ga0496101_0839939 Ga0496101_0839939_61_585 174
10 3300048910 Ga0496107_0248037 Ga0496107_0248037_53_577 174
11 iso_pu_bacteria 2824609381 2824611793 178
12 iso_pu_bacteria 2824653114 2824655029 178
13 iso_pu_bacteria 2922361189 2922366213 179
14 3300005337 Ga0070682_100030872 Ga0070682_1000308722 180
15 3300005338 Ga0068868_100002640 Ga0068868_1000026407 180
16 3300005344 Ga0070661_100075348 Ga0070661_1000753483 180
17 3300005347 Ga0070668_100474916 Ga0070668_1004749162 180
18 3300005354 Ga0070675_100260644 Ga0070675_1002606442 180
19 3300005364 Ga0070673_100081240 Ga0070673_1000812403 180
20 3300005437 Ga0070710_10351926 Ga0070710_103519262 180
21 3300005455 Ga0070663_100033325 Ga0070663_1000333253 180
22 3300005459 Ga0068867_100153275 Ga0068867_1001532752 180
23 3300005543 Ga0070672_100186388 Ga0070672_1001863882 180
24 3300005548 Ga0070665_100079071 Ga0070665_1000790713 180
25 3300005564 Ga0070664_100037752 Ga0070664_1000377523 180
26 3300006358 Ga0068871_100053388 Ga0068871_1000533885 180
27 3300006881 Ga0068865_100026281 Ga0068865_1000262813 180
28 3300009098 Ga0105245_10194066 Ga0105245_101940662 180
29 3300009176 Ga0105242_10059491 Ga0105242_100594914 180
30 3300010375 Ga0105239_10038676 Ga0105239_100386762 180
31 3300013296 Ga0157374_10015082 Ga0157374_100150822 180
32 3300013306 Ga0163162_10013299 Ga0163162_100132995 180
33 3300014969 Ga0157376_10062862 Ga0157376_100628623 180
34 3300017792 Ga0163161_10277091 Ga0163161_102770912 180
35 3300025315 Ga0207697_10119652 Ga0207697_101196522 180
36 3300025901 Ga0207688_10180408 Ga0207688_101804081 180
37 3300025926 Ga0207659_10310545 Ga0207659_103105452 180
38 3300025927 Ga0207687_10052096 Ga0207687_100520963 180
39 3300025931 Ga0207644_10268448 Ga0207644_102684481 180
40 3300025940 Ga0207691_10073734 Ga0207691_100737342 180
41 3300026067 Ga0207678_10011829 Ga0207678_100118296 180
42 3300041512 Ga0451853_2046610 Ga0451853_2046610_2021_2563 180
43 3300048904 Ga0496101_0046223 Ga0496101_0046223_610_1152 180
44 3300048905 Ga0496102_0001939 Ga0496102_0001939_4072_4614 180
45 3300048906 Ga0496103_0080902 Ga0496103_0080902_735_1277 180
46 3300048907 Ga0496104_0024496 Ga0496104_0024496_3427_3969 180
47 3300048908 Ga0496105_0021155 Ga0496105_0021155_2475_3017 180
48 3300048909 Ga0496106_0056755 Ga0496106_0056755_779_1321 180
49 3300048910 Ga0496107_0025842 Ga0496107_0025842_2680_3222 180
50 3300048913 Ga0496110_0028344 Ga0496110_0028344_623_1165 180
51 3300048915 Ga0496112_0027948 Ga0496112_0027948_2245_2787 180
52 3300048918 Ga0496115_0000422 Ga0496115_0000422_22991_23533 180
53 3300013297 Ga0157378_10034431 Ga0157378_100344313 181
54 3300014325 Ga0163163_10539807 Ga0163163_105398072 181
55 3300025945 Ga0207679_10048458 Ga0207679_100484582 181
56 3300047320 Ga0495672_0424622 Ga0495672_0424622_45_590 181
57 3300047469 Ga0495673_0081312 Ga0495673_0081312_415_960 181
58 3300048911 Ga0496108_0035103 Ga0496108_0035103_2042_2587 181
59 3300048912 Ga0496109_0107186 Ga0496109_0107186_286_831 181
60 3300048916 Ga0496113_0047378 Ga0496113_0047378_1857_2402 181
61 iso_pu_bacteria 2904690495 2904691648 181
62 iso_pu_bacteria 2908756301 2908763734 181
63 3300046513 Ga0495616_0152898 Ga0495616_0152898_429_980 183
64 3300046523 Ga0495644_0091837 Ga0495644_0091837_34_585 183
65 3300048916 Ga0496113_0908895 Ga0496113_0908895_63_614 183
66 3300048917 Ga0496114_0578663 Ga0496114_0578663_41_592 183
67 3300048917 Ga0496114_1173410 Ga0496114_1173410_78_629 183
68 3300050512 nmdc:mga0n895_1441623_c1 nmdc:mga0n895_1441623_c1_20_571 183
69 3300053084 Ga0495595_0191846 Ga0495595_0191846_352_909 185
70 3300025294 Ga0209025_1055542 Ga0209025_10555422 186
71 3300005455 Ga0070663_100339823 Ga0070663_1003398232 187
72 3300028379 Ga0268266_10375620 Ga0268266_103756202 187
73 3300010375 Ga0105239_11021427 Ga0105239_110214272 188
74 3300005578 Ga0068854_100162464 Ga0068854_1001624643 189
75 3300006163 Ga0070715_10292425 Ga0070715_102924251 189
76 3300053086 Ga0500578_0594892 Ga0500578_0594892_24_596 190
77 3300053156 Ga0500622_0007353 Ga0500622_0007353_5675_6247 190
78 3300005331 Ga0070670_100080989 Ga0070670_1000809893 191
79 3300005334 Ga0068869_100070955 Ga0068869_1000709553 191
80 3300005336 Ga0070680_100710243 Ga0070680_1007102432 191
81 3300005344 Ga0070661_100119690 Ga0070661_1001196903 191
82 3300005347 Ga0070668_100016139 Ga0070668_1000161394 191
83 3300005353 Ga0070669_100319674 Ga0070669_1003196742 191
84 3300005354 Ga0070675_100152255 Ga0070675_1001522551 191
85 3300005355 Ga0070671_100013730 Ga0070671_1000137302 191
86 3300005366 Ga0070659_100126673 Ga0070659_1001266733 191
87 3300005455 Ga0070663_100011200 Ga0070663_1000112003 191
88 3300005457 Ga0070662_100041247 Ga0070662_1000412472 191
89 3300005539 Ga0068853_100136426 Ga0068853_1001364261 191
90 3300005543 Ga0070672_100123736 Ga0070672_1001237362 191
91 3300005544 Ga0070686_100356323 Ga0070686_1003563232 191
92 3300005546 Ga0070696_100139962 Ga0070696_1001399622 191
93 3300005547 Ga0070693_100328556 Ga0070693_1003285562 191
94 3300005548 Ga0070665_100012477 Ga0070665_1000124775 191
95 3300005563 Ga0068855_100145101 Ga0068855_1001451013 191
96 3300005577 Ga0068857_100082333 Ga0068857_1000823333 191
97 3300005614 Ga0068856_100109763 Ga0068856_1001097632 191
98 3300005615 Ga0070702_100017245 Ga0070702_1000172453 191
99 3300005616 Ga0068852_100036443 Ga0068852_1000364432 191
100 3300005617 Ga0068859_100038727 Ga0068859_1000387274 191
101 3300005618 Ga0068864_100022449 Ga0068864_1000224494 191
102 3300005719 Ga0068861_100011149 Ga0068861_1000111494 191
103 3300005840 Ga0068870_10014095 Ga0068870_100140954 191
104 3300005841 Ga0068863_100024757 Ga0068863_1000247575 191
105 3300005842 Ga0068858_100162906 Ga0068858_1001629062 191
106 3300005843 Ga0068860_100133926 Ga0068860_1001339262 191
107 3300005844 Ga0068862_100052693 Ga0068862_1000526932 191
108 3300006048 Ga0075363_100011979 Ga0075363_1000119794 191
109 3300006051 Ga0075364_10030478 Ga0075364_100304784 191
110 3300006186 Ga0075369_10021586 Ga0075369_100215862 191
111 3300006237 Ga0097621_100015958 Ga0097621_1000159587 191
112 3300006353 Ga0075370_10072218 Ga0075370_100722182 191
113 3300006852 Ga0075433_10332678 Ga0075433_103326782 191
114 3300006881 Ga0068865_100089001 Ga0068865_1000890013 191
115 3300006931 Ga0097620_100038730 Ga0097620_1000387304 191
116 3300009093 Ga0105240_10247035 Ga0105240_102470352 191
117 3300009094 Ga0111539_11197047 Ga0111539_111970471 191
118 3300009098 Ga0105245_10043059 Ga0105245_100430593 191
119 3300009101 Ga0105247_10034503 Ga0105247_100345033 191
120 3300009148 Ga0105243_10177477 Ga0105243_101774772 191
121 3300009174 Ga0105241_10012171 Ga0105241_100121715 191
122 3300009177 Ga0105248_10010641 Ga0105248_1001064111 191
123 3300009545 Ga0105237_10062317 Ga0105237_100623173 191
124 3300009551 Ga0105238_10025189 Ga0105238_100251895 191
125 3300011119 Ga0105246_10019408 Ga0105246_100194083 191
126 3300013296 Ga0157374_10073303 Ga0157374_100733033 191
127 3300013306 Ga0163162_10830600 Ga0163162_108306002 191
128 3300014325 Ga0163163_10021051 Ga0163163_100210517 191
129 3300014968 Ga0157379_10112244 Ga0157379_101122443 191
130 3300014969 Ga0157376_10243096 Ga0157376_102430962 191
131 3300025900 Ga0207710_10022382 Ga0207710_100223823 191
132 3300025901 Ga0207688_10009511 Ga0207688_100095115 191
133 3300025904 Ga0207647_10086574 Ga0207647_100865742 191
134 3300025908 Ga0207643_10042602 Ga0207643_100426022 191
135 3300025913 Ga0207695_10450562 Ga0207695_104505622 191
136 3300025914 Ga0207671_10006919 Ga0207671_100069194 191
137 3300025924 Ga0207694_10772142 Ga0207694_107721422 191
138 3300025925 Ga0207650_10059961 Ga0207650_100599613 191
139 3300025927 Ga0207687_10111332 Ga0207687_101113322 191
140 3300025933 Ga0207706_10036435 Ga0207706_100364353 191
141 3300025938 Ga0207704_10036623 Ga0207704_100366233 191
142 3300025941 Ga0207711_10046563 Ga0207711_100465634 191
143 3300025942 Ga0207689_10021863 Ga0207689_100218633 191
144 3300025945 Ga0207679_10145791 Ga0207679_101457912 191
145 3300025949 Ga0207667_10087440 Ga0207667_100874404 191
146 3300025972 Ga0207668_10011873 Ga0207668_100118734 191
147 3300026023 Ga0207677_10156196 Ga0207677_101561963 191
148 3300026041 Ga0207639_10186586 Ga0207639_101865861 191
149 3300026067 Ga0207678_10017970 Ga0207678_100179705 191
150 3300026078 Ga0207702_10086059 Ga0207702_100860592 191
151 3300026088 Ga0207641_11245833 Ga0207641_112458331 191
152 3300026116 Ga0207674_10119773 Ga0207674_101197733 191
153 3300026118 Ga0207675_100024265 Ga0207675_1000242654 191
154 3300026142 Ga0207698_10598959 Ga0207698_105989592 191
155 3300027866 Ga0209813_10004746 Ga0209813_100047462 191
156 3300048905 Ga0496102_0065140 Ga0496102_0065140_1193_1825 191
157 3300048910 Ga0496107_0088214 Ga0496107_0088214_1252_1884 191
158 3300048911 Ga0496108_0031097 Ga0496108_0031097_1734_2366 191
159 3300048914 Ga0496111_0179222 Ga0496111_0179222_467_1099 191
160 3300048924 Ga0496121_0111691 Ga0496121_0111691_1412_2044 191
161 3300048928 Ga0496125_0160215 Ga0496125_0160215_390_1022 191
162 3300048929 Ga0496126_0062434 Ga0496126_0062434_1841_2473 191
163 3300049583 Ga0501067_0175692 Ga0501067_0175692_166_741 191
164 3300050494 nmdc:mga06z11_409540_c1 nmdc:mga06z11_409540_c1_37_669 191
165 3300050495 nmdc:mga04h51_10656_c1 nmdc:mga04h51_10656_c1_1768_2400 191
166 3300050496 nmdc:mga07m45_104853_c1 nmdc:mga07m45_104853_c1_40_672 191
167 3300050512 nmdc:mga0n895_167091_c1 nmdc:mga0n895_167091_c1_1334_1966 191
168 3300050515 nmdc:mga0a205_291786_c1 nmdc:mga0a205_291786_c1_733_1365 191
169 iso_pu_bacteria 2885383462 2885387168 192
170 3300009094 Ga0111539_10291568 Ga0111539_102915682 193
171 3300026118 Ga0207675_100319449 Ga0207675_1003194492 193
172 3300027907 Ga0207428_10116806 Ga0207428_101168062 193
173 3300050511 nmdc:mga08y16_190837_c1 nmdc:mga08y16_190837_c1_1039_1671 193
174 3300009094 Ga0111539_10698901 Ga0111539_106989012 194
175 3300010375 Ga0105239_10000778 Ga0105239_1000077821 196
176 3300038443 Ga0395901_0179763 Ga0395901_0179763_851_1480 197
177 3300048908 Ga0496105_0295772 Ga0496105_0295772_571_1164 197
178 3300005334 Ga0068869_100272433 Ga0068869_1002724332 198
179 3300005356 Ga0070674_100366756 Ga0070674_1003667562 198
180 3300005548 Ga0070665_100377182 Ga0070665_1003771822 198
181 3300005718 Ga0068866_10119239 Ga0068866_101192392 198
182 3300005719 Ga0068861_100735825 Ga0068861_1007358251 198
183 3300005843 Ga0068860_100247061 Ga0068860_1002470612 198
184 3300014969 Ga0157376_10513778 Ga0157376_105137782 198
185 3300025899 Ga0207642_10076826 Ga0207642_100768262 198
186 3300025931 Ga0207644_10284676 Ga0207644_102846762 198
187 3300025937 Ga0207669_10123134 Ga0207669_101231341 198
188 3300025942 Ga0207689_10216795 Ga0207689_102167952 198
189 3300028379 Ga0268266_10419102 Ga0268266_104191022 198
190 3300025940 Ga0207691_10135105 Ga0207691_101351053 199
191 iso_pu_bacteria 2922386360 2922386716 199
192 3300009551 Ga0105238_10124257 Ga0105238_101242573 200
193 3300047315 Ga0495581_0372224 Ga0495581_0372224_14_616 200
194 iso_pu_bacteria 2824773399 2824776665 201
195 3300005338 Ga0068868_100648905 Ga0068868_1006489051 202
196 3300005356 Ga0070674_100287602 Ga0070674_1002876022 202
197 3300005367 Ga0070667_100785051 Ga0070667_1007850511 202
198 3300005719 Ga0068861_100105212 Ga0068861_1001052124 202
199 3300006881 Ga0068865_100091319 Ga0068865_1000913193 202
200 3300009098 Ga0105245_10903266 Ga0105245_109032661 202
201 3300013306 Ga0163162_10066991 Ga0163162_100669915 202
202 3300025933 Ga0207706_10169767 Ga0207706_101697672 202
203 3300025935 Ga0207709_10050861 Ga0207709_100508613 202
204 3300025937 Ga0207669_10242644 Ga0207669_102426442 202
205 3300026023 Ga0207677_10337662 Ga0207677_103376622 202
206 3300026118 Ga0207675_100017302 Ga0207675_1000173022 202
207 3300026121 Ga0207683_10498581 Ga0207683_104985812 202
208 3300035695 Ga0373927_0438726 Ga0373927_0438726_76_702 202
209 3300046526 Ga0495666_0070668 Ga0495666_0070668_762_1388 202
210 3300013308 Ga0157375_11242775 Ga0157375_112427751 203
211 3300028379 Ga0268266_10221468 Ga0268266_102214682 203
212 3300048912 Ga0496109_0661493 Ga0496109_0661493_144_797 203
213 iso_pu_bacteria 8006964411 8006966090 203
214 iso_pu_bacteria 8056673599 8056678798 203
215 3300026067 Ga0207678_10160149 Ga0207678_101601492 204
216 3300047320 Ga0495672_0044480 Ga0495672_0044480_1031_1645 204
217 iso_pu_bacteria 2513237101 2513692951 204
218 iso_pu_bacteria 2524023210 2524467105 204
219 iso_pu_bacteria 2889033259 2889033415 204
220 iso_pu_bacteria 8006994254 8006997262 204
221 3300003659 JGI25404J52841_10000073 JGI25404J52841_100000738 205
222 3300005356 Ga0070674_100426826 Ga0070674_1004268262 205
223 3300005983 Ga0081540_1003974 Ga0081540_10039746 205
224 3300013306 Ga0163162_10371334 Ga0163162_103713342 205
225 3300025940 Ga0207691_10129284 Ga0207691_101292842 205
226 3300026067 Ga0207678_10060310 Ga0207678_100603102 205
227 3300026095 Ga0207676_10468673 Ga0207676_104686731 205
228 3300049587 Ga0501071_0117133 Ga0501071_0117133_1147_1764 205
229 iso_pu_bacteria 2513237098 2513672782 205
230 iso_pu_bacteria 2513237139 2513878345 205
231 iso_pu_bacteria 2513237161 2514011727 205
232 iso_pu_bacteria 2617270735 2617352729 205
233 iso_pu_bacteria 2617270741 2617372927 205
234 iso_pu_bacteria 2802429603 2805920568 205
235 iso_pu_bacteria 2824671348 2824672311 205
236 iso_pu_bacteria 2824679649 2824682281 205
237 iso_pu_bacteria 2824687955 2824688806 205
238 iso_pu_bacteria 2824696289 2824702184 205
239 iso_pu_bacteria 2824732956 2824737670 205
240 iso_pu_bacteria 2824746037 2824752452 205
241 iso_pu_bacteria 2838122688 2838127387 205
242 iso_pu_bacteria 2841941048 2841946406 205
243 iso_pu_bacteria 2841949485 2841957124 205
244 iso_pu_bacteria 2841966195 2841972916 205
245 iso_pu_bacteria 2841974524 2841978412 205
246 iso_pu_bacteria 2841983080 2841987486 205
247 iso_pu_bacteria 2847930680 2847937527 205
248 iso_pu_bacteria 2847939898 2847947949 205
249 iso_pu_bacteria 2874612657 2874616772 205
250 iso_pu_bacteria 2874620515 2874628277 205
251 iso_pu_bacteria 2879083081 2879084940 205
252 iso_pu_bacteria 2881364244 2881370104 205
253 iso_pu_bacteria 2881665667 2881670106 205
254 iso_pu_bacteria 2885366525 2885370164 205
255 iso_pu_bacteria 2903768456 2903775401 205
256 iso_pu_bacteria 2904666416 2904674104 205
257 iso_pu_bacteria 2906643746 2906645519 205
258 iso_pu_bacteria 2908775508 2908781376 205
259 iso_pu_bacteria 2922393267 2922396873 205
260 iso_pu_bacteria 2935769743 2935772777 205
261 iso_pu_bacteria 2935777560 2935778086 205
262 iso_pu_bacteria 2935785616 2935787314 205
263 iso_pu_bacteria 2935793552 2935795898 205
264 iso_pu_bacteria 8016522445 8016526603 205
265 iso_pu_bacteria 8016530956 8016531689 205
266 iso_pu_bacteria 8016539877 8016544886 205
267 iso_pu_bacteria 8016548790 8016557190 205
268 iso_pu_bacteria 8016557553 8016565541 205
269 iso_pu_bacteria 8016566248 8016569957 205
270 iso_pu_bacteria 8016575299 8016582536 205
271 iso_pu_bacteria 8016595262 8016603160 205
272 iso_pu_bacteria 8016603502 8016606077 205
273 iso_pu_bacteria 8016613128 8016617959 205
274 iso_pu_bacteria 8016622563 8016623613 205
275 iso_pu_bacteria 8019538911 8019540022 205
276 iso_pu_bacteria 8019547302 8019550634 205
277 iso_pu_bacteria 8056681323 8056689056 205
278 3300005439 Ga0070711_100348999 Ga0070711_1003489992 206
279 3300005456 Ga0070678_100648841 Ga0070678_1006488411 206
280 3300005545 Ga0070695_100378451 Ga0070695_1003784511 206
281 3300005718 Ga0068866_10135098 Ga0068866_101350982 206
282 3300006175 Ga0070712_100394774 Ga0070712_1003947742 206
283 3300006358 Ga0068871_100849827 Ga0068871_1008498272 206
284 3300013308 Ga0157375_11628512 Ga0157375_116285122 206
285 3300025915 Ga0207693_10370041 Ga0207693_103700411 206
286 3300026121 Ga0207683_10067081 Ga0207683_100670812 206
287 3300048905 Ga0496102_0425365 Ga0496102_0425365_261_881 206
288 3300048907 Ga0496104_0359048 Ga0496104_0359048_736_1356 206
289 3300048909 Ga0496106_0461435 Ga0496106_0461435_42_662 206
290 3300048918 Ga0496115_0536623 Ga0496115_0536623_257_877 206
291 3300005330 Ga0070690_100384318 Ga0070690_1003843181 207
292 3300005347 Ga0070668_100084085 Ga0070668_1000840852 207
293 3300005548 Ga0070665_100000907 Ga0070665_10000090721 207
294 3300005844 Ga0068862_101082315 Ga0068862_1010823152 207
295 3300005937 Ga0081455_10023565 Ga0081455_100235657 207
296 3300005981 Ga0081538_10018086 Ga0081538_100180866 207
297 3300006038 Ga0075365_10100784 Ga0075365_101007843 207
298 3300006178 Ga0075367_10027318 Ga0075367_100273183 207
299 3300006195 Ga0075366_10094557 Ga0075366_100945572 207
300 3300009174 Ga0105241_10252256 Ga0105241_102522562 207
301 3300009553 Ga0105249_10218823 Ga0105249_102188232 207
302 3300014326 Ga0157380_10122627 Ga0157380_101226273 207
303 3300025972 Ga0207668_10064080 Ga0207668_100640802 207
304 3300026075 Ga0207708_10179324 Ga0207708_101793242 207
305 3300028379 Ga0268266_10025774 Ga0268266_100257742 207
306 3300028786 Ga0307517_10324536 Ga0307517_103245362 207
307 3300031730 Ga0307516_10024698 Ga0307516_100246984 207
308 3300032126 Ga0307415_100037464 Ga0307415_1000374643 207
309 3300033180 Ga0307510_10028462 Ga0307510_100284622 207
310 3300044658 Ga0466972_0004993 Ga0466972_0004993_1935_2558 207
311 3300044901 Ga0466960_0022513 Ga0466960_0022513_408_1031 207
312 3300046460 Ga0495638_0016005 Ga0495638_0016005_3740_4363 207
313 3300046542 Ga0495597_0061929 Ga0495597_0061929_724_1350 207
314 3300046648 Ga0495611_0052079 Ga0495611_0052079_735_1358 207
315 3300046660 Ga0495625_0056559 Ga0495625_0056559_711_1334 207
316 3300047469 Ga0495673_0069300 Ga0495673_0069300_433_1056 207
317 3300048929 Ga0496126_0029624 Ga0496126_0029624_2619_3242 207
318 3300050492 nmdc:mga0yw44_41893_c1 nmdc:mga0yw44_41893_c1_211_834 207
319 3300050493 nmdc:mga0k408_97380_c1 nmdc:mga0k408_97380_c1_390_1013 207
320 3300050494 nmdc:mga06z11_16904_c1 nmdc:mga06z11_16904_c1_1017_1640 207
321 3300050496 nmdc:mga07m45_14191_c1 nmdc:mga07m45_14191_c1_2348_2971 207
322 3300050513 nmdc:mga0rr50_79239_c1 nmdc:mga0rr50_79239_c1_148_771 207
323 3300050516 nmdc:mga0sz30_217479_c1 nmdc:mga0sz30_217479_c1_151_774 207
324 3300053087 Ga0500643_000058 Ga0500643_000058_98040_98663 207
325 3300053098 Ga0500650_0308924 Ga0500650_0308924_33_656 207
326 3300053103 Ga0500555_004058 Ga0500555_004058_776_1399 207
327 3300053104 Ga0500556_0003194 Ga0500556_0003194_2754_3377 207
328 3300053108 Ga0500562_031276 Ga0500562_031276_419_1042 207
329 3300053108 Ga0500562_051932 Ga0500562_051932_162_785 207
330 3300053109 Ga0500569_001603 Ga0500569_001603_529_1152 207
331 3300053134 Ga0500658_0253378 Ga0500658_0253378_28_651 207
332 3300053142 Ga0500577_0197621 Ga0500577_0197621_140_763 207
333 3300053146 Ga0500588_0009676 Ga0500588_0009676_175_798 207
334 3300053153 Ga0500616_0005330 Ga0500616_0005330_2336_2959 207
335 3300053730 Ga0500645_023962 Ga0500645_023962_79_702 207
336 3300053736 Ga0500599_004318 Ga0500599_004318_355_978 207
337 3300002244 JGI24742J22300_10017981 JGI24742J22300_100179812 208
338 3300003659 JGI25404J52841_10018614 JGI25404J52841_100186142 208
339 3300005329 Ga0070683_100228272 Ga0070683_1002282722 208
340 3300005330 Ga0070690_100218738 Ga0070690_1002187382 208
341 3300005335 Ga0070666_10086780 Ga0070666_100867802 208
342 3300005337 Ga0070682_100732652 Ga0070682_1007326521 208
343 3300005338 Ga0068868_100430015 Ga0068868_1004300152 208
344 3300005340 Ga0070689_100480329 Ga0070689_1004803291 208
345 3300005341 Ga0070691_10218046 Ga0070691_102180462 208
346 3300005347 Ga0070668_100017881 Ga0070668_1000178815 208
347 3300005347 Ga0070668_100040249 Ga0070668_1000402492 208
348 3300005347 Ga0070668_100242384 Ga0070668_1002423842 208
349 3300005356 Ga0070674_100344533 Ga0070674_1003445331 208
350 3300005356 Ga0070674_100748366 Ga0070674_1007483661 208
351 3300005441 Ga0070700_100090789 Ga0070700_1000907892 208
352 3300005444 Ga0070694_100520767 Ga0070694_1005207672 208
353 3300005455 Ga0070663_100029062 Ga0070663_1000290624 208
354 3300005455 Ga0070663_100117018 Ga0070663_1001170183 208
355 3300005456 Ga0070678_100289729 Ga0070678_1002897292 208
356 3300005457 Ga0070662_100215243 Ga0070662_1002152432 208
357 3300005458 Ga0070681_10061902 Ga0070681_100619022 208
358 3300005459 Ga0068867_100090574 Ga0068867_1000905743 208
359 3300005459 Ga0068867_100152489 Ga0068867_1001524892 208
360 3300005539 Ga0068853_100446633 Ga0068853_1004466332 208
361 3300005544 Ga0070686_100123848 Ga0070686_1001238482 208
362 3300005544 Ga0070686_100193888 Ga0070686_1001938882 208
363 3300005718 Ga0068866_10031988 Ga0068866_100319882 208
364 3300005718 Ga0068866_10209068 Ga0068866_102090682 208
365 3300005719 Ga0068861_100082171 Ga0068861_1000821712 208
366 3300005719 Ga0068861_100724529 Ga0068861_1007245291 208
367 3300005842 Ga0068858_101134748 Ga0068858_1011347481 208
368 3300005843 Ga0068860_100369245 Ga0068860_1003692452 208
369 3300005843 Ga0068860_100497713 Ga0068860_1004977132 208
370 3300005844 Ga0068862_100061636 Ga0068862_1000616362 208
371 3300005983 Ga0081540_1006148 Ga0081540_10061485 208
372 3300005983 Ga0081540_1017945 Ga0081540_10179453 208
373 3300005983 Ga0081540_1027706 Ga0081540_10277063 208
374 3300005983 Ga0081540_1093100 Ga0081540_10931002 208
375 3300006163 Ga0070715_10043602 Ga0070715_100436022 208
376 3300006175 Ga0070712_100448735 Ga0070712_1004487351 208
377 3300006844 Ga0075428_100894342 Ga0075428_1008943422 208
378 3300006881 Ga0068865_100020402 Ga0068865_10002040210 208
379 3300006881 Ga0068865_100235837 Ga0068865_1002358373 208
380 3300006881 Ga0068865_100375056 Ga0068865_1003750562 208
381 3300007076 Ga0075435_100199905 Ga0075435_1001999052 208
382 3300009093 Ga0105240_10244052 Ga0105240_102440522 208
383 3300009098 Ga0105245_10052458 Ga0105245_100524583 208
384 3300009098 Ga0105245_10094116 Ga0105245_100941162 208
385 3300009176 Ga0105242_10180639 Ga0105242_101806392 208
386 3300009176 Ga0105242_10727310 Ga0105242_107273102 208
387 3300009545 Ga0105237_10013986 Ga0105237_100139866 208
388 3300009551 Ga0105238_10011512 Ga0105238_100115127 208
389 3300009553 Ga0105249_10114180 Ga0105249_101141802 208
390 3300009553 Ga0105249_10362195 Ga0105249_103621952 208
391 3300009553 Ga0105249_10374406 Ga0105249_103744062 208
392 3300010375 Ga0105239_10034155 Ga0105239_100341554 208
393 3300013105 Ga0157369_10447405 Ga0157369_104474052 208
394 3300013296 Ga0157374_10013084 Ga0157374_100130845 208
395 3300013297 Ga0157378_10123194 Ga0157378_101231943 208
396 3300013297 Ga0157378_10489770 Ga0157378_104897702 208
397 3300013306 Ga0163162_10113952 Ga0163162_101139523 208
398 3300013306 Ga0163162_10181916 Ga0163162_101819162 208
399 3300013306 Ga0163162_10661704 Ga0163162_106617042 208
400 3300014326 Ga0157380_10263149 Ga0157380_102631491 208
401 3300014326 Ga0157380_10373276 Ga0157380_103732762 208
402 3300014968 Ga0157379_10800050 Ga0157379_108000502 208
403 3300017792 Ga0163161_10076732 Ga0163161_100767323 208
404 3300025315 Ga0207697_10036024 Ga0207697_100360242 208
405 3300025899 Ga0207642_10066994 Ga0207642_100669942 208
406 3300025901 Ga0207688_10067356 Ga0207688_100673562 208
407 3300025903 Ga0207680_10046687 Ga0207680_100466873 208
408 3300025904 Ga0207647_10058272 Ga0207647_100582722 208
409 3300025905 Ga0207685_10079681 Ga0207685_100796812 208
410 3300025907 Ga0207645_10232386 Ga0207645_102323861 208
411 3300025912 Ga0207707_10066037 Ga0207707_100660372 208
412 3300025915 Ga0207693_10541507 Ga0207693_105415072 208
413 3300025919 Ga0207657_10120755 Ga0207657_101207552 208
414 3300025923 Ga0207681_10564651 Ga0207681_105646512 208
415 3300025924 Ga0207694_10058814 Ga0207694_100588142 208
416 3300025927 Ga0207687_10067996 Ga0207687_100679963 208
417 3300025931 Ga0207644_10341011 Ga0207644_103410112 208
418 3300025932 Ga0207690_10065385 Ga0207690_100653853 208
419 3300025933 Ga0207706_10076849 Ga0207706_100768493 208
420 3300025935 Ga0207709_10082288 Ga0207709_100822882 208
421 3300025936 Ga0207670_10248416 Ga0207670_102484162 208
422 3300025937 Ga0207669_10634325 Ga0207669_106343252 208
423 3300025937 Ga0207669_10793316 Ga0207669_107933161 208
424 3300025938 Ga0207704_10239061 Ga0207704_102390612 208
425 3300025939 Ga0207665_10126279 Ga0207665_101262792 208
426 3300025940 Ga0207691_10256745 Ga0207691_102567452 208
427 3300025940 Ga0207691_10542449 Ga0207691_105424492 208
428 3300025944 Ga0207661_10168564 Ga0207661_101685642 208
429 3300025961 Ga0207712_10013111 Ga0207712_100131114 208
430 3300025972 Ga0207668_10002442 Ga0207668_100024424 208
431 3300025972 Ga0207668_10090856 Ga0207668_100908562 208
432 3300025972 Ga0207668_10230060 Ga0207668_102300601 208
433 3300025972 Ga0207668_10387988 Ga0207668_103879882 208
434 3300026035 Ga0207703_10712024 Ga0207703_107120241 208
435 3300026067 Ga0207678_10030402 Ga0207678_100304026 208
436 3300026067 Ga0207678_10063112 Ga0207678_100631123 208
437 3300026075 Ga0207708_10042169 Ga0207708_100421692 208
438 3300026075 Ga0207708_10082714 Ga0207708_100827143 208
439 3300026089 Ga0207648_10215168 Ga0207648_102151682 208
440 3300026089 Ga0207648_10441599 Ga0207648_104415992 208
441 3300026118 Ga0207675_100039743 Ga0207675_1000397432 208
442 3300026118 Ga0207675_100491665 Ga0207675_1004916652 208
443 3300026121 Ga0207683_10053206 Ga0207683_100532063 208
444 3300026121 Ga0207683_10493321 Ga0207683_104933212 208
445 3300028379 Ga0268266_10261490 Ga0268266_102614902 208
446 3300028380 Ga0268265_10055689 Ga0268265_100556892 208
447 3300028381 Ga0268264_10446182 Ga0268264_104461822 208
448 3300028794 Ga0307515_10516873 Ga0307515_105168731 208
449 3300031730 Ga0307516_10005450 Ga0307516_100054507 208
450 3300031730 Ga0307516_10015280 Ga0307516_100152805 208
451 3300033180 Ga0307510_10168552 Ga0307510_101685522 208
452 3300035111 Ga0373923_0234594 Ga0373923_0234594_65_691 208
453 3300035171 Ga0373946_0135808 Ga0373946_0135808_329_955 208
454 3300035695 Ga0373927_0356587 Ga0373927_0356587_89_715 208
455 3300035695 Ga0373927_0387601 Ga0373927_0387601_194_820 208
456 3300035725 Ga0373947_0163686 Ga0373947_0163686_614_1240 208
457 3300037471 Ga0395905_0275517 Ga0395905_0275517_277_918 208
458 3300044706 Ga0466964_0137563 Ga0466964_0137563_444_1070 208
459 3300046461 Ga0495641_0053386 Ga0495641_0053386_162_788 208
460 3300046500 Ga0495596_0063481 Ga0495596_0063481_688_1314 208
461 3300046512 Ga0495610_0117712 Ga0495610_0117712_330_983 208
462 3300046515 Ga0495620_0036638 Ga0495620_0036638_823_1488 208
463 3300046518 Ga0495631_0150217 Ga0495631_0150217_303_929 208
464 3300046519 Ga0495632_0197736 Ga0495632_0197736_203_829 208
465 3300046523 Ga0495644_0185582 Ga0495644_0185582_99_764 208
466 3300046615 Ga0495656_0047402 Ga0495656_0047402_584_1210 208
467 3300046616 Ga0495668_0085690 Ga0495668_0085690_418_1044 208
468 3300046616 Ga0495668_0366996 Ga0495668_0366996_41_706 208
469 3300046660 Ga0495625_0498127 Ga0495625_0498127_58_684 208
470 3300046684 Ga0495669_0005641 Ga0495669_0005641_790_1416 208
471 3300046692 Ga0495671_0213053 Ga0495671_0213053_127_753 208
472 3300046794 Ga0495589_0098065 Ga0495589_0098065_654_1319 208
473 3300047317 Ga0495604_0266595 Ga0495604_0266595_353_979 208
474 3300047321 Ga0495676_0316765 Ga0495676_0316765_324_950 208
475 3300047445 Ga0495677_0026762 Ga0495677_0026762_1280_1906 208
476 3300048905 Ga0496102_0955953 Ga0496102_0955953_120_746 208
477 3300048907 Ga0496104_0495658 Ga0496104_0495658_309_935 208
478 3300048909 Ga0496106_0345717 Ga0496106_0345717_286_912 208
479 3300048914 Ga0496111_0181419 Ga0496111_0181419_427_1053 208
480 3300050493 nmdc:mga0k408_158460_c1 nmdc:mga0k408_158460_c1_364_1017 208
481 3300050512 nmdc:mga0n895_103107_c1 nmdc:mga0n895_103107_c1_482_1108 208
482 3300050516 nmdc:mga0sz30_47966_c1 nmdc:mga0sz30_47966_c1_953_1606 208
483 3300005456 Ga0070678_100222692 Ga0070678_1002226922 209
484 3300005457 Ga0070662_100177656 Ga0070662_1001776562 209
485 3300005543 Ga0070672_100344825 Ga0070672_1003448252 209
486 3300006038 Ga0075365_10009774 Ga0075365_100097743 209
487 3300006038 Ga0075365_10033811 Ga0075365_100338112 209
488 3300006048 Ga0075363_100023243 Ga0075363_1000232436 209
489 3300006048 Ga0075363_100064361 Ga0075363_1000643612 209
490 3300006048 Ga0075363_100123050 Ga0075363_1001230502 209
491 3300006051 Ga0075364_10006598 Ga0075364_100065982 209
492 3300006173 Ga0070716_100101458 Ga0070716_1001014582 209
493 3300006177 Ga0075362_10110606 Ga0075362_101106062 209
494 3300006178 Ga0075367_10095706 Ga0075367_100957061 209
495 3300006941 Ga0099825_1035583 Ga0099825_10355832 209
496 3300006942 Ga0099824_1014958 Ga0099824_10149584 209
497 3300006944 Ga0099823_1057867 Ga0099823_10578672 209
498 3300009093 Ga0105240_10626137 Ga0105240_106261372 209
499 3300009148 Ga0105243_10418300 Ga0105243_104183002 209
500 3300010375 Ga0105239_10029633 Ga0105239_100296335 209
501 3300011119 Ga0105246_10890668 Ga0105246_108906681 209
502 3300014745 Ga0157377_10274558 Ga0157377_102745582 209
503 3300021321 Ga0214542_1000606 Ga0214542_10006069 209
504 3300021324 Ga0214545_1000003 Ga0214545_1000003201 209
505 3300021327 Ga0214543_1000002 Ga0214543_1000002565 209
506 3300025297 Ga0209758_1003647 Ga0209758_10036475 209
507 3300025297 Ga0209758_1017313 Ga0209758_10173132 209
508 3300025901 Ga0207688_10060730 Ga0207688_100607301 209
509 3300025904 Ga0207647_10093709 Ga0207647_100937092 209
510 3300025919 Ga0207657_10475179 Ga0207657_104751792 209
511 3300025933 Ga0207706_10216289 Ga0207706_102162892 209
512 3300025939 Ga0207665_10128387 Ga0207665_101283872 209
513 3300026023 Ga0207677_10574981 Ga0207677_105749812 209
514 3300027296 Ga0209389_1000043 Ga0209389_10000438 209
515 3300027296 Ga0209389_1000077 Ga0209389_100007774 209
516 3300027357 Ga0209589_1000047 Ga0209589_1000047103 209
517 3300027361 Ga0209489_100075 Ga0209489_100075135 209
518 3300027361 Ga0209489_100251 Ga0209489_10025174 209
519 3300027363 Ga0209700_100271 Ga0209700_10027174 209
520 3300031238 Ga0265332_10038748 Ga0265332_100387482 209
521 3300031241 Ga0265325_10084672 Ga0265325_100846722 209
522 3300031250 Ga0265331_10065277 Ga0265331_100652772 209
523 3300031344 Ga0265316_10085124 Ga0265316_100851242 209
524 3300031712 Ga0265342_10098074 Ga0265342_100980742 209
525 3300046559 Ga0495667_0223745 Ga0495667_0223745_83_712 209
526 3300047320 Ga0495672_0161760 Ga0495672_0161760_18_647 209
527 3300047472 Ga0495686_0082561 Ga0495686_0082561_1247_1876 209
528 3300048924 Ga0496121_0000214 Ga0496121_0000214_97975_98604 209
529 3300050490 nmdc:mga03n38_245955_c1 nmdc:mga03n38_245955_c1_225_854 209
530 3300050490 nmdc:mga03n38_290332_c1 nmdc:mga03n38_290332_c1_39_668 209
531 3300050490 nmdc:mga03n38_61415_c1 nmdc:mga03n38_61415_c1_783_1412 209
532 3300050491 nmdc:mga00v17_81879_c1 nmdc:mga00v17_81879_c1_67_696 209
533 3300050492 nmdc:mga0yw44_144353_c1 nmdc:mga0yw44_144353_c1_580_1212 209
534 3300050492 nmdc:mga0yw44_501039_c1 nmdc:mga0yw44_501039_c1_166_795 209
535 3300050494 nmdc:mga06z11_426866_c1 nmdc:mga06z11_426866_c1_49_717 209
536 3300053096 Ga0500641_0000956 Ga0500641_0000956_1550_2200 209
537 3300053096 Ga0500641_0006010 Ga0500641_0006010_1794_2426 209
538 3300053119 Ga0500595_006714 Ga0500595_006714_2156_2785 209
539 3300053147 Ga0500589_017471 Ga0500589_017471_1136_1768 209
540 iso_pu_bacteria 2824600985 2824602984 209
541 iso_pu_bacteria 2888419890 2888425799 209
542 3300000549 LJQas_1003694 LJQas_10036942 210
543 3300005327 Ga0070658_10087636 Ga0070658_100876362 210
544 3300005328 Ga0070676_10321747 Ga0070676_103217472 210
545 3300005329 Ga0070683_100353016 Ga0070683_1003530162 210
546 3300005330 Ga0070690_100094006 Ga0070690_1000940062 210
547 3300005331 Ga0070670_100303313 Ga0070670_1003033131 210
548 3300005334 Ga0068869_100326377 Ga0068869_1003263772 210
549 3300005336 Ga0070680_100088385 Ga0070680_1000883852 210
550 3300005337 Ga0070682_100107936 Ga0070682_1001079362 210
551 3300005337 Ga0070682_100269681 Ga0070682_1002696811 210
552 3300005339 Ga0070660_100069978 Ga0070660_1000699782 210
553 3300005341 Ga0070691_10062736 Ga0070691_100627362 210
554 3300005344 Ga0070661_100080291 Ga0070661_1000802911 210
555 3300005364 Ga0070673_100112266 Ga0070673_1001122662 210
556 3300005366 Ga0070659_100153865 Ga0070659_1001538652 210
557 3300005366 Ga0070659_100187774 Ga0070659_1001877743 210
558 3300005434 Ga0070709_10060796 Ga0070709_100607962 210
559 3300005445 Ga0070708_100284274 Ga0070708_1002842742 210
560 3300005455 Ga0070663_100010586 Ga0070663_1000105863 210
561 3300005455 Ga0070663_100034596 Ga0070663_1000345962 210
562 3300005456 Ga0070678_100737454 Ga0070678_1007374541 210
563 3300005466 Ga0070685_10719490 Ga0070685_107194901 210
564 3300005467 Ga0070706_100350994 Ga0070706_1003509942 210
565 3300005468 Ga0070707_100479566 Ga0070707_1004795662 210
566 3300005535 Ga0070684_100037005 Ga0070684_1000370054 210
567 3300005536 Ga0070697_100141672 Ga0070697_1001416722 210
568 3300005536 Ga0070697_100537843 Ga0070697_1005378432 210
569 3300005539 Ga0068853_100260398 Ga0068853_1002603982 210
570 3300005548 Ga0070665_100026407 Ga0070665_1000264074 210
571 3300005577 Ga0068857_100090725 Ga0068857_1000907254 210
572 3300005616 Ga0068852_100114739 Ga0068852_1001147392 210
573 3300005616 Ga0068852_100176400 Ga0068852_1001764003 210
574 3300005719 Ga0068861_100077725 Ga0068861_1000777252 210
575 3300006038 Ga0075365_10338822 Ga0075365_103388222 210
576 3300006048 Ga0075363_100026384 Ga0075363_1000263842 210
577 3300006051 Ga0075364_10057390 Ga0075364_100573902 210
578 3300006178 Ga0075367_10157223 Ga0075367_101572232 210
579 3300006353 Ga0075370_10014309 Ga0075370_100143092 210
580 3300006358 Ga0068871_100097853 Ga0068871_1000978532 210
581 3300006844 Ga0075428_100768388 Ga0075428_1007683882 210
582 3300007265 Ga0099794_10022730 Ga0099794_100227303 210
583 3300009093 Ga0105240_10096778 Ga0105240_100967782 210
584 3300009098 Ga0105245_11041984 Ga0105245_110419841 210
585 3300009176 Ga0105242_10372710 Ga0105242_103727102 210
586 3300009545 Ga0105237_10004604 Ga0105237_100046043 210
587 3300009545 Ga0105237_10124269 Ga0105237_101242692 210
588 3300009551 Ga0105238_10278327 Ga0105238_102783272 210
589 3300010375 Ga0105239_10072659 Ga0105239_100726594 210
590 3300013104 Ga0157370_10027778 Ga0157370_100277788 210
591 3300013105 Ga0157369_10124282 Ga0157369_101242822 210
592 3300013306 Ga0163162_10121401 Ga0163162_101214012 210
593 3300013306 Ga0163162_10126318 Ga0163162_101263182 210
594 3300013306 Ga0163162_10528349 Ga0163162_105283492 210
595 3300013308 Ga0157375_10732388 Ga0157375_107323882 210
596 3300014325 Ga0163163_10034261 Ga0163163_100342612 210
597 3300014326 Ga0157380_10048416 Ga0157380_100484162 210
598 3300014326 Ga0157380_10576415 Ga0157380_105764152 210
599 3300014326 Ga0157380_10606505 Ga0157380_106065052 210
600 3300017792 Ga0163161_10048644 Ga0163161_100486443 210
601 3300025906 Ga0207699_10076273 Ga0207699_100762732 210
602 3300025910 Ga0207684_10118318 Ga0207684_101183182 210
603 3300025912 Ga0207707_10013073 Ga0207707_1001307311 210
604 3300025912 Ga0207707_10751064 Ga0207707_107510641 210
605 3300025913 Ga0207695_10241475 Ga0207695_102414752 210
606 3300025914 Ga0207671_10205028 Ga0207671_102050281 210
607 3300025917 Ga0207660_10019729 Ga0207660_100197295 210
608 3300025919 Ga0207657_10090075 Ga0207657_100900752 210
609 3300025921 Ga0207652_10015037 Ga0207652_100150374 210
610 3300025922 Ga0207646_10179519 Ga0207646_101795192 210
611 3300025924 Ga0207694_10078792 Ga0207694_100787923 210
612 3300025932 Ga0207690_10280199 Ga0207690_102801992 210
613 3300025933 Ga0207706_10106148 Ga0207706_101061483 210
614 3300025944 Ga0207661_10081831 Ga0207661_100818312 210
615 3300025945 Ga0207679_10537008 Ga0207679_105370082 210
616 3300025949 Ga0207667_10109389 Ga0207667_101093892 210
617 3300025960 Ga0207651_10581454 Ga0207651_105814542 210
618 3300025961 Ga0207712_10098934 Ga0207712_100989342 210
619 3300025981 Ga0207640_10352000 Ga0207640_103520002 210
620 3300025981 Ga0207640_10718011 Ga0207640_107180112 210
621 3300025986 Ga0207658_10681798 Ga0207658_106817982 210
622 3300026023 Ga0207677_10176710 Ga0207677_101767102 210
623 3300026041 Ga0207639_10029947 Ga0207639_100299473 210
624 3300026067 Ga0207678_10009390 Ga0207678_100093907 210
625 3300026116 Ga0207674_10021202 Ga0207674_100212022 210
626 3300026142 Ga0207698_10183415 Ga0207698_101834152 210
627 3300026142 Ga0207698_10257474 Ga0207698_102574742 210
628 3300026142 Ga0207698_11036254 Ga0207698_110362541 210
629 3300028379 Ga0268266_10007087 Ga0268266_100070873 210
630 3300031456 Ga0307513_10352747 Ga0307513_103527472 210
631 3300031649 Ga0307514_10318034 Ga0307514_103180342 210
632 3300031730 Ga0307516_10036105 Ga0307516_100361052 210
633 3300035112 Ga0373932_0108269 Ga0373932_0108269_72_704 210
634 3300035171 Ga0373946_0225657 Ga0373946_0225657_17_652 210
635 3300037068 Ga0373925_0108644 Ga0373925_0108644_886_1521 210
636 3300046459 Ga0495629_0180725 Ga0495629_0180725_670_1305 210
637 3300046531 Ga0495665_0063420 Ga0495665_0063420_852_1487 210
638 3300046664 Ga0495659_0136332 Ga0495659_0136332_283_915 210
639 3300046683 Ga0495658_0113870 Ga0495658_0113870_457_1092 210
640 3300047315 Ga0495581_0233647 Ga0495581_0233647_75_710 210
641 3300048904 Ga0496101_0337427 Ga0496101_0337427_313_945 210
642 3300048905 Ga0496102_0138363 Ga0496102_0138363_606_1238 210
643 3300048905 Ga0496102_0414688 Ga0496102_0414688_453_1088 210
644 3300048906 Ga0496103_0069107 Ga0496103_0069107_706_1338 210
645 3300048907 Ga0496104_0162292 Ga0496104_0162292_70_702 210
646 3300048908 Ga0496105_0090827 Ga0496105_0090827_1072_1704 210
647 3300048911 Ga0496108_0141781 Ga0496108_0141781_364_999 210
648 3300048911 Ga0496108_0572521 Ga0496108_0572521_104_739 210
649 3300048912 Ga0496109_0122327 Ga0496109_0122327_1163_1795 210
650 3300048913 Ga0496110_0119295 Ga0496110_0119295_1578_2210 210
651 3300048913 Ga0496110_0130483 Ga0496110_0130483_293_925 210
652 3300048914 Ga0496111_0189917 Ga0496111_0189917_219_851 210
653 3300048915 Ga0496112_0187957 Ga0496112_0187957_317_952 210
654 3300048916 Ga0496113_0050393 Ga0496113_0050393_1115_1747 210
655 3300048917 Ga0496114_0109518 Ga0496114_0109518_427_1059 210
656 3300048917 Ga0496114_0365864 Ga0496114_0365864_533_1168 210
657 3300048918 Ga0496115_0100362 Ga0496115_0100362_1163_1795 210
658 3300048924 Ga0496121_0074968 Ga0496121_0074968_1044_1688 210
659 3300048929 Ga0496126_0053231 Ga0496126_0053231_2005_2649 210
660 3300048929 Ga0496126_0285606 Ga0496126_0285606_443_1078 210
661 3300049460 Ga0495682_0136717 Ga0495682_0136717_124_756 210
662 3300050490 nmdc:mga03n38_182606_c1 nmdc:mga03n38_182606_c1_367_1002 210
663 3300050491 nmdc:mga00v17_48296_c1 nmdc:mga00v17_48296_c1_1004_1639 210
664 3300050492 nmdc:mga0yw44_117199_c1 nmdc:mga0yw44_117199_c1_272_907 210
665 3300050493 nmdc:mga0k408_119032_c1 nmdc:mga0k408_119032_c1_351_986 210
666 3300050494 nmdc:mga06z11_27540_c1 nmdc:mga06z11_27540_c1_1550_2185 210
667 3300053155 Ga0500620_009594 Ga0500620_009594_766_1401 210

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tzz-assembly2.cif.gz_B crystal structure of the protein l1841, unknown member of enolase superfamily from bradyrhizobium japonicum 0.7554 65 104
1tzz-assembly1.cif.gz_A crystal structure of the protein l1841, unknown member of enolase superfamily from bradyrhizobium japonicum 0.748 65 104
3brw-assembly1.cif.gz_A structure of the rap-rapgap complex 0.7302 62 111
2qm0-assembly1.cif.gz_A crystal structure of bes protein from bacillus cereus 0.6912 64 91
2qm0-assembly1.cif.gz_B crystal structure of bes protein from bacillus cereus 0.6822 64 91
ID Description Score Start End Superfamily
4kbjA02 Alpha Beta;Alpha-Beta Complex;Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3;RNA polymerase Rpb2, domain 2 0.8345 65 111 3.90.1110.10
af_X2JDH0_779_875_3.30.1120.160 Alpha Beta;2-Layer Sandwich;Arylsulfatase, C-terminal domain; 0.7733 66 112 3.30.1120.160
1tzzA01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.763 65 104 3.30.390.10
af_H2L055_270_364_3.30.1120.160 Alpha Beta;2-Layer Sandwich;Arylsulfatase, C-terminal domain; 0.7569 70 115 3.30.1120.160
af_Q8II57_290_513_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6998 80 111 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A837CCD5-F1-model_v4 Uncharacterized protein 0.9343 98 210
AF-H5YEF0-F1-model_v4 Uncharacterized protein 0.9163 98 210
AF-A0A837CCD5-F1-model_v4 Uncharacterized protein 0.9108 98 210
AF-H5YEF0-F1-model_v4 Uncharacterized protein 0.8933 98 210
AF-A0A512NIT6-F1-model_v4 Uncharacterized protein 0.8891 66 210

Feature Viewer

pLDDT pTM Quality
79.14 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map