F473833
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 667 | 358 | 602 | 202 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100894342|Ga0075428_1008943422 |
| Length | 222 |
| Sequence | MKAIPLSVAFEVASGIAFAQGAADPMAHLRACAVMEQAERLKCLDRLSRDIAVPDRAAGSGDNWIISETTSPVNYMQLRMPRTRGSPSSRPMVTATASSRGGPDGSSMRLAIHCRGGRTELVVSGPAISRRGSEYSITYRVNDDQPLQLPASSPSFGAGAAFTGDIVRLLQSLPEEGHIAVRISPRGGAGQDGHFLLGGLKTAREKLAAACKWPHAIAAPHN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 2 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 3 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 4 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 5 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 6 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 7 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 8 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 9 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 10 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 11 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 12 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 13 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 14 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 15 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 16 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 17 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 18 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 19 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 20 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 21 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 22 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 23 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 24 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 25 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 26 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 27 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 28 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 29 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 30 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 31 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 32 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 33 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 34 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 35 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 36 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 37 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 38 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 39 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 40 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 41 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 42 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 43 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 44 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 45 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 46 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 47 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 48 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 49 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 50 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 51 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 58 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 62 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 85 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 91 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 98 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 100 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 101 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 102 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 104 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 105 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 106 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 107 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 108 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 109 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 110 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 111 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 112 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 113 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 114 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 115 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 116 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 117 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 118 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 119 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 121 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 122 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 123 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 124 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 125 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 126 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 128 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 129 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 130 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 131 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 132 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 134 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 135 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 136 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 137 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 138 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 164 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 165 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 166 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 225 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 226 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 227 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 228 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 234 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 235 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 236 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 237 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 239 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 240 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 241 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 242 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 243 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 244 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 245 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 250 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 251 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 255 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 256 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 257 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 258 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 292 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 293 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 294 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 295 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 296 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 297 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 300 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 301 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 302 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 303 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 304 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 305 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 306 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 307 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 308 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 312 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 313 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 314 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 315 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 316 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 317 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 318 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 323 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 325 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 326 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 327 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 328 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 329 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 330 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 331 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 332 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 333 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 335 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 336 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 337 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 338 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 339 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 340 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 341 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 342 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 343 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 344 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 345 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 346 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 347 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 348 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 349 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 350 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 351 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 352 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 353 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 354 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 355 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 356 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 357 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 358 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.25 |
| Metatranscriptomes | 0 |
| Isolates | 9.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.9 |
| Nodule | 7.95 |
| Rhizoplane | 7.35 |
| Rhizosphere | 68.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1003694 | 3300000549 | Bacteria | 2034 |
| 2 | JGI24742J22300_10017981 | 3300002244 | Bacteria | 1198 |
| 3 | JGI25404J52841_10000073 | 3300003659 | Bacteria | 9022 |
| 4 | JGI25404J52841_10018614 | 3300003659 | Bacteria | 1505 |
| 5 | Ga0070658_10087636 | 3300005327 | Bacteria | 2562 |
| 6 | Ga0070676_10321747 | 3300005328 | Bacteria | 1055 |
| 7 | Ga0070683_100228272 | 3300005329 | Bacteria | 1770 |
| 8 | Ga0070683_100353016 | 3300005329 | Bacteria | 1400 |
| 9 | Ga0070690_100094006 | 3300005330 | Bacteria | 1978 |
| 10 | Ga0070690_100218738 | 3300005330 | Bacteria | 1334 |
| 11 | Ga0070690_100384318 | 3300005330 | Bacteria | 1027 |
| 12 | Ga0070670_100080989 | 3300005331 | Bacteria | 2790 |
| 13 | Ga0070670_100303313 | 3300005331 | Bacteria | 1397 |
| 14 | Ga0068869_100070955 | 3300005334 | Bacteria | 2578 |
| 15 | Ga0068869_100272433 | 3300005334 | Bacteria | 1359 |
| 16 | Ga0068869_100326377 | 3300005334 | Bacteria | 1246 |
| 17 | Ga0070666_10086780 | 3300005335 | Bacteria | 2145 |
| 18 | Ga0070680_100088385 | 3300005336 | Bacteria | 2563 |
| 19 | Ga0070680_100710243 | 3300005336 | Bacteria | 865 |
| 20 | Ga0070682_100030872 | 3300005337 | Bacteria | 3238 |
| 21 | Ga0070682_100107936 | 3300005337 | Bacteria | 1850 |
| 22 | Ga0070682_100269681 | 3300005337 | Bacteria | 1236 |
| 23 | Ga0070682_100732652 | 3300005337 | Bacteria | 796 |
| 24 | Ga0068868_100002640 | 3300005338 | Bacteria | 12436 |
| 25 | Ga0068868_100430015 | 3300005338 | Bacteria | 1145 |
| 26 | Ga0068868_100648905 | 3300005338 | Bacteria | 940 |
| 27 | Ga0070660_100069978 | 3300005339 | Bacteria | 2737 |
| 28 | Ga0070689_100480329 | 3300005340 | Bacteria | 1061 |
| 29 | Ga0070691_10062736 | 3300005341 | Bacteria | 1790 |
| 30 | Ga0070691_10218046 | 3300005341 | Bacteria | 1010 |
| 31 | Ga0070661_100075348 | 3300005344 | Bacteria | 2486 |
| 32 | Ga0070661_100080291 | 3300005344 | Bacteria | 2408 |
| 33 | Ga0070661_100119690 | 3300005344 | Bacteria | 1971 |
| 34 | Ga0070668_100016139 | 3300005347 | Bacteria | 5589 |
| 35 | Ga0070668_100017881 | 3300005347 | Bacteria | 5319 |
| 36 | Ga0070668_100040249 | 3300005347 | Bacteria | 3576 |
| 37 | Ga0070668_100084085 | 3300005347 | Bacteria | 2499 |
| 38 | Ga0070668_100242384 | 3300005347 | Bacteria | 1494 |
| 39 | Ga0070668_100474916 | 3300005347 | Bacteria | 1079 |
| 40 | Ga0070669_100319674 | 3300005353 | Bacteria | 1253 |
| 41 | Ga0070675_100152255 | 3300005354 | Bacteria | 1984 |
| 42 | Ga0070675_100260644 | 3300005354 | Bacteria | 1519 |
| 43 | Ga0070671_100013730 | 3300005355 | Bacteria | 6533 |
| 44 | Ga0070674_100287602 | 3300005356 | Bacteria | 1305 |
| 45 | Ga0070674_100344533 | 3300005356 | Bacteria | 1202 |
| 46 | Ga0070674_100366756 | 3300005356 | Bacteria | 1168 |
| 47 | Ga0070674_100426826 | 3300005356 | Bacteria | 1089 |
| 48 | Ga0070674_100748366 | 3300005356 | Bacteria | 840 |
| 49 | Ga0070673_100081240 | 3300005364 | Bacteria | 2628 |
| 50 | Ga0070673_100112266 | 3300005364 | Bacteria | 2262 |
| 51 | Ga0070659_100126673 | 3300005366 | Bacteria | 2072 |
| 52 | Ga0070659_100153865 | 3300005366 | Bacteria | 1877 |
| 53 | Ga0070659_100187774 | 3300005366 | Bacteria | 1698 |
| 54 | Ga0070667_100785051 | 3300005367 | Bacteria | 884 |
| 55 | Ga0070709_10060796 | 3300005434 | Bacteria | 2403 |
| 56 | Ga0070710_10351926 | 3300005437 | Bacteria | 975 |
| 57 | Ga0070711_100348999 | 3300005439 | Bacteria | 1189 |
| 58 | Ga0070700_100090789 | 3300005441 | Bacteria | 1993 |
| 59 | Ga0070694_100520767 | 3300005444 | Bacteria | 949 |
| 60 | Ga0070708_100284274 | 3300005445 | Bacteria | 1557 |
| 61 | Ga0070663_100010586 | 3300005455 | Bacteria | 5753 |
| 62 | Ga0070663_100011200 | 3300005455 | Bacteria | 5618 |
| 63 | Ga0070663_100029062 | 3300005455 | Bacteria | 3772 |
| 64 | Ga0070663_100033325 | 3300005455 | Bacteria | 3558 |
| 65 | Ga0070663_100034596 | 3300005455 | Bacteria | 3500 |
| 66 | Ga0070663_100117018 | 3300005455 | Bacteria | 2010 |
| 67 | Ga0070663_100339823 | 3300005455 | Bacteria | 1213 |
| 68 | Ga0070678_100222692 | 3300005456 | Bacteria | 1569 |
| 69 | Ga0070678_100289729 | 3300005456 | Bacteria | 1387 |
| 70 | Ga0070678_100648841 | 3300005456 | Bacteria | 947 |
| 71 | Ga0070678_100737454 | 3300005456 | Bacteria | 890 |
| 72 | Ga0070662_100041247 | 3300005457 | Bacteria | 3292 |
| 73 | Ga0070662_100177656 | 3300005457 | Bacteria | 1676 |
| 74 | Ga0070662_100215243 | 3300005457 | Bacteria | 1530 |
| 75 | Ga0070681_10061902 | 3300005458 | Bacteria | 3716 |
| 76 | Ga0068867_100090574 | 3300005459 | Bacteria | 2320 |
| 77 | Ga0068867_100152489 | 3300005459 | Bacteria | 1816 |
| 78 | Ga0068867_100153275 | 3300005459 | Bacteria | 1812 |
| 79 | Ga0070685_10719490 | 3300005466 | Bacteria | 729 |
| 80 | Ga0070706_100350994 | 3300005467 | Bacteria | 1375 |
| 81 | Ga0070707_100479566 | 3300005468 | Bacteria | 1205 |
| 82 | Ga0070684_100037005 | 3300005535 | Bacteria | 4184 |
| 83 | Ga0070697_100141672 | 3300005536 | Bacteria | 2022 |
| 84 | Ga0070697_100537843 | 3300005536 | Bacteria | 1024 |
| 85 | Ga0068853_100136426 | 3300005539 | Bacteria | 2200 |
| 86 | Ga0068853_100260398 | 3300005539 | Bacteria | 1594 |
| 87 | Ga0068853_100446633 | 3300005539 | Bacteria | 1216 |
| 88 | Ga0070672_100123736 | 3300005543 | Bacteria | 2120 |
| 89 | Ga0070672_100186388 | 3300005543 | Bacteria | 1731 |
| 90 | Ga0070672_100344825 | 3300005543 | Bacteria | 1269 |
| 91 | Ga0070686_100123848 | 3300005544 | Bacteria | 1778 |
| 92 | Ga0070686_100193888 | 3300005544 | Bacteria | 1452 |
| 93 | Ga0070686_100356323 | 3300005544 | Bacteria | 1101 |
| 94 | Ga0070695_100378451 | 3300005545 | Bacteria | 1068 |
| 95 | Ga0070696_100139962 | 3300005546 | Bacteria | 1768 |
| 96 | Ga0070693_100328556 | 3300005547 | Bacteria | 1040 |
| 97 | Ga0070665_100000907 | 3300005548 | Bacteria | 38019 |
| 98 | Ga0070665_100012477 | 3300005548 | Bacteria | 8564 |
| 99 | Ga0070665_100026407 | 3300005548 | Bacteria | 5848 |
| 100 | Ga0070665_100079071 | 3300005548 | Bacteria | 3295 |
| 101 | Ga0070665_100377182 | 3300005548 | Bacteria | 1425 |
| 102 | Ga0068855_100145101 | 3300005563 | Bacteria | 2703 |
| 103 | Ga0070664_100037752 | 3300005564 | Bacteria | 4062 |
| 104 | Ga0068857_100082333 | 3300005577 | Bacteria | 2875 |
| 105 | Ga0068857_100090725 | 3300005577 | Bacteria | 2734 |
| 106 | Ga0068854_100162464 | 3300005578 | Bacteria | 1731 |
| 107 | Ga0068856_100109763 | 3300005614 | Bacteria | 2755 |
| 108 | Ga0070702_100017245 | 3300005615 | Bacteria | 3722 |
| 109 | Ga0068852_100036443 | 3300005616 | Bacteria | 4116 |
| 110 | Ga0068852_100114739 | 3300005616 | Bacteria | 2455 |
| 111 | Ga0068852_100176400 | 3300005616 | Bacteria | 2007 |
| 112 | Ga0068859_100038727 | 3300005617 | Bacteria | 4782 |
| 113 | Ga0068864_100022449 | 3300005618 | Bacteria | 5292 |
| 114 | Ga0068866_10031988 | 3300005718 | Bacteria | 2539 |
| 115 | Ga0068866_10119239 | 3300005718 | Bacteria | 1484 |
| 116 | Ga0068866_10135098 | 3300005718 | Bacteria | 1408 |
| 117 | Ga0068866_10209068 | 3300005718 | Bacteria | 1170 |
| 118 | Ga0068861_100011149 | 3300005719 | Bacteria | 6241 |
| 119 | Ga0068861_100077725 | 3300005719 | Bacteria | 2589 |
| 120 | Ga0068861_100082171 | 3300005719 | Bacteria | 2524 |
| 121 | Ga0068861_100105212 | 3300005719 | Bacteria | 2253 |
| 122 | Ga0068861_100724529 | 3300005719 | Bacteria | 926 |
| 123 | Ga0068861_100735825 | 3300005719 | Bacteria | 920 |
| 124 | Ga0068870_10014095 | 3300005840 | Bacteria | 3770 |
| 125 | Ga0068863_100024757 | 3300005841 | Bacteria | 5725 |
| 126 | Ga0068858_100162906 | 3300005842 | Bacteria | 2100 |
| 127 | Ga0068858_101134748 | 3300005842 | Bacteria | 768 |
| 128 | Ga0068860_100133926 | 3300005843 | Bacteria | 2379 |
| 129 | Ga0068860_100247061 | 3300005843 | Bacteria | 1737 |
| 130 | Ga0068860_100369245 | 3300005843 | Bacteria | 1415 |
| 131 | Ga0068860_100497713 | 3300005843 | Bacteria | 1216 |
| 132 | Ga0068862_100052693 | 3300005844 | Bacteria | 3482 |
| 133 | Ga0068862_100061636 | 3300005844 | Bacteria | 3224 |
| 134 | Ga0068862_101082315 | 3300005844 | Bacteria | 796 |
| 135 | Ga0081455_10023565 | 3300005937 | Bacteria | 5726 |
| 136 | Ga0081538_10018086 | 3300005981 | Bacteria | 5316 |
| 137 | Ga0081540_1003974 | 3300005983 | Bacteria | 11485 |
| 138 | Ga0081540_1006148 | 3300005983 | Bacteria | 8811 |
| 139 | Ga0081540_1017945 | 3300005983 | Bacteria | 4360 |
| 140 | Ga0081540_1027706 | 3300005983 | Bacteria | 3203 |
| 141 | Ga0081540_1093100 | 3300005983 | Bacteria | 1321 |
| 142 | Ga0075365_10009774 | 3300006038 | Bacteria | 5542 |
| 143 | Ga0075365_10033811 | 3300006038 | Bacteria | 3298 |
| 144 | Ga0075365_10100784 | 3300006038 | Bacteria | 1977 |
| 145 | Ga0075365_10338822 | 3300006038 | Bacteria | 1060 |
| 146 | Ga0075363_100011979 | 3300006048 | Bacteria | 4169 |
| 147 | Ga0075363_100023243 | 3300006048 | Bacteria | 3140 |
| 148 | Ga0075363_100026384 | 3300006048 | Bacteria | 2972 |
| 149 | Ga0075363_100064361 | 3300006048 | Bacteria | 1981 |
| 150 | Ga0075363_100123050 | 3300006048 | Bacteria | 1450 |
| 151 | Ga0075364_10006598 | 3300006051 | Bacteria | 6833 |
| 152 | Ga0075364_10030478 | 3300006051 | Bacteria | 3462 |
| 153 | Ga0075364_10057390 | 3300006051 | Bacteria | 2550 |
| 154 | Ga0070715_10043602 | 3300006163 | Bacteria | 1892 |
| 155 | Ga0070715_10292425 | 3300006163 | Unclassified | 868 |
| 156 | Ga0070716_100101458 | 3300006173 | Bacteria | 1765 |
| 157 | Ga0070712_100394774 | 3300006175 | Bacteria | 1141 |
| 158 | Ga0070712_100448735 | 3300006175 | Bacteria | 1073 |
| 159 | Ga0075362_10110606 | 3300006177 | Bacteria | 1293 |
| 160 | Ga0075367_10027318 | 3300006178 | Bacteria | 3245 |
| 161 | Ga0075367_10095706 | 3300006178 | Bacteria | 1811 |
| 162 | Ga0075367_10157223 | 3300006178 | Bacteria | 1413 |
| 163 | Ga0075369_10021586 | 3300006186 | Bacteria | 2648 |
| 164 | Ga0075366_10094557 | 3300006195 | Bacteria | 1792 |
| 165 | Ga0097621_100015958 | 3300006237 | Bacteria | 5664 |
| 166 | Ga0075370_10014309 | 3300006353 | Bacteria | 4231 |
| 167 | Ga0075370_10072218 | 3300006353 | Bacteria | 1975 |
| 168 | Ga0068871_100053388 | 3300006358 | Bacteria | 3275 |
| 169 | Ga0068871_100097853 | 3300006358 | Bacteria | 2454 |
| 170 | Ga0068871_100849827 | 3300006358 | Bacteria | 844 |
| 171 | Ga0075428_100768388 | 3300006844 | Bacteria | 1025 |
| 172 | Ga0075428_100894342 | 3300006844 | Bacteria | 942 |
| 173 | Ga0075433_10332678 | 3300006852 | Bacteria | 1343 |
| 174 | Ga0068865_100020402 | 3300006881 | Bacteria | 4296 |
| 175 | Ga0068865_100026281 | 3300006881 | Bacteria | 3837 |
| 176 | Ga0068865_100089001 | 3300006881 | Bacteria | 2235 |
| 177 | Ga0068865_100091319 | 3300006881 | Bacteria | 2210 |
| 178 | Ga0068865_100235837 | 3300006881 | Bacteria | 1437 |
| 179 | Ga0068865_100375056 | 3300006881 | Bacteria | 1159 |
| 180 | Ga0097620_100038730 | 3300006931 | Bacteria | 4782 |
| 181 | Ga0099825_1035583 | 3300006941 | Bacteria | 1769 |
| 182 | Ga0099824_1014958 | 3300006942 | Bacteria | 7524 |
| 183 | Ga0099823_1057867 | 3300006944 | Bacteria | 2114 |
| 184 | Ga0075435_100199905 | 3300007076 | Bacteria | 1693 |
| 185 | Ga0099794_10022730 | 3300007265 | Bacteria | 2860 |
| 186 | Ga0105240_10096778 | 3300009093 | Bacteria | 3597 |
| 187 | Ga0105240_10244052 | 3300009093 | Bacteria | 2081 |
| 188 | Ga0105240_10247035 | 3300009093 | Bacteria | 2066 |
| 189 | Ga0105240_10626137 | 3300009093 | Bacteria | 1182 |
| 190 | Ga0111539_10291568 | 3300009094 | Bacteria | 1899 |
| 191 | Ga0111539_10698901 | 3300009094 | Bacteria | 1180 |
| 192 | Ga0111539_11197047 | 3300009094 | Bacteria | 882 |
| 193 | Ga0105245_10043059 | 3300009098 | Bacteria | 4027 |
| 194 | Ga0105245_10052458 | 3300009098 | Bacteria | 3658 |
| 195 | Ga0105245_10094116 | 3300009098 | Bacteria | 2761 |
| 196 | Ga0105245_10194066 | 3300009098 | Bacteria | 1947 |
| 197 | Ga0105245_10903266 | 3300009098 | Bacteria | 925 |
| 198 | Ga0105245_11041984 | 3300009098 | Bacteria | 863 |
| 199 | Ga0105247_10034503 | 3300009101 | Bacteria | 3081 |
| 200 | Ga0105243_10177477 | 3300009148 | Bacteria | 1850 |
| 201 | Ga0105243_10418300 | 3300009148 | Bacteria | 1249 |
| 202 | Ga0105241_10012171 | 3300009174 | Bacteria | 6315 |
| 203 | Ga0105241_10252256 | 3300009174 | Bacteria | 1496 |
| 204 | Ga0105242_10059491 | 3300009176 | Bacteria | 3135 |
| 205 | Ga0105242_10180639 | 3300009176 | Bacteria | 1861 |
| 206 | Ga0105242_10372710 | 3300009176 | Bacteria | 1325 |
| 207 | Ga0105242_10727310 | 3300009176 | Bacteria | 974 |
| 208 | Ga0105248_10010641 | 3300009177 | Bacteria | 10144 |
| 209 | Ga0105237_10004604 | 3300009545 | Bacteria | 15907 |
| 210 | Ga0105237_10013986 | 3300009545 | Bacteria | 8398 |
| 211 | Ga0105237_10062317 | 3300009545 | Bacteria | 3729 |
| 212 | Ga0105237_10124269 | 3300009545 | Bacteria | 2575 |
| 213 | Ga0105238_10011512 | 3300009551 | Bacteria | 8914 |
| 214 | Ga0105238_10025189 | 3300009551 | Bacteria | 6063 |
| 215 | Ga0105238_10124257 | 3300009551 | Bacteria | 2560 |
| 216 | Ga0105238_10278327 | 3300009551 | Bacteria | 1654 |
| 217 | Ga0105249_10114180 | 3300009553 | Bacteria | 2557 |
| 218 | Ga0105249_10218823 | 3300009553 | Bacteria | 1873 |
| 219 | Ga0105249_10362195 | 3300009553 | Bacteria | 1472 |
| 220 | Ga0105249_10374406 | 3300009553 | Bacteria | 1448 |
| 221 | Ga0105239_10000778 | 3300010375 | Bacteria | 45211 |
| 222 | Ga0105239_10029633 | 3300010375 | Bacteria | 6017 |
| 223 | Ga0105239_10034155 | 3300010375 | Bacteria | 5583 |
| 224 | Ga0105239_10038676 | 3300010375 | Bacteria | 5228 |
| 225 | Ga0105239_10072659 | 3300010375 | Bacteria | 3782 |
| 226 | Ga0105239_11021427 | 3300010375 | Unclassified | 951 |
| 227 | Ga0105246_10019408 | 3300011119 | Bacteria | 4343 |
| 228 | Ga0105246_10890668 | 3300011119 | Unclassified | 797 |
| 229 | Ga0157370_10027778 | 3300013104 | Bacteria | 5578 |
| 230 | Ga0157369_10124282 | 3300013105 | Bacteria | 2737 |
| 231 | Ga0157369_10447405 | 3300013105 | Bacteria | 1338 |
| 232 | Ga0157374_10013084 | 3300013296 | Bacteria | 7237 |
| 233 | Ga0157374_10015082 | 3300013296 | Bacteria | 6775 |
| 234 | Ga0157374_10073303 | 3300013296 | Bacteria | 3232 |
| 235 | Ga0157378_10034431 | 3300013297 | Bacteria | 4479 |
| 236 | Ga0157378_10123194 | 3300013297 | Bacteria | 2392 |
| 237 | Ga0157378_10489770 | 3300013297 | Bacteria | 1226 |
| 238 | Ga0163162_10013299 | 3300013306 | Bacteria | 8039 |
| 239 | Ga0163162_10066991 | 3300013306 | Bacteria | 3641 |
| 240 | Ga0163162_10113952 | 3300013306 | Bacteria | 2802 |
| 241 | Ga0163162_10121401 | 3300013306 | Bacteria | 2717 |
| 242 | Ga0163162_10126318 | 3300013306 | Bacteria | 2664 |
| 243 | Ga0163162_10181916 | 3300013306 | Bacteria | 2228 |
| 244 | Ga0163162_10371334 | 3300013306 | Bacteria | 1563 |
| 245 | Ga0163162_10528349 | 3300013306 | Bacteria | 1309 |
| 246 | Ga0163162_10661704 | 3300013306 | Bacteria | 1168 |
| 247 | Ga0163162_10830600 | 3300013306 | Bacteria | 1040 |
| 248 | Ga0157375_10732388 | 3300013308 | Bacteria | 1141 |
| 249 | Ga0157375_11242775 | 3300013308 | Bacteria | 874 |
| 250 | Ga0157375_11628512 | 3300013308 | Bacteria | 763 |
| 251 | Ga0163163_10021051 | 3300014325 | Bacteria | 6152 |
| 252 | Ga0163163_10034261 | 3300014325 | Bacteria | 4916 |
| 253 | Ga0163163_10539807 | 3300014325 | Bacteria | 1228 |
| 254 | Ga0157380_10048416 | 3300014326 | Bacteria | 3348 |
| 255 | Ga0157380_10122627 | 3300014326 | Bacteria | 2204 |
| 256 | Ga0157380_10263149 | 3300014326 | Bacteria | 1568 |
| 257 | Ga0157380_10373276 | 3300014326 | Bacteria | 1343 |
| 258 | Ga0157380_10576415 | 3300014326 | Bacteria | 1109 |
| 259 | Ga0157380_10606505 | 3300014326 | Bacteria | 1084 |
| 260 | Ga0157377_10274558 | 3300014745 | Bacteria | 1102 |
| 261 | Ga0157379_10112244 | 3300014968 | Bacteria | 2449 |
| 262 | Ga0157379_10800050 | 3300014968 | Bacteria | 890 |
| 263 | Ga0157376_10062862 | 3300014969 | Bacteria | 3125 |
| 264 | Ga0157376_10243096 | 3300014969 | Bacteria | 1678 |
| 265 | Ga0157376_10513778 | 3300014969 | Bacteria | 1179 |
| 266 | Ga0163161_10048644 | 3300017792 | Bacteria | 3063 |
| 267 | Ga0163161_10076732 | 3300017792 | Bacteria | 2453 |
| 268 | Ga0163161_10277091 | 3300017792 | Bacteria | 1314 |
| 269 | Ga0214542_1000606 | 3300021321 | Bacteria | 66272 |
| 270 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 271 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 272 | Ga0209025_1055542 | 3300025294 | Bacteria | 1530 |
| 273 | Ga0209758_1003647 | 3300025297 | Bacteria | 13738 |
| 274 | Ga0209758_1017313 | 3300025297 | Bacteria | 3598 |
| 275 | Ga0207697_10036024 | 3300025315 | Bacteria | 2026 |
| 276 | Ga0207697_10119652 | 3300025315 | Bacteria | 1132 |
| 277 | Ga0207642_10066994 | 3300025899 | Bacteria | 1693 |
| 278 | Ga0207642_10076826 | 3300025899 | Bacteria | 1609 |
| 279 | Ga0207710_10022382 | 3300025900 | Bacteria | 2713 |
| 280 | Ga0207688_10009511 | 3300025901 | Bacteria | 5290 |
| 281 | Ga0207688_10060730 | 3300025901 | Bacteria | 2130 |
| 282 | Ga0207688_10067356 | 3300025901 | Bacteria | 2026 |
| 283 | Ga0207688_10180408 | 3300025901 | Bacteria | 1259 |
| 284 | Ga0207680_10046687 | 3300025903 | Bacteria | 2562 |
| 285 | Ga0207647_10058272 | 3300025904 | Bacteria | 2366 |
| 286 | Ga0207647_10086574 | 3300025904 | Bacteria | 1872 |
| 287 | Ga0207647_10093709 | 3300025904 | Bacteria | 1789 |
| 288 | Ga0207685_10079681 | 3300025905 | Bacteria | 1352 |
| 289 | Ga0207699_10076273 | 3300025906 | Bacteria | 2064 |
| 290 | Ga0207645_10232386 | 3300025907 | Bacteria | 1217 |
| 291 | Ga0207643_10042602 | 3300025908 | Bacteria | 2560 |
| 292 | Ga0207684_10118318 | 3300025910 | Bacteria | 2270 |
| 293 | Ga0207707_10013073 | 3300025912 | Bacteria | 7231 |
| 294 | Ga0207707_10066037 | 3300025912 | Bacteria | 3150 |
| 295 | Ga0207707_10751064 | 3300025912 | Bacteria | 816 |
| 296 | Ga0207695_10241475 | 3300025913 | Bacteria | 1708 |
| 297 | Ga0207695_10450562 | 3300025913 | Bacteria | 1170 |
| 298 | Ga0207671_10006919 | 3300025914 | Bacteria | 9994 |
| 299 | Ga0207671_10205028 | 3300025914 | Bacteria | 1541 |
| 300 | Ga0207693_10370041 | 3300025915 | Bacteria | 1121 |
| 301 | Ga0207693_10541507 | 3300025915 | Bacteria | 908 |
| 302 | Ga0207660_10019729 | 3300025917 | Bacteria | 4512 |
| 303 | Ga0207657_10090075 | 3300025919 | Bacteria | 2560 |
| 304 | Ga0207657_10120755 | 3300025919 | Bacteria | 2156 |
| 305 | Ga0207657_10475179 | 3300025919 | Bacteria | 980 |
| 306 | Ga0207652_10015037 | 3300025921 | Bacteria | 6277 |
| 307 | Ga0207646_10179519 | 3300025922 | Bacteria | 1912 |
| 308 | Ga0207681_10564651 | 3300025923 | Bacteria | 938 |
| 309 | Ga0207694_10058814 | 3300025924 | Bacteria | 2990 |
| 310 | Ga0207694_10078792 | 3300025924 | Bacteria | 2583 |
| 311 | Ga0207694_10772142 | 3300025924 | Unclassified | 811 |
| 312 | Ga0207650_10059961 | 3300025925 | Bacteria | 2838 |
| 313 | Ga0207659_10310545 | 3300025926 | Bacteria | 1298 |
| 314 | Ga0207687_10052096 | 3300025927 | Bacteria | 2855 |
| 315 | Ga0207687_10067996 | 3300025927 | Bacteria | 2536 |
| 316 | Ga0207687_10111332 | 3300025927 | Bacteria | 2032 |
| 317 | Ga0207644_10268448 | 3300025931 | Bacteria | 1366 |
| 318 | Ga0207644_10284676 | 3300025931 | Bacteria | 1328 |
| 319 | Ga0207644_10341011 | 3300025931 | Bacteria | 1215 |
| 320 | Ga0207690_10065385 | 3300025932 | Bacteria | 2487 |
| 321 | Ga0207690_10280199 | 3300025932 | Bacteria | 1298 |
| 322 | Ga0207706_10036435 | 3300025933 | Bacteria | 4370 |
| 323 | Ga0207706_10076849 | 3300025933 | Bacteria | 2937 |
| 324 | Ga0207706_10106148 | 3300025933 | Bacteria | 2471 |
| 325 | Ga0207706_10169767 | 3300025933 | Bacteria | 1917 |
| 326 | Ga0207706_10216289 | 3300025933 | Bacteria | 1679 |
| 327 | Ga0207709_10050861 | 3300025935 | Bacteria | 2536 |
| 328 | Ga0207709_10082288 | 3300025935 | Bacteria | 2078 |
| 329 | Ga0207670_10248416 | 3300025936 | Bacteria | 1374 |
| 330 | Ga0207669_10123134 | 3300025937 | Bacteria | 1765 |
| 331 | Ga0207669_10242644 | 3300025937 | Bacteria | 1336 |
| 332 | Ga0207669_10634325 | 3300025937 | Bacteria | 872 |
| 333 | Ga0207669_10793316 | 3300025937 | Bacteria | 785 |
| 334 | Ga0207704_10036623 | 3300025938 | Bacteria | 2825 |
| 335 | Ga0207704_10239061 | 3300025938 | Bacteria | 1356 |
| 336 | Ga0207665_10126279 | 3300025939 | Bacteria | 1811 |
| 337 | Ga0207665_10128387 | 3300025939 | Bacteria | 1797 |
| 338 | Ga0207691_10073734 | 3300025940 | Bacteria | 3079 |
| 339 | Ga0207691_10129284 | 3300025940 | Bacteria | 2232 |
| 340 | Ga0207691_10135105 | 3300025940 | Bacteria | 2176 |
| 341 | Ga0207691_10256745 | 3300025940 | Bacteria | 1507 |
| 342 | Ga0207691_10542449 | 3300025940 | Bacteria | 986 |
| 343 | Ga0207711_10046563 | 3300025941 | Bacteria | 3706 |
| 344 | Ga0207689_10021863 | 3300025942 | Bacteria | 5379 |
| 345 | Ga0207689_10216795 | 3300025942 | Bacteria | 1581 |
| 346 | Ga0207661_10081831 | 3300025944 | Bacteria | 2668 |
| 347 | Ga0207661_10168564 | 3300025944 | Bacteria | 1905 |
| 348 | Ga0207679_10048458 | 3300025945 | Bacteria | 3093 |
| 349 | Ga0207679_10145791 | 3300025945 | Bacteria | 1920 |
| 350 | Ga0207679_10537008 | 3300025945 | Bacteria | 1048 |
| 351 | Ga0207667_10087440 | 3300025949 | Bacteria | 3224 |
| 352 | Ga0207667_10109389 | 3300025949 | Bacteria | 2850 |
| 353 | Ga0207651_10581454 | 3300025960 | Bacteria | 977 |
| 354 | Ga0207712_10013111 | 3300025961 | Bacteria | 5310 |
| 355 | Ga0207712_10098934 | 3300025961 | Bacteria | 2164 |
| 356 | Ga0207668_10002442 | 3300025972 | Bacteria | 10848 |
| 357 | Ga0207668_10011873 | 3300025972 | Bacteria | 5311 |
| 358 | Ga0207668_10064080 | 3300025972 | Bacteria | 2596 |
| 359 | Ga0207668_10090856 | 3300025972 | Bacteria | 2242 |
| 360 | Ga0207668_10230060 | 3300025972 | Bacteria | 1494 |
| 361 | Ga0207668_10387988 | 3300025972 | Bacteria | 1177 |
| 362 | Ga0207668_10473732 | 3300025972 | Bacteria | 1073 |
| 363 | Ga0207640_10352000 | 3300025981 | Bacteria | 1184 |
| 364 | Ga0207640_10718011 | 3300025981 | Bacteria | 859 |
| 365 | Ga0207658_10681798 | 3300025986 | Bacteria | 928 |
| 366 | Ga0207677_10156196 | 3300026023 | Bacteria | 1767 |
| 367 | Ga0207677_10176710 | 3300026023 | Bacteria | 1675 |
| 368 | Ga0207677_10337662 | 3300026023 | Bacteria | 1258 |
| 369 | Ga0207677_10574981 | 3300026023 | Bacteria | 985 |
| 370 | Ga0207703_10712024 | 3300026035 | Bacteria | 955 |
| 371 | Ga0207639_10029947 | 3300026041 | Bacteria | 3989 |
| 372 | Ga0207639_10186586 | 3300026041 | Bacteria | 1768 |
| 373 | Ga0207678_10009390 | 3300026067 | Bacteria | 8607 |
| 374 | Ga0207678_10011829 | 3300026067 | Bacteria | 7662 |
| 375 | Ga0207678_10017970 | 3300026067 | Bacteria | 6212 |
| 376 | Ga0207678_10030402 | 3300026067 | Bacteria | 4715 |
| 377 | Ga0207678_10060310 | 3300026067 | Bacteria | 3263 |
| 378 | Ga0207678_10063112 | 3300026067 | Bacteria | 3184 |
| 379 | Ga0207678_10160149 | 3300026067 | Bacteria | 1922 |
| 380 | Ga0207678_10393568 | 3300026067 | Bacteria | 1199 |
| 381 | Ga0207708_10042169 | 3300026075 | Bacteria | 3479 |
| 382 | Ga0207708_10082714 | 3300026075 | Bacteria | 2468 |
| 383 | Ga0207708_10179324 | 3300026075 | Bacteria | 1682 |
| 384 | Ga0207702_10086059 | 3300026078 | Bacteria | 2740 |
| 385 | Ga0207641_11245833 | 3300026088 | Unclassified | 744 |
| 386 | Ga0207648_10215168 | 3300026089 | Bacteria | 1707 |
| 387 | Ga0207648_10441599 | 3300026089 | Bacteria | 1184 |
| 388 | Ga0207676_10468673 | 3300026095 | Bacteria | 1191 |
| 389 | Ga0207674_10021202 | 3300026116 | Bacteria | 7004 |
| 390 | Ga0207674_10119773 | 3300026116 | Bacteria | 2601 |
| 391 | Ga0207675_100017302 | 3300026118 | Bacteria | 6730 |
| 392 | Ga0207675_100024265 | 3300026118 | Bacteria | 5639 |
| 393 | Ga0207675_100039743 | 3300026118 | Bacteria | 4390 |
| 394 | Ga0207675_100319449 | 3300026118 | Bacteria | 1515 |
| 395 | Ga0207675_100491665 | 3300026118 | Bacteria | 1220 |
| 396 | Ga0207683_10053206 | 3300026121 | Bacteria | 3549 |
| 397 | Ga0207683_10067081 | 3300026121 | Bacteria | 3165 |
| 398 | Ga0207683_10493321 | 3300026121 | Bacteria | 1131 |
| 399 | Ga0207683_10498581 | 3300026121 | Bacteria | 1124 |
| 400 | Ga0207698_10183415 | 3300026142 | Bacteria | 1856 |
| 401 | Ga0207698_10257474 | 3300026142 | Bacteria | 1601 |
| 402 | Ga0207698_10598959 | 3300026142 | Bacteria | 1086 |
| 403 | Ga0207698_11036254 | 3300026142 | Bacteria | 832 |
| 404 | Ga0209389_1000043 | 3300027296 | Bacteria | 123224 |
| 405 | Ga0209389_1000077 | 3300027296 | Bacteria | 91273 |
| 406 | Ga0209589_1000047 | 3300027357 | Bacteria | 118659 |
| 407 | Ga0209489_100075 | 3300027361 | Bacteria | 136991 |
| 408 | Ga0209489_100251 | 3300027361 | Bacteria | 91273 |
| 409 | Ga0209700_100271 | 3300027363 | Bacteria | 91215 |
| 410 | Ga0209813_10004746 | 3300027866 | Bacteria | 3261 |
| 411 | Ga0207428_10116806 | 3300027907 | Bacteria | 2048 |
| 412 | Ga0268266_10007087 | 3300028379 | Bacteria | 10179 |
| 413 | Ga0268266_10025774 | 3300028379 | Bacteria | 5003 |
| 414 | Ga0268266_10221468 | 3300028379 | Bacteria | 1739 |
| 415 | Ga0268266_10261490 | 3300028379 | Bacteria | 1604 |
| 416 | Ga0268266_10375620 | 3300028379 | Bacteria | 1340 |
| 417 | Ga0268266_10419102 | 3300028379 | Bacteria | 1268 |
| 418 | Ga0268265_10055689 | 3300028380 | Bacteria | 3005 |
| 419 | Ga0268264_10446182 | 3300028381 | Bacteria | 1253 |
| 420 | Ga0307517_10324536 | 3300028786 | Bacteria | 850 |
| 421 | Ga0307515_10516873 | 3300028794 | Unclassified | 804 |
| 422 | Ga0265332_10038748 | 3300031238 | Bacteria | 2065 |
| 423 | Ga0265325_10084672 | 3300031241 | Bacteria | 1571 |
| 424 | Ga0265331_10065277 | 3300031250 | Bacteria | 1712 |
| 425 | Ga0265316_10085124 | 3300031344 | Bacteria | 2420 |
| 426 | Ga0307513_10352747 | 3300031456 | Bacteria | 1218 |
| 427 | Ga0307514_10318034 | 3300031649 | Bacteria | 857 |
| 428 | Ga0265342_10098074 | 3300031712 | Bacteria | 1673 |
| 429 | Ga0307516_10005450 | 3300031730 | Bacteria | 15211 |
| 430 | Ga0307516_10015280 | 3300031730 | Bacteria | 8084 |
| 431 | Ga0307516_10024698 | 3300031730 | Bacteria | 6136 |
| 432 | Ga0307516_10036105 | 3300031730 | Bacteria | 4950 |
| 433 | Ga0307415_100037464 | 3300032126 | Bacteria | 3188 |
| 434 | Ga0307510_10028462 | 3300033180 | Bacteria | 6382 |
| 435 | Ga0307510_10168552 | 3300033180 | Bacteria | 1773 |
| 436 | Ga0373923_0234594 | 3300035111 | Bacteria | 856 |
| 437 | Ga0373932_0108269 | 3300035112 | Bacteria | 913 |
| 438 | Ga0373946_0135808 | 3300035171 | Bacteria | 1136 |
| 439 | Ga0373946_0225657 | 3300035171 | Bacteria | 906 |
| 440 | Ga0373931_0115979 | 3300035691 | Bacteria | 1525 |
| 441 | Ga0373927_0109131 | 3300035695 | Bacteria | 1803 |
| 442 | Ga0373927_0356587 | 3300035695 | Bacteria | 964 |
| 443 | Ga0373927_0387601 | 3300035695 | Bacteria | 922 |
| 444 | Ga0373927_0438726 | 3300035695 | Bacteria | 862 |
| 445 | Ga0373947_0163686 | 3300035725 | Bacteria | 1440 |
| 446 | Ga0373925_0108644 | 3300037068 | Bacteria | 2141 |
| 447 | Ga0395905_0275517 | 3300037471 | Bacteria | 1568 |
| 448 | Ga0395901_0179763 | 3300038443 | Bacteria | 2219 |
| 449 | Ga0451853_2046610 | 3300041512 | Bacteria | 3440 |
| 450 | Ga0466972_0004993 | 3300044658 | Bacteria | 6655 |
| 451 | Ga0466964_0137563 | 3300044706 | Bacteria | 1119 |
| 452 | Ga0466960_0022513 | 3300044901 | Bacteria | 2818 |
| 453 | Ga0495629_0180725 | 3300046459 | Bacteria | 1462 |
| 454 | Ga0495638_0016005 | 3300046460 | Bacteria | 5026 |
| 455 | Ga0495641_0053386 | 3300046461 | Bacteria | 1839 |
| 456 | Ga0495596_0063481 | 3300046500 | Bacteria | 1437 |
| 457 | Ga0495610_0117712 | 3300046512 | Bacteria | 1169 |
| 458 | Ga0495616_0152898 | 3300046513 | Bacteria | 1043 |
| 459 | Ga0495620_0036638 | 3300046515 | Bacteria | 2193 |
| 460 | Ga0495631_0150217 | 3300046518 | Bacteria | 1000 |
| 461 | Ga0495632_0197736 | 3300046519 | Bacteria | 917 |
| 462 | Ga0495644_0091837 | 3300046523 | Bacteria | 1146 |
| 463 | Ga0495644_0185582 | 3300046523 | Bacteria | 800 |
| 464 | Ga0495666_0070668 | 3300046526 | Bacteria | 1660 |
| 465 | Ga0495665_0063420 | 3300046531 | Bacteria | 1951 |
| 466 | Ga0495597_0061929 | 3300046542 | Bacteria | 1629 |
| 467 | Ga0495667_0223745 | 3300046559 | Bacteria | 1201 |
| 468 | Ga0495656_0047402 | 3300046615 | Bacteria | 1822 |
| 469 | Ga0495656_0438943 | 3300046615 | Bacteria | 687 |
| 470 | Ga0495668_0085690 | 3300046616 | Bacteria | 1728 |
| 471 | Ga0495668_0366996 | 3300046616 | Bacteria | 790 |
| 472 | Ga0495611_0052079 | 3300046648 | Bacteria | 1846 |
| 473 | Ga0495625_0056559 | 3300046660 | Bacteria | 2792 |
| 474 | Ga0495625_0224173 | 3300046660 | Bacteria | 1230 |
| 475 | Ga0495625_0498127 | 3300046660 | Bacteria | 745 |
| 476 | Ga0495659_0136332 | 3300046664 | Bacteria | 977 |
| 477 | Ga0495588_0350488 | 3300046674 | Bacteria | 776 |
| 478 | Ga0495658_0113870 | 3300046683 | Bacteria | 1629 |
| 479 | Ga0495669_0005641 | 3300046684 | Bacteria | 5223 |
| 480 | Ga0495671_0213053 | 3300046692 | Bacteria | 936 |
| 481 | Ga0495589_0098065 | 3300046794 | Bacteria | 1419 |
| 482 | Ga0495600_0291532 | 3300046809 | Bacteria | 1031 |
| 483 | Ga0495581_0233647 | 3300047315 | Bacteria | 1075 |
| 484 | Ga0495581_0372224 | 3300047315 | Bacteria | 834 |
| 485 | Ga0495604_0266595 | 3300047317 | Bacteria | 1162 |
| 486 | Ga0495672_0044480 | 3300047320 | Bacteria | 2664 |
| 487 | Ga0495672_0161760 | 3300047320 | Bacteria | 1150 |
| 488 | Ga0495672_0424622 | 3300047320 | Unclassified | 604 |
| 489 | Ga0495676_0316765 | 3300047321 | Bacteria | 1049 |
| 490 | Ga0495677_0026762 | 3300047445 | Bacteria | 2092 |
| 491 | Ga0495673_0069300 | 3300047469 | Bacteria | 1488 |
| 492 | Ga0495673_0081312 | 3300047469 | Bacteria | 1342 |
| 493 | Ga0495686_0082561 | 3300047472 | Bacteria | 1961 |
| 494 | Ga0496101_0046223 | 3300048904 | Bacteria | 3121 |
| 495 | Ga0496101_0337427 | 3300048904 | Bacteria | 1183 |
| 496 | Ga0496101_0839939 | 3300048904 | Bacteria | 724 |
| 497 | Ga0496102_0001939 | 3300048905 | Bacteria | 17821 |
| 498 | Ga0496102_0065140 | 3300048905 | Bacteria | 3339 |
| 499 | Ga0496102_0138363 | 3300048905 | Bacteria | 2282 |
| 500 | Ga0496102_0414688 | 3300048905 | Bacteria | 1265 |
| 501 | Ga0496102_0425365 | 3300048905 | Bacteria | 1247 |
| 502 | Ga0496102_0955953 | 3300048905 | Unclassified | 778 |
| 503 | Ga0496103_0069107 | 3300048906 | Bacteria | 2208 |
| 504 | Ga0496103_0080902 | 3300048906 | Bacteria | 2043 |
| 505 | Ga0496104_0024496 | 3300048907 | Bacteria | 5551 |
| 506 | Ga0496104_0162292 | 3300048907 | Bacteria | 2143 |
| 507 | Ga0496104_0359048 | 3300048907 | Bacteria | 1369 |
| 508 | Ga0496104_0495658 | 3300048907 | Bacteria | 1133 |
| 509 | Ga0496105_0021155 | 3300048908 | Bacteria | 5261 |
| 510 | Ga0496105_0090827 | 3300048908 | Bacteria | 2522 |
| 511 | Ga0496105_0295772 | 3300048908 | Bacteria | 1303 |
| 512 | Ga0496106_0056755 | 3300048909 | Bacteria | 2960 |
| 513 | Ga0496106_0345717 | 3300048909 | Bacteria | 1195 |
| 514 | Ga0496106_0461435 | 3300048909 | Bacteria | 1020 |
| 515 | Ga0496107_0025842 | 3300048910 | Bacteria | 4160 |
| 516 | Ga0496107_0088214 | 3300048910 | Bacteria | 2265 |
| 517 | Ga0496107_0248037 | 3300048910 | Bacteria | 1325 |
| 518 | Ga0496108_0031097 | 3300048911 | Bacteria | 4427 |
| 519 | Ga0496108_0035103 | 3300048911 | Bacteria | 4167 |
| 520 | Ga0496108_0141781 | 3300048911 | Bacteria | 2071 |
| 521 | Ga0496108_0572521 | 3300048911 | Bacteria | 985 |
| 522 | Ga0496109_0107186 | 3300048912 | Bacteria | 2595 |
| 523 | Ga0496109_0122327 | 3300048912 | Bacteria | 2425 |
| 524 | Ga0496109_0661493 | 3300048912 | Bacteria | 982 |
| 525 | Ga0496110_0028344 | 3300048913 | Bacteria | 4809 |
| 526 | Ga0496110_0119295 | 3300048913 | Bacteria | 2376 |
| 527 | Ga0496110_0130483 | 3300048913 | Bacteria | 2269 |
| 528 | Ga0496111_0179222 | 3300048914 | Bacteria | 1575 |
| 529 | Ga0496111_0181419 | 3300048914 | Bacteria | 1565 |
| 530 | Ga0496111_0189917 | 3300048914 | Bacteria | 1527 |
| 531 | Ga0496112_0027948 | 3300048915 | Bacteria | 5441 |
| 532 | Ga0496112_0187957 | 3300048915 | Bacteria | 2029 |
| 533 | Ga0496113_0047378 | 3300048916 | Bacteria | 3194 |
| 534 | Ga0496113_0050393 | 3300048916 | Bacteria | 3104 |
| 535 | Ga0496113_0908895 | 3300048916 | Unclassified | 696 |
| 536 | Ga0496114_0109518 | 3300048917 | Bacteria | 2365 |
| 537 | Ga0496114_0365864 | 3300048917 | Bacteria | 1276 |
| 538 | Ga0496114_0578663 | 3300048917 | Bacteria | 991 |
| 539 | Ga0496114_1173410 | 3300048917 | Bacteria | 654 |
| 540 | Ga0496115_0000422 | 3300048918 | Bacteria | 34614 |
| 541 | Ga0496115_0100362 | 3300048918 | Bacteria | 2373 |
| 542 | Ga0496115_0536623 | 3300048918 | Bacteria | 936 |
| 543 | Ga0496121_0000214 | 3300048924 | Bacteria | 127349 |
| 544 | Ga0496121_0074968 | 3300048924 | Bacteria | 2704 |
| 545 | Ga0496121_0111691 | 3300048924 | Bacteria | 2083 |
| 546 | Ga0496125_0160215 | 3300048928 | Bacteria | 1530 |
| 547 | Ga0496126_0029624 | 3300048929 | Bacteria | 5198 |
| 548 | Ga0496126_0053231 | 3300048929 | Bacteria | 3673 |
| 549 | Ga0496126_0062434 | 3300048929 | Bacteria | 3343 |
| 550 | Ga0496126_0285606 | 3300048929 | Bacteria | 1366 |
| 551 | Ga0495682_0136717 | 3300049460 | Bacteria | 876 |
| 552 | Ga0501067_0175692 | 3300049583 | Bacteria | 1193 |
| 553 | Ga0501071_0117133 | 3300049587 | Bacteria | 1972 |
| 554 | nmdc:mga03n38_182606_c1 | 3300050490 | Bacteria | 1076 |
| 555 | nmdc:mga03n38_245955_c1 | 3300050490 | Bacteria | 943 |
| 556 | nmdc:mga03n38_290332_c1 | 3300050490 | Bacteria | 875 |
| 557 | nmdc:mga03n38_61415_c1 | 3300050490 | Bacteria | 1711 |
| 558 | nmdc:mga00v17_48296_c1 | 3300050491 | Bacteria | 2579 |
| 559 | nmdc:mga00v17_81879_c1 | 3300050491 | Bacteria | 2017 |
| 560 | nmdc:mga0yw44_117199_c1 | 3300050492 | Bacteria | 1712 |
| 561 | nmdc:mga0yw44_144353_c1 | 3300050492 | Bacteria | 1549 |
| 562 | nmdc:mga0yw44_41893_c1 | 3300050492 | Bacteria | 1977 |
| 563 | nmdc:mga0yw44_501039_c1 | 3300050492 | Bacteria | 824 |
| 564 | nmdc:mga0k408_119032_c1 | 3300050493 | Bacteria | 1563 |
| 565 | nmdc:mga0k408_158460_c1 | 3300050493 | Bacteria | 1348 |
| 566 | nmdc:mga0k408_97380_c1 | 3300050493 | Bacteria | 1732 |
| 567 | nmdc:mga06z11_16904_c1 | 3300050494 | Bacteria | 3298 |
| 568 | nmdc:mga06z11_27540_c1 | 3300050494 | Bacteria | 2717 |
| 569 | nmdc:mga06z11_409540_c1 | 3300050494 | Bacteria | 817 |
| 570 | nmdc:mga06z11_426866_c1 | 3300050494 | Bacteria | 799 |
| 571 | nmdc:mga04h51_10656_c1 | 3300050495 | Bacteria | 2530 |
| 572 | nmdc:mga07m45_104853_c1 | 3300050496 | Bacteria | 1626 |
| 573 | nmdc:mga07m45_14191_c1 | 3300050496 | Bacteria | 4238 |
| 574 | nmdc:mga08y16_190837_c1 | 3300050511 | Bacteria | 2125 |
| 575 | nmdc:mga0n895_103107_c1 | 3300050512 | Bacteria | 2864 |
| 576 | nmdc:mga0n895_1441623_c1 | 3300050512 | Bacteria | 656 |
| 577 | nmdc:mga0n895_167091_c1 | 3300050512 | Bacteria | 2232 |
| 578 | nmdc:mga0rr50_79239_c1 | 3300050513 | Bacteria | 2529 |
| 579 | nmdc:mga0a205_291786_c1 | 3300050515 | Bacteria | 1505 |
| 580 | nmdc:mga0sz30_217479_c1 | 3300050516 | Unclassified | 849 |
| 581 | nmdc:mga0sz30_47966_c1 | 3300050516 | Bacteria | 1806 |
| 582 | Ga0495595_0191846 | 3300053084 | Bacteria | 1016 |
| 583 | Ga0500578_0594892 | 3300053086 | Bacteria | 609 |
| 584 | Ga0500643_000058 | 3300053087 | Bacteria | 130051 |
| 585 | Ga0500641_0000956 | 3300053096 | Bacteria | 10286 |
| 586 | Ga0500641_0006010 | 3300053096 | Bacteria | 4296 |
| 587 | Ga0500650_0308924 | 3300053098 | Bacteria | 698 |
| 588 | Ga0500555_004058 | 3300053103 | Bacteria | 4162 |
| 589 | Ga0500556_0003194 | 3300053104 | Bacteria | 4883 |
| 590 | Ga0500562_031276 | 3300053108 | Unclassified | 1404 |
| 591 | Ga0500562_051932 | 3300053108 | Bacteria | 1097 |
| 592 | Ga0500569_001603 | 3300053109 | Bacteria | 4294 |
| 593 | Ga0500595_006714 | 3300053119 | Bacteria | 4852 |
| 594 | Ga0500658_0253378 | 3300053134 | Bacteria | 809 |
| 595 | Ga0500577_0197621 | 3300053142 | Bacteria | 867 |
| 596 | Ga0500588_0009676 | 3300053146 | Bacteria | 2301 |
| 597 | Ga0500589_017471 | 3300053147 | Bacteria | 3231 |
| 598 | Ga0500616_0005330 | 3300053153 | Bacteria | 8765 |
| 599 | Ga0500620_009594 | 3300053155 | Bacteria | 2506 |
| 600 | Ga0500622_0007353 | 3300053156 | Bacteria | 6264 |
| 601 | Ga0500645_023962 | 3300053730 | Bacteria | 1868 |
| 602 | Ga0500599_004318 | 3300053736 | Bacteria | 1757 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025972 | Ga0207668_10473732 | Ga0207668_104737322 | 161 |
| 2 | 3300026067 | Ga0207678_10393568 | Ga0207678_103935682 | 166 |
| 3 | 3300046615 | Ga0495656_0438943 | Ga0495656_0438943_81_602 | 173 |
| 4 | 3300035691 | Ga0373931_0115979 | Ga0373931_0115979_65_589 | 174 |
| 5 | 3300035695 | Ga0373927_0109131 | Ga0373927_0109131_28_555 | 174 |
| 6 | 3300046660 | Ga0495625_0224173 | Ga0495625_0224173_55_582 | 174 |
| 7 | 3300046674 | Ga0495588_0350488 | Ga0495588_0350488_217_744 | 174 |
| 8 | 3300046809 | Ga0495600_0291532 | Ga0495600_0291532_80_604 | 174 |
| 9 | 3300048904 | Ga0496101_0839939 | Ga0496101_0839939_61_585 | 174 |
| 10 | 3300048910 | Ga0496107_0248037 | Ga0496107_0248037_53_577 | 174 |
| 11 | iso_pu_bacteria | 2824609381 | 2824611793 | 178 |
| 12 | iso_pu_bacteria | 2824653114 | 2824655029 | 178 |
| 13 | iso_pu_bacteria | 2922361189 | 2922366213 | 179 |
| 14 | 3300005337 | Ga0070682_100030872 | Ga0070682_1000308722 | 180 |
| 15 | 3300005338 | Ga0068868_100002640 | Ga0068868_1000026407 | 180 |
| 16 | 3300005344 | Ga0070661_100075348 | Ga0070661_1000753483 | 180 |
| 17 | 3300005347 | Ga0070668_100474916 | Ga0070668_1004749162 | 180 |
| 18 | 3300005354 | Ga0070675_100260644 | Ga0070675_1002606442 | 180 |
| 19 | 3300005364 | Ga0070673_100081240 | Ga0070673_1000812403 | 180 |
| 20 | 3300005437 | Ga0070710_10351926 | Ga0070710_103519262 | 180 |
| 21 | 3300005455 | Ga0070663_100033325 | Ga0070663_1000333253 | 180 |
| 22 | 3300005459 | Ga0068867_100153275 | Ga0068867_1001532752 | 180 |
| 23 | 3300005543 | Ga0070672_100186388 | Ga0070672_1001863882 | 180 |
| 24 | 3300005548 | Ga0070665_100079071 | Ga0070665_1000790713 | 180 |
| 25 | 3300005564 | Ga0070664_100037752 | Ga0070664_1000377523 | 180 |
| 26 | 3300006358 | Ga0068871_100053388 | Ga0068871_1000533885 | 180 |
| 27 | 3300006881 | Ga0068865_100026281 | Ga0068865_1000262813 | 180 |
| 28 | 3300009098 | Ga0105245_10194066 | Ga0105245_101940662 | 180 |
| 29 | 3300009176 | Ga0105242_10059491 | Ga0105242_100594914 | 180 |
| 30 | 3300010375 | Ga0105239_10038676 | Ga0105239_100386762 | 180 |
| 31 | 3300013296 | Ga0157374_10015082 | Ga0157374_100150822 | 180 |
| 32 | 3300013306 | Ga0163162_10013299 | Ga0163162_100132995 | 180 |
| 33 | 3300014969 | Ga0157376_10062862 | Ga0157376_100628623 | 180 |
| 34 | 3300017792 | Ga0163161_10277091 | Ga0163161_102770912 | 180 |
| 35 | 3300025315 | Ga0207697_10119652 | Ga0207697_101196522 | 180 |
| 36 | 3300025901 | Ga0207688_10180408 | Ga0207688_101804081 | 180 |
| 37 | 3300025926 | Ga0207659_10310545 | Ga0207659_103105452 | 180 |
| 38 | 3300025927 | Ga0207687_10052096 | Ga0207687_100520963 | 180 |
| 39 | 3300025931 | Ga0207644_10268448 | Ga0207644_102684481 | 180 |
| 40 | 3300025940 | Ga0207691_10073734 | Ga0207691_100737342 | 180 |
| 41 | 3300026067 | Ga0207678_10011829 | Ga0207678_100118296 | 180 |
| 42 | 3300041512 | Ga0451853_2046610 | Ga0451853_2046610_2021_2563 | 180 |
| 43 | 3300048904 | Ga0496101_0046223 | Ga0496101_0046223_610_1152 | 180 |
| 44 | 3300048905 | Ga0496102_0001939 | Ga0496102_0001939_4072_4614 | 180 |
| 45 | 3300048906 | Ga0496103_0080902 | Ga0496103_0080902_735_1277 | 180 |
| 46 | 3300048907 | Ga0496104_0024496 | Ga0496104_0024496_3427_3969 | 180 |
| 47 | 3300048908 | Ga0496105_0021155 | Ga0496105_0021155_2475_3017 | 180 |
| 48 | 3300048909 | Ga0496106_0056755 | Ga0496106_0056755_779_1321 | 180 |
| 49 | 3300048910 | Ga0496107_0025842 | Ga0496107_0025842_2680_3222 | 180 |
| 50 | 3300048913 | Ga0496110_0028344 | Ga0496110_0028344_623_1165 | 180 |
| 51 | 3300048915 | Ga0496112_0027948 | Ga0496112_0027948_2245_2787 | 180 |
| 52 | 3300048918 | Ga0496115_0000422 | Ga0496115_0000422_22991_23533 | 180 |
| 53 | 3300013297 | Ga0157378_10034431 | Ga0157378_100344313 | 181 |
| 54 | 3300014325 | Ga0163163_10539807 | Ga0163163_105398072 | 181 |
| 55 | 3300025945 | Ga0207679_10048458 | Ga0207679_100484582 | 181 |
| 56 | 3300047320 | Ga0495672_0424622 | Ga0495672_0424622_45_590 | 181 |
| 57 | 3300047469 | Ga0495673_0081312 | Ga0495673_0081312_415_960 | 181 |
| 58 | 3300048911 | Ga0496108_0035103 | Ga0496108_0035103_2042_2587 | 181 |
| 59 | 3300048912 | Ga0496109_0107186 | Ga0496109_0107186_286_831 | 181 |
| 60 | 3300048916 | Ga0496113_0047378 | Ga0496113_0047378_1857_2402 | 181 |
| 61 | iso_pu_bacteria | 2904690495 | 2904691648 | 181 |
| 62 | iso_pu_bacteria | 2908756301 | 2908763734 | 181 |
| 63 | 3300046513 | Ga0495616_0152898 | Ga0495616_0152898_429_980 | 183 |
| 64 | 3300046523 | Ga0495644_0091837 | Ga0495644_0091837_34_585 | 183 |
| 65 | 3300048916 | Ga0496113_0908895 | Ga0496113_0908895_63_614 | 183 |
| 66 | 3300048917 | Ga0496114_0578663 | Ga0496114_0578663_41_592 | 183 |
| 67 | 3300048917 | Ga0496114_1173410 | Ga0496114_1173410_78_629 | 183 |
| 68 | 3300050512 | nmdc:mga0n895_1441623_c1 | nmdc:mga0n895_1441623_c1_20_571 | 183 |
| 69 | 3300053084 | Ga0495595_0191846 | Ga0495595_0191846_352_909 | 185 |
| 70 | 3300025294 | Ga0209025_1055542 | Ga0209025_10555422 | 186 |
| 71 | 3300005455 | Ga0070663_100339823 | Ga0070663_1003398232 | 187 |
| 72 | 3300028379 | Ga0268266_10375620 | Ga0268266_103756202 | 187 |
| 73 | 3300010375 | Ga0105239_11021427 | Ga0105239_110214272 | 188 |
| 74 | 3300005578 | Ga0068854_100162464 | Ga0068854_1001624643 | 189 |
| 75 | 3300006163 | Ga0070715_10292425 | Ga0070715_102924251 | 189 |
| 76 | 3300053086 | Ga0500578_0594892 | Ga0500578_0594892_24_596 | 190 |
| 77 | 3300053156 | Ga0500622_0007353 | Ga0500622_0007353_5675_6247 | 190 |
| 78 | 3300005331 | Ga0070670_100080989 | Ga0070670_1000809893 | 191 |
| 79 | 3300005334 | Ga0068869_100070955 | Ga0068869_1000709553 | 191 |
| 80 | 3300005336 | Ga0070680_100710243 | Ga0070680_1007102432 | 191 |
| 81 | 3300005344 | Ga0070661_100119690 | Ga0070661_1001196903 | 191 |
| 82 | 3300005347 | Ga0070668_100016139 | Ga0070668_1000161394 | 191 |
| 83 | 3300005353 | Ga0070669_100319674 | Ga0070669_1003196742 | 191 |
| 84 | 3300005354 | Ga0070675_100152255 | Ga0070675_1001522551 | 191 |
| 85 | 3300005355 | Ga0070671_100013730 | Ga0070671_1000137302 | 191 |
| 86 | 3300005366 | Ga0070659_100126673 | Ga0070659_1001266733 | 191 |
| 87 | 3300005455 | Ga0070663_100011200 | Ga0070663_1000112003 | 191 |
| 88 | 3300005457 | Ga0070662_100041247 | Ga0070662_1000412472 | 191 |
| 89 | 3300005539 | Ga0068853_100136426 | Ga0068853_1001364261 | 191 |
| 90 | 3300005543 | Ga0070672_100123736 | Ga0070672_1001237362 | 191 |
| 91 | 3300005544 | Ga0070686_100356323 | Ga0070686_1003563232 | 191 |
| 92 | 3300005546 | Ga0070696_100139962 | Ga0070696_1001399622 | 191 |
| 93 | 3300005547 | Ga0070693_100328556 | Ga0070693_1003285562 | 191 |
| 94 | 3300005548 | Ga0070665_100012477 | Ga0070665_1000124775 | 191 |
| 95 | 3300005563 | Ga0068855_100145101 | Ga0068855_1001451013 | 191 |
| 96 | 3300005577 | Ga0068857_100082333 | Ga0068857_1000823333 | 191 |
| 97 | 3300005614 | Ga0068856_100109763 | Ga0068856_1001097632 | 191 |
| 98 | 3300005615 | Ga0070702_100017245 | Ga0070702_1000172453 | 191 |
| 99 | 3300005616 | Ga0068852_100036443 | Ga0068852_1000364432 | 191 |
| 100 | 3300005617 | Ga0068859_100038727 | Ga0068859_1000387274 | 191 |
| 101 | 3300005618 | Ga0068864_100022449 | Ga0068864_1000224494 | 191 |
| 102 | 3300005719 | Ga0068861_100011149 | Ga0068861_1000111494 | 191 |
| 103 | 3300005840 | Ga0068870_10014095 | Ga0068870_100140954 | 191 |
| 104 | 3300005841 | Ga0068863_100024757 | Ga0068863_1000247575 | 191 |
| 105 | 3300005842 | Ga0068858_100162906 | Ga0068858_1001629062 | 191 |
| 106 | 3300005843 | Ga0068860_100133926 | Ga0068860_1001339262 | 191 |
| 107 | 3300005844 | Ga0068862_100052693 | Ga0068862_1000526932 | 191 |
| 108 | 3300006048 | Ga0075363_100011979 | Ga0075363_1000119794 | 191 |
| 109 | 3300006051 | Ga0075364_10030478 | Ga0075364_100304784 | 191 |
| 110 | 3300006186 | Ga0075369_10021586 | Ga0075369_100215862 | 191 |
| 111 | 3300006237 | Ga0097621_100015958 | Ga0097621_1000159587 | 191 |
| 112 | 3300006353 | Ga0075370_10072218 | Ga0075370_100722182 | 191 |
| 113 | 3300006852 | Ga0075433_10332678 | Ga0075433_103326782 | 191 |
| 114 | 3300006881 | Ga0068865_100089001 | Ga0068865_1000890013 | 191 |
| 115 | 3300006931 | Ga0097620_100038730 | Ga0097620_1000387304 | 191 |
| 116 | 3300009093 | Ga0105240_10247035 | Ga0105240_102470352 | 191 |
| 117 | 3300009094 | Ga0111539_11197047 | Ga0111539_111970471 | 191 |
| 118 | 3300009098 | Ga0105245_10043059 | Ga0105245_100430593 | 191 |
| 119 | 3300009101 | Ga0105247_10034503 | Ga0105247_100345033 | 191 |
| 120 | 3300009148 | Ga0105243_10177477 | Ga0105243_101774772 | 191 |
| 121 | 3300009174 | Ga0105241_10012171 | Ga0105241_100121715 | 191 |
| 122 | 3300009177 | Ga0105248_10010641 | Ga0105248_1001064111 | 191 |
| 123 | 3300009545 | Ga0105237_10062317 | Ga0105237_100623173 | 191 |
| 124 | 3300009551 | Ga0105238_10025189 | Ga0105238_100251895 | 191 |
| 125 | 3300011119 | Ga0105246_10019408 | Ga0105246_100194083 | 191 |
| 126 | 3300013296 | Ga0157374_10073303 | Ga0157374_100733033 | 191 |
| 127 | 3300013306 | Ga0163162_10830600 | Ga0163162_108306002 | 191 |
| 128 | 3300014325 | Ga0163163_10021051 | Ga0163163_100210517 | 191 |
| 129 | 3300014968 | Ga0157379_10112244 | Ga0157379_101122443 | 191 |
| 130 | 3300014969 | Ga0157376_10243096 | Ga0157376_102430962 | 191 |
| 131 | 3300025900 | Ga0207710_10022382 | Ga0207710_100223823 | 191 |
| 132 | 3300025901 | Ga0207688_10009511 | Ga0207688_100095115 | 191 |
| 133 | 3300025904 | Ga0207647_10086574 | Ga0207647_100865742 | 191 |
| 134 | 3300025908 | Ga0207643_10042602 | Ga0207643_100426022 | 191 |
| 135 | 3300025913 | Ga0207695_10450562 | Ga0207695_104505622 | 191 |
| 136 | 3300025914 | Ga0207671_10006919 | Ga0207671_100069194 | 191 |
| 137 | 3300025924 | Ga0207694_10772142 | Ga0207694_107721422 | 191 |
| 138 | 3300025925 | Ga0207650_10059961 | Ga0207650_100599613 | 191 |
| 139 | 3300025927 | Ga0207687_10111332 | Ga0207687_101113322 | 191 |
| 140 | 3300025933 | Ga0207706_10036435 | Ga0207706_100364353 | 191 |
| 141 | 3300025938 | Ga0207704_10036623 | Ga0207704_100366233 | 191 |
| 142 | 3300025941 | Ga0207711_10046563 | Ga0207711_100465634 | 191 |
| 143 | 3300025942 | Ga0207689_10021863 | Ga0207689_100218633 | 191 |
| 144 | 3300025945 | Ga0207679_10145791 | Ga0207679_101457912 | 191 |
| 145 | 3300025949 | Ga0207667_10087440 | Ga0207667_100874404 | 191 |
| 146 | 3300025972 | Ga0207668_10011873 | Ga0207668_100118734 | 191 |
| 147 | 3300026023 | Ga0207677_10156196 | Ga0207677_101561963 | 191 |
| 148 | 3300026041 | Ga0207639_10186586 | Ga0207639_101865861 | 191 |
| 149 | 3300026067 | Ga0207678_10017970 | Ga0207678_100179705 | 191 |
| 150 | 3300026078 | Ga0207702_10086059 | Ga0207702_100860592 | 191 |
| 151 | 3300026088 | Ga0207641_11245833 | Ga0207641_112458331 | 191 |
| 152 | 3300026116 | Ga0207674_10119773 | Ga0207674_101197733 | 191 |
| 153 | 3300026118 | Ga0207675_100024265 | Ga0207675_1000242654 | 191 |
| 154 | 3300026142 | Ga0207698_10598959 | Ga0207698_105989592 | 191 |
| 155 | 3300027866 | Ga0209813_10004746 | Ga0209813_100047462 | 191 |
| 156 | 3300048905 | Ga0496102_0065140 | Ga0496102_0065140_1193_1825 | 191 |
| 157 | 3300048910 | Ga0496107_0088214 | Ga0496107_0088214_1252_1884 | 191 |
| 158 | 3300048911 | Ga0496108_0031097 | Ga0496108_0031097_1734_2366 | 191 |
| 159 | 3300048914 | Ga0496111_0179222 | Ga0496111_0179222_467_1099 | 191 |
| 160 | 3300048924 | Ga0496121_0111691 | Ga0496121_0111691_1412_2044 | 191 |
| 161 | 3300048928 | Ga0496125_0160215 | Ga0496125_0160215_390_1022 | 191 |
| 162 | 3300048929 | Ga0496126_0062434 | Ga0496126_0062434_1841_2473 | 191 |
| 163 | 3300049583 | Ga0501067_0175692 | Ga0501067_0175692_166_741 | 191 |
| 164 | 3300050494 | nmdc:mga06z11_409540_c1 | nmdc:mga06z11_409540_c1_37_669 | 191 |
| 165 | 3300050495 | nmdc:mga04h51_10656_c1 | nmdc:mga04h51_10656_c1_1768_2400 | 191 |
| 166 | 3300050496 | nmdc:mga07m45_104853_c1 | nmdc:mga07m45_104853_c1_40_672 | 191 |
| 167 | 3300050512 | nmdc:mga0n895_167091_c1 | nmdc:mga0n895_167091_c1_1334_1966 | 191 |
| 168 | 3300050515 | nmdc:mga0a205_291786_c1 | nmdc:mga0a205_291786_c1_733_1365 | 191 |
| 169 | iso_pu_bacteria | 2885383462 | 2885387168 | 192 |
| 170 | 3300009094 | Ga0111539_10291568 | Ga0111539_102915682 | 193 |
| 171 | 3300026118 | Ga0207675_100319449 | Ga0207675_1003194492 | 193 |
| 172 | 3300027907 | Ga0207428_10116806 | Ga0207428_101168062 | 193 |
| 173 | 3300050511 | nmdc:mga08y16_190837_c1 | nmdc:mga08y16_190837_c1_1039_1671 | 193 |
| 174 | 3300009094 | Ga0111539_10698901 | Ga0111539_106989012 | 194 |
| 175 | 3300010375 | Ga0105239_10000778 | Ga0105239_1000077821 | 196 |
| 176 | 3300038443 | Ga0395901_0179763 | Ga0395901_0179763_851_1480 | 197 |
| 177 | 3300048908 | Ga0496105_0295772 | Ga0496105_0295772_571_1164 | 197 |
| 178 | 3300005334 | Ga0068869_100272433 | Ga0068869_1002724332 | 198 |
| 179 | 3300005356 | Ga0070674_100366756 | Ga0070674_1003667562 | 198 |
| 180 | 3300005548 | Ga0070665_100377182 | Ga0070665_1003771822 | 198 |
| 181 | 3300005718 | Ga0068866_10119239 | Ga0068866_101192392 | 198 |
| 182 | 3300005719 | Ga0068861_100735825 | Ga0068861_1007358251 | 198 |
| 183 | 3300005843 | Ga0068860_100247061 | Ga0068860_1002470612 | 198 |
| 184 | 3300014969 | Ga0157376_10513778 | Ga0157376_105137782 | 198 |
| 185 | 3300025899 | Ga0207642_10076826 | Ga0207642_100768262 | 198 |
| 186 | 3300025931 | Ga0207644_10284676 | Ga0207644_102846762 | 198 |
| 187 | 3300025937 | Ga0207669_10123134 | Ga0207669_101231341 | 198 |
| 188 | 3300025942 | Ga0207689_10216795 | Ga0207689_102167952 | 198 |
| 189 | 3300028379 | Ga0268266_10419102 | Ga0268266_104191022 | 198 |
| 190 | 3300025940 | Ga0207691_10135105 | Ga0207691_101351053 | 199 |
| 191 | iso_pu_bacteria | 2922386360 | 2922386716 | 199 |
| 192 | 3300009551 | Ga0105238_10124257 | Ga0105238_101242573 | 200 |
| 193 | 3300047315 | Ga0495581_0372224 | Ga0495581_0372224_14_616 | 200 |
| 194 | iso_pu_bacteria | 2824773399 | 2824776665 | 201 |
| 195 | 3300005338 | Ga0068868_100648905 | Ga0068868_1006489051 | 202 |
| 196 | 3300005356 | Ga0070674_100287602 | Ga0070674_1002876022 | 202 |
| 197 | 3300005367 | Ga0070667_100785051 | Ga0070667_1007850511 | 202 |
| 198 | 3300005719 | Ga0068861_100105212 | Ga0068861_1001052124 | 202 |
| 199 | 3300006881 | Ga0068865_100091319 | Ga0068865_1000913193 | 202 |
| 200 | 3300009098 | Ga0105245_10903266 | Ga0105245_109032661 | 202 |
| 201 | 3300013306 | Ga0163162_10066991 | Ga0163162_100669915 | 202 |
| 202 | 3300025933 | Ga0207706_10169767 | Ga0207706_101697672 | 202 |
| 203 | 3300025935 | Ga0207709_10050861 | Ga0207709_100508613 | 202 |
| 204 | 3300025937 | Ga0207669_10242644 | Ga0207669_102426442 | 202 |
| 205 | 3300026023 | Ga0207677_10337662 | Ga0207677_103376622 | 202 |
| 206 | 3300026118 | Ga0207675_100017302 | Ga0207675_1000173022 | 202 |
| 207 | 3300026121 | Ga0207683_10498581 | Ga0207683_104985812 | 202 |
| 208 | 3300035695 | Ga0373927_0438726 | Ga0373927_0438726_76_702 | 202 |
| 209 | 3300046526 | Ga0495666_0070668 | Ga0495666_0070668_762_1388 | 202 |
| 210 | 3300013308 | Ga0157375_11242775 | Ga0157375_112427751 | 203 |
| 211 | 3300028379 | Ga0268266_10221468 | Ga0268266_102214682 | 203 |
| 212 | 3300048912 | Ga0496109_0661493 | Ga0496109_0661493_144_797 | 203 |
| 213 | iso_pu_bacteria | 8006964411 | 8006966090 | 203 |
| 214 | iso_pu_bacteria | 8056673599 | 8056678798 | 203 |
| 215 | 3300026067 | Ga0207678_10160149 | Ga0207678_101601492 | 204 |
| 216 | 3300047320 | Ga0495672_0044480 | Ga0495672_0044480_1031_1645 | 204 |
| 217 | iso_pu_bacteria | 2513237101 | 2513692951 | 204 |
| 218 | iso_pu_bacteria | 2524023210 | 2524467105 | 204 |
| 219 | iso_pu_bacteria | 2889033259 | 2889033415 | 204 |
| 220 | iso_pu_bacteria | 8006994254 | 8006997262 | 204 |
| 221 | 3300003659 | JGI25404J52841_10000073 | JGI25404J52841_100000738 | 205 |
| 222 | 3300005356 | Ga0070674_100426826 | Ga0070674_1004268262 | 205 |
| 223 | 3300005983 | Ga0081540_1003974 | Ga0081540_10039746 | 205 |
| 224 | 3300013306 | Ga0163162_10371334 | Ga0163162_103713342 | 205 |
| 225 | 3300025940 | Ga0207691_10129284 | Ga0207691_101292842 | 205 |
| 226 | 3300026067 | Ga0207678_10060310 | Ga0207678_100603102 | 205 |
| 227 | 3300026095 | Ga0207676_10468673 | Ga0207676_104686731 | 205 |
| 228 | 3300049587 | Ga0501071_0117133 | Ga0501071_0117133_1147_1764 | 205 |
| 229 | iso_pu_bacteria | 2513237098 | 2513672782 | 205 |
| 230 | iso_pu_bacteria | 2513237139 | 2513878345 | 205 |
| 231 | iso_pu_bacteria | 2513237161 | 2514011727 | 205 |
| 232 | iso_pu_bacteria | 2617270735 | 2617352729 | 205 |
| 233 | iso_pu_bacteria | 2617270741 | 2617372927 | 205 |
| 234 | iso_pu_bacteria | 2802429603 | 2805920568 | 205 |
| 235 | iso_pu_bacteria | 2824671348 | 2824672311 | 205 |
| 236 | iso_pu_bacteria | 2824679649 | 2824682281 | 205 |
| 237 | iso_pu_bacteria | 2824687955 | 2824688806 | 205 |
| 238 | iso_pu_bacteria | 2824696289 | 2824702184 | 205 |
| 239 | iso_pu_bacteria | 2824732956 | 2824737670 | 205 |
| 240 | iso_pu_bacteria | 2824746037 | 2824752452 | 205 |
| 241 | iso_pu_bacteria | 2838122688 | 2838127387 | 205 |
| 242 | iso_pu_bacteria | 2841941048 | 2841946406 | 205 |
| 243 | iso_pu_bacteria | 2841949485 | 2841957124 | 205 |
| 244 | iso_pu_bacteria | 2841966195 | 2841972916 | 205 |
| 245 | iso_pu_bacteria | 2841974524 | 2841978412 | 205 |
| 246 | iso_pu_bacteria | 2841983080 | 2841987486 | 205 |
| 247 | iso_pu_bacteria | 2847930680 | 2847937527 | 205 |
| 248 | iso_pu_bacteria | 2847939898 | 2847947949 | 205 |
| 249 | iso_pu_bacteria | 2874612657 | 2874616772 | 205 |
| 250 | iso_pu_bacteria | 2874620515 | 2874628277 | 205 |
| 251 | iso_pu_bacteria | 2879083081 | 2879084940 | 205 |
| 252 | iso_pu_bacteria | 2881364244 | 2881370104 | 205 |
| 253 | iso_pu_bacteria | 2881665667 | 2881670106 | 205 |
| 254 | iso_pu_bacteria | 2885366525 | 2885370164 | 205 |
| 255 | iso_pu_bacteria | 2903768456 | 2903775401 | 205 |
| 256 | iso_pu_bacteria | 2904666416 | 2904674104 | 205 |
| 257 | iso_pu_bacteria | 2906643746 | 2906645519 | 205 |
| 258 | iso_pu_bacteria | 2908775508 | 2908781376 | 205 |
| 259 | iso_pu_bacteria | 2922393267 | 2922396873 | 205 |
| 260 | iso_pu_bacteria | 2935769743 | 2935772777 | 205 |
| 261 | iso_pu_bacteria | 2935777560 | 2935778086 | 205 |
| 262 | iso_pu_bacteria | 2935785616 | 2935787314 | 205 |
| 263 | iso_pu_bacteria | 2935793552 | 2935795898 | 205 |
| 264 | iso_pu_bacteria | 8016522445 | 8016526603 | 205 |
| 265 | iso_pu_bacteria | 8016530956 | 8016531689 | 205 |
| 266 | iso_pu_bacteria | 8016539877 | 8016544886 | 205 |
| 267 | iso_pu_bacteria | 8016548790 | 8016557190 | 205 |
| 268 | iso_pu_bacteria | 8016557553 | 8016565541 | 205 |
| 269 | iso_pu_bacteria | 8016566248 | 8016569957 | 205 |
| 270 | iso_pu_bacteria | 8016575299 | 8016582536 | 205 |
| 271 | iso_pu_bacteria | 8016595262 | 8016603160 | 205 |
| 272 | iso_pu_bacteria | 8016603502 | 8016606077 | 205 |
| 273 | iso_pu_bacteria | 8016613128 | 8016617959 | 205 |
| 274 | iso_pu_bacteria | 8016622563 | 8016623613 | 205 |
| 275 | iso_pu_bacteria | 8019538911 | 8019540022 | 205 |
| 276 | iso_pu_bacteria | 8019547302 | 8019550634 | 205 |
| 277 | iso_pu_bacteria | 8056681323 | 8056689056 | 205 |
| 278 | 3300005439 | Ga0070711_100348999 | Ga0070711_1003489992 | 206 |
| 279 | 3300005456 | Ga0070678_100648841 | Ga0070678_1006488411 | 206 |
| 280 | 3300005545 | Ga0070695_100378451 | Ga0070695_1003784511 | 206 |
| 281 | 3300005718 | Ga0068866_10135098 | Ga0068866_101350982 | 206 |
| 282 | 3300006175 | Ga0070712_100394774 | Ga0070712_1003947742 | 206 |
| 283 | 3300006358 | Ga0068871_100849827 | Ga0068871_1008498272 | 206 |
| 284 | 3300013308 | Ga0157375_11628512 | Ga0157375_116285122 | 206 |
| 285 | 3300025915 | Ga0207693_10370041 | Ga0207693_103700411 | 206 |
| 286 | 3300026121 | Ga0207683_10067081 | Ga0207683_100670812 | 206 |
| 287 | 3300048905 | Ga0496102_0425365 | Ga0496102_0425365_261_881 | 206 |
| 288 | 3300048907 | Ga0496104_0359048 | Ga0496104_0359048_736_1356 | 206 |
| 289 | 3300048909 | Ga0496106_0461435 | Ga0496106_0461435_42_662 | 206 |
| 290 | 3300048918 | Ga0496115_0536623 | Ga0496115_0536623_257_877 | 206 |
| 291 | 3300005330 | Ga0070690_100384318 | Ga0070690_1003843181 | 207 |
| 292 | 3300005347 | Ga0070668_100084085 | Ga0070668_1000840852 | 207 |
| 293 | 3300005548 | Ga0070665_100000907 | Ga0070665_10000090721 | 207 |
| 294 | 3300005844 | Ga0068862_101082315 | Ga0068862_1010823152 | 207 |
| 295 | 3300005937 | Ga0081455_10023565 | Ga0081455_100235657 | 207 |
| 296 | 3300005981 | Ga0081538_10018086 | Ga0081538_100180866 | 207 |
| 297 | 3300006038 | Ga0075365_10100784 | Ga0075365_101007843 | 207 |
| 298 | 3300006178 | Ga0075367_10027318 | Ga0075367_100273183 | 207 |
| 299 | 3300006195 | Ga0075366_10094557 | Ga0075366_100945572 | 207 |
| 300 | 3300009174 | Ga0105241_10252256 | Ga0105241_102522562 | 207 |
| 301 | 3300009553 | Ga0105249_10218823 | Ga0105249_102188232 | 207 |
| 302 | 3300014326 | Ga0157380_10122627 | Ga0157380_101226273 | 207 |
| 303 | 3300025972 | Ga0207668_10064080 | Ga0207668_100640802 | 207 |
| 304 | 3300026075 | Ga0207708_10179324 | Ga0207708_101793242 | 207 |
| 305 | 3300028379 | Ga0268266_10025774 | Ga0268266_100257742 | 207 |
| 306 | 3300028786 | Ga0307517_10324536 | Ga0307517_103245362 | 207 |
| 307 | 3300031730 | Ga0307516_10024698 | Ga0307516_100246984 | 207 |
| 308 | 3300032126 | Ga0307415_100037464 | Ga0307415_1000374643 | 207 |
| 309 | 3300033180 | Ga0307510_10028462 | Ga0307510_100284622 | 207 |
| 310 | 3300044658 | Ga0466972_0004993 | Ga0466972_0004993_1935_2558 | 207 |
| 311 | 3300044901 | Ga0466960_0022513 | Ga0466960_0022513_408_1031 | 207 |
| 312 | 3300046460 | Ga0495638_0016005 | Ga0495638_0016005_3740_4363 | 207 |
| 313 | 3300046542 | Ga0495597_0061929 | Ga0495597_0061929_724_1350 | 207 |
| 314 | 3300046648 | Ga0495611_0052079 | Ga0495611_0052079_735_1358 | 207 |
| 315 | 3300046660 | Ga0495625_0056559 | Ga0495625_0056559_711_1334 | 207 |
| 316 | 3300047469 | Ga0495673_0069300 | Ga0495673_0069300_433_1056 | 207 |
| 317 | 3300048929 | Ga0496126_0029624 | Ga0496126_0029624_2619_3242 | 207 |
| 318 | 3300050492 | nmdc:mga0yw44_41893_c1 | nmdc:mga0yw44_41893_c1_211_834 | 207 |
| 319 | 3300050493 | nmdc:mga0k408_97380_c1 | nmdc:mga0k408_97380_c1_390_1013 | 207 |
| 320 | 3300050494 | nmdc:mga06z11_16904_c1 | nmdc:mga06z11_16904_c1_1017_1640 | 207 |
| 321 | 3300050496 | nmdc:mga07m45_14191_c1 | nmdc:mga07m45_14191_c1_2348_2971 | 207 |
| 322 | 3300050513 | nmdc:mga0rr50_79239_c1 | nmdc:mga0rr50_79239_c1_148_771 | 207 |
| 323 | 3300050516 | nmdc:mga0sz30_217479_c1 | nmdc:mga0sz30_217479_c1_151_774 | 207 |
| 324 | 3300053087 | Ga0500643_000058 | Ga0500643_000058_98040_98663 | 207 |
| 325 | 3300053098 | Ga0500650_0308924 | Ga0500650_0308924_33_656 | 207 |
| 326 | 3300053103 | Ga0500555_004058 | Ga0500555_004058_776_1399 | 207 |
| 327 | 3300053104 | Ga0500556_0003194 | Ga0500556_0003194_2754_3377 | 207 |
| 328 | 3300053108 | Ga0500562_031276 | Ga0500562_031276_419_1042 | 207 |
| 329 | 3300053108 | Ga0500562_051932 | Ga0500562_051932_162_785 | 207 |
| 330 | 3300053109 | Ga0500569_001603 | Ga0500569_001603_529_1152 | 207 |
| 331 | 3300053134 | Ga0500658_0253378 | Ga0500658_0253378_28_651 | 207 |
| 332 | 3300053142 | Ga0500577_0197621 | Ga0500577_0197621_140_763 | 207 |
| 333 | 3300053146 | Ga0500588_0009676 | Ga0500588_0009676_175_798 | 207 |
| 334 | 3300053153 | Ga0500616_0005330 | Ga0500616_0005330_2336_2959 | 207 |
| 335 | 3300053730 | Ga0500645_023962 | Ga0500645_023962_79_702 | 207 |
| 336 | 3300053736 | Ga0500599_004318 | Ga0500599_004318_355_978 | 207 |
| 337 | 3300002244 | JGI24742J22300_10017981 | JGI24742J22300_100179812 | 208 |
| 338 | 3300003659 | JGI25404J52841_10018614 | JGI25404J52841_100186142 | 208 |
| 339 | 3300005329 | Ga0070683_100228272 | Ga0070683_1002282722 | 208 |
| 340 | 3300005330 | Ga0070690_100218738 | Ga0070690_1002187382 | 208 |
| 341 | 3300005335 | Ga0070666_10086780 | Ga0070666_100867802 | 208 |
| 342 | 3300005337 | Ga0070682_100732652 | Ga0070682_1007326521 | 208 |
| 343 | 3300005338 | Ga0068868_100430015 | Ga0068868_1004300152 | 208 |
| 344 | 3300005340 | Ga0070689_100480329 | Ga0070689_1004803291 | 208 |
| 345 | 3300005341 | Ga0070691_10218046 | Ga0070691_102180462 | 208 |
| 346 | 3300005347 | Ga0070668_100017881 | Ga0070668_1000178815 | 208 |
| 347 | 3300005347 | Ga0070668_100040249 | Ga0070668_1000402492 | 208 |
| 348 | 3300005347 | Ga0070668_100242384 | Ga0070668_1002423842 | 208 |
| 349 | 3300005356 | Ga0070674_100344533 | Ga0070674_1003445331 | 208 |
| 350 | 3300005356 | Ga0070674_100748366 | Ga0070674_1007483661 | 208 |
| 351 | 3300005441 | Ga0070700_100090789 | Ga0070700_1000907892 | 208 |
| 352 | 3300005444 | Ga0070694_100520767 | Ga0070694_1005207672 | 208 |
| 353 | 3300005455 | Ga0070663_100029062 | Ga0070663_1000290624 | 208 |
| 354 | 3300005455 | Ga0070663_100117018 | Ga0070663_1001170183 | 208 |
| 355 | 3300005456 | Ga0070678_100289729 | Ga0070678_1002897292 | 208 |
| 356 | 3300005457 | Ga0070662_100215243 | Ga0070662_1002152432 | 208 |
| 357 | 3300005458 | Ga0070681_10061902 | Ga0070681_100619022 | 208 |
| 358 | 3300005459 | Ga0068867_100090574 | Ga0068867_1000905743 | 208 |
| 359 | 3300005459 | Ga0068867_100152489 | Ga0068867_1001524892 | 208 |
| 360 | 3300005539 | Ga0068853_100446633 | Ga0068853_1004466332 | 208 |
| 361 | 3300005544 | Ga0070686_100123848 | Ga0070686_1001238482 | 208 |
| 362 | 3300005544 | Ga0070686_100193888 | Ga0070686_1001938882 | 208 |
| 363 | 3300005718 | Ga0068866_10031988 | Ga0068866_100319882 | 208 |
| 364 | 3300005718 | Ga0068866_10209068 | Ga0068866_102090682 | 208 |
| 365 | 3300005719 | Ga0068861_100082171 | Ga0068861_1000821712 | 208 |
| 366 | 3300005719 | Ga0068861_100724529 | Ga0068861_1007245291 | 208 |
| 367 | 3300005842 | Ga0068858_101134748 | Ga0068858_1011347481 | 208 |
| 368 | 3300005843 | Ga0068860_100369245 | Ga0068860_1003692452 | 208 |
| 369 | 3300005843 | Ga0068860_100497713 | Ga0068860_1004977132 | 208 |
| 370 | 3300005844 | Ga0068862_100061636 | Ga0068862_1000616362 | 208 |
| 371 | 3300005983 | Ga0081540_1006148 | Ga0081540_10061485 | 208 |
| 372 | 3300005983 | Ga0081540_1017945 | Ga0081540_10179453 | 208 |
| 373 | 3300005983 | Ga0081540_1027706 | Ga0081540_10277063 | 208 |
| 374 | 3300005983 | Ga0081540_1093100 | Ga0081540_10931002 | 208 |
| 375 | 3300006163 | Ga0070715_10043602 | Ga0070715_100436022 | 208 |
| 376 | 3300006175 | Ga0070712_100448735 | Ga0070712_1004487351 | 208 |
| 377 | 3300006844 | Ga0075428_100894342 | Ga0075428_1008943422 | 208 |
| 378 | 3300006881 | Ga0068865_100020402 | Ga0068865_10002040210 | 208 |
| 379 | 3300006881 | Ga0068865_100235837 | Ga0068865_1002358373 | 208 |
| 380 | 3300006881 | Ga0068865_100375056 | Ga0068865_1003750562 | 208 |
| 381 | 3300007076 | Ga0075435_100199905 | Ga0075435_1001999052 | 208 |
| 382 | 3300009093 | Ga0105240_10244052 | Ga0105240_102440522 | 208 |
| 383 | 3300009098 | Ga0105245_10052458 | Ga0105245_100524583 | 208 |
| 384 | 3300009098 | Ga0105245_10094116 | Ga0105245_100941162 | 208 |
| 385 | 3300009176 | Ga0105242_10180639 | Ga0105242_101806392 | 208 |
| 386 | 3300009176 | Ga0105242_10727310 | Ga0105242_107273102 | 208 |
| 387 | 3300009545 | Ga0105237_10013986 | Ga0105237_100139866 | 208 |
| 388 | 3300009551 | Ga0105238_10011512 | Ga0105238_100115127 | 208 |
| 389 | 3300009553 | Ga0105249_10114180 | Ga0105249_101141802 | 208 |
| 390 | 3300009553 | Ga0105249_10362195 | Ga0105249_103621952 | 208 |
| 391 | 3300009553 | Ga0105249_10374406 | Ga0105249_103744062 | 208 |
| 392 | 3300010375 | Ga0105239_10034155 | Ga0105239_100341554 | 208 |
| 393 | 3300013105 | Ga0157369_10447405 | Ga0157369_104474052 | 208 |
| 394 | 3300013296 | Ga0157374_10013084 | Ga0157374_100130845 | 208 |
| 395 | 3300013297 | Ga0157378_10123194 | Ga0157378_101231943 | 208 |
| 396 | 3300013297 | Ga0157378_10489770 | Ga0157378_104897702 | 208 |
| 397 | 3300013306 | Ga0163162_10113952 | Ga0163162_101139523 | 208 |
| 398 | 3300013306 | Ga0163162_10181916 | Ga0163162_101819162 | 208 |
| 399 | 3300013306 | Ga0163162_10661704 | Ga0163162_106617042 | 208 |
| 400 | 3300014326 | Ga0157380_10263149 | Ga0157380_102631491 | 208 |
| 401 | 3300014326 | Ga0157380_10373276 | Ga0157380_103732762 | 208 |
| 402 | 3300014968 | Ga0157379_10800050 | Ga0157379_108000502 | 208 |
| 403 | 3300017792 | Ga0163161_10076732 | Ga0163161_100767323 | 208 |
| 404 | 3300025315 | Ga0207697_10036024 | Ga0207697_100360242 | 208 |
| 405 | 3300025899 | Ga0207642_10066994 | Ga0207642_100669942 | 208 |
| 406 | 3300025901 | Ga0207688_10067356 | Ga0207688_100673562 | 208 |
| 407 | 3300025903 | Ga0207680_10046687 | Ga0207680_100466873 | 208 |
| 408 | 3300025904 | Ga0207647_10058272 | Ga0207647_100582722 | 208 |
| 409 | 3300025905 | Ga0207685_10079681 | Ga0207685_100796812 | 208 |
| 410 | 3300025907 | Ga0207645_10232386 | Ga0207645_102323861 | 208 |
| 411 | 3300025912 | Ga0207707_10066037 | Ga0207707_100660372 | 208 |
| 412 | 3300025915 | Ga0207693_10541507 | Ga0207693_105415072 | 208 |
| 413 | 3300025919 | Ga0207657_10120755 | Ga0207657_101207552 | 208 |
| 414 | 3300025923 | Ga0207681_10564651 | Ga0207681_105646512 | 208 |
| 415 | 3300025924 | Ga0207694_10058814 | Ga0207694_100588142 | 208 |
| 416 | 3300025927 | Ga0207687_10067996 | Ga0207687_100679963 | 208 |
| 417 | 3300025931 | Ga0207644_10341011 | Ga0207644_103410112 | 208 |
| 418 | 3300025932 | Ga0207690_10065385 | Ga0207690_100653853 | 208 |
| 419 | 3300025933 | Ga0207706_10076849 | Ga0207706_100768493 | 208 |
| 420 | 3300025935 | Ga0207709_10082288 | Ga0207709_100822882 | 208 |
| 421 | 3300025936 | Ga0207670_10248416 | Ga0207670_102484162 | 208 |
| 422 | 3300025937 | Ga0207669_10634325 | Ga0207669_106343252 | 208 |
| 423 | 3300025937 | Ga0207669_10793316 | Ga0207669_107933161 | 208 |
| 424 | 3300025938 | Ga0207704_10239061 | Ga0207704_102390612 | 208 |
| 425 | 3300025939 | Ga0207665_10126279 | Ga0207665_101262792 | 208 |
| 426 | 3300025940 | Ga0207691_10256745 | Ga0207691_102567452 | 208 |
| 427 | 3300025940 | Ga0207691_10542449 | Ga0207691_105424492 | 208 |
| 428 | 3300025944 | Ga0207661_10168564 | Ga0207661_101685642 | 208 |
| 429 | 3300025961 | Ga0207712_10013111 | Ga0207712_100131114 | 208 |
| 430 | 3300025972 | Ga0207668_10002442 | Ga0207668_100024424 | 208 |
| 431 | 3300025972 | Ga0207668_10090856 | Ga0207668_100908562 | 208 |
| 432 | 3300025972 | Ga0207668_10230060 | Ga0207668_102300601 | 208 |
| 433 | 3300025972 | Ga0207668_10387988 | Ga0207668_103879882 | 208 |
| 434 | 3300026035 | Ga0207703_10712024 | Ga0207703_107120241 | 208 |
| 435 | 3300026067 | Ga0207678_10030402 | Ga0207678_100304026 | 208 |
| 436 | 3300026067 | Ga0207678_10063112 | Ga0207678_100631123 | 208 |
| 437 | 3300026075 | Ga0207708_10042169 | Ga0207708_100421692 | 208 |
| 438 | 3300026075 | Ga0207708_10082714 | Ga0207708_100827143 | 208 |
| 439 | 3300026089 | Ga0207648_10215168 | Ga0207648_102151682 | 208 |
| 440 | 3300026089 | Ga0207648_10441599 | Ga0207648_104415992 | 208 |
| 441 | 3300026118 | Ga0207675_100039743 | Ga0207675_1000397432 | 208 |
| 442 | 3300026118 | Ga0207675_100491665 | Ga0207675_1004916652 | 208 |
| 443 | 3300026121 | Ga0207683_10053206 | Ga0207683_100532063 | 208 |
| 444 | 3300026121 | Ga0207683_10493321 | Ga0207683_104933212 | 208 |
| 445 | 3300028379 | Ga0268266_10261490 | Ga0268266_102614902 | 208 |
| 446 | 3300028380 | Ga0268265_10055689 | Ga0268265_100556892 | 208 |
| 447 | 3300028381 | Ga0268264_10446182 | Ga0268264_104461822 | 208 |
| 448 | 3300028794 | Ga0307515_10516873 | Ga0307515_105168731 | 208 |
| 449 | 3300031730 | Ga0307516_10005450 | Ga0307516_100054507 | 208 |
| 450 | 3300031730 | Ga0307516_10015280 | Ga0307516_100152805 | 208 |
| 451 | 3300033180 | Ga0307510_10168552 | Ga0307510_101685522 | 208 |
| 452 | 3300035111 | Ga0373923_0234594 | Ga0373923_0234594_65_691 | 208 |
| 453 | 3300035171 | Ga0373946_0135808 | Ga0373946_0135808_329_955 | 208 |
| 454 | 3300035695 | Ga0373927_0356587 | Ga0373927_0356587_89_715 | 208 |
| 455 | 3300035695 | Ga0373927_0387601 | Ga0373927_0387601_194_820 | 208 |
| 456 | 3300035725 | Ga0373947_0163686 | Ga0373947_0163686_614_1240 | 208 |
| 457 | 3300037471 | Ga0395905_0275517 | Ga0395905_0275517_277_918 | 208 |
| 458 | 3300044706 | Ga0466964_0137563 | Ga0466964_0137563_444_1070 | 208 |
| 459 | 3300046461 | Ga0495641_0053386 | Ga0495641_0053386_162_788 | 208 |
| 460 | 3300046500 | Ga0495596_0063481 | Ga0495596_0063481_688_1314 | 208 |
| 461 | 3300046512 | Ga0495610_0117712 | Ga0495610_0117712_330_983 | 208 |
| 462 | 3300046515 | Ga0495620_0036638 | Ga0495620_0036638_823_1488 | 208 |
| 463 | 3300046518 | Ga0495631_0150217 | Ga0495631_0150217_303_929 | 208 |
| 464 | 3300046519 | Ga0495632_0197736 | Ga0495632_0197736_203_829 | 208 |
| 465 | 3300046523 | Ga0495644_0185582 | Ga0495644_0185582_99_764 | 208 |
| 466 | 3300046615 | Ga0495656_0047402 | Ga0495656_0047402_584_1210 | 208 |
| 467 | 3300046616 | Ga0495668_0085690 | Ga0495668_0085690_418_1044 | 208 |
| 468 | 3300046616 | Ga0495668_0366996 | Ga0495668_0366996_41_706 | 208 |
| 469 | 3300046660 | Ga0495625_0498127 | Ga0495625_0498127_58_684 | 208 |
| 470 | 3300046684 | Ga0495669_0005641 | Ga0495669_0005641_790_1416 | 208 |
| 471 | 3300046692 | Ga0495671_0213053 | Ga0495671_0213053_127_753 | 208 |
| 472 | 3300046794 | Ga0495589_0098065 | Ga0495589_0098065_654_1319 | 208 |
| 473 | 3300047317 | Ga0495604_0266595 | Ga0495604_0266595_353_979 | 208 |
| 474 | 3300047321 | Ga0495676_0316765 | Ga0495676_0316765_324_950 | 208 |
| 475 | 3300047445 | Ga0495677_0026762 | Ga0495677_0026762_1280_1906 | 208 |
| 476 | 3300048905 | Ga0496102_0955953 | Ga0496102_0955953_120_746 | 208 |
| 477 | 3300048907 | Ga0496104_0495658 | Ga0496104_0495658_309_935 | 208 |
| 478 | 3300048909 | Ga0496106_0345717 | Ga0496106_0345717_286_912 | 208 |
| 479 | 3300048914 | Ga0496111_0181419 | Ga0496111_0181419_427_1053 | 208 |
| 480 | 3300050493 | nmdc:mga0k408_158460_c1 | nmdc:mga0k408_158460_c1_364_1017 | 208 |
| 481 | 3300050512 | nmdc:mga0n895_103107_c1 | nmdc:mga0n895_103107_c1_482_1108 | 208 |
| 482 | 3300050516 | nmdc:mga0sz30_47966_c1 | nmdc:mga0sz30_47966_c1_953_1606 | 208 |
| 483 | 3300005456 | Ga0070678_100222692 | Ga0070678_1002226922 | 209 |
| 484 | 3300005457 | Ga0070662_100177656 | Ga0070662_1001776562 | 209 |
| 485 | 3300005543 | Ga0070672_100344825 | Ga0070672_1003448252 | 209 |
| 486 | 3300006038 | Ga0075365_10009774 | Ga0075365_100097743 | 209 |
| 487 | 3300006038 | Ga0075365_10033811 | Ga0075365_100338112 | 209 |
| 488 | 3300006048 | Ga0075363_100023243 | Ga0075363_1000232436 | 209 |
| 489 | 3300006048 | Ga0075363_100064361 | Ga0075363_1000643612 | 209 |
| 490 | 3300006048 | Ga0075363_100123050 | Ga0075363_1001230502 | 209 |
| 491 | 3300006051 | Ga0075364_10006598 | Ga0075364_100065982 | 209 |
| 492 | 3300006173 | Ga0070716_100101458 | Ga0070716_1001014582 | 209 |
| 493 | 3300006177 | Ga0075362_10110606 | Ga0075362_101106062 | 209 |
| 494 | 3300006178 | Ga0075367_10095706 | Ga0075367_100957061 | 209 |
| 495 | 3300006941 | Ga0099825_1035583 | Ga0099825_10355832 | 209 |
| 496 | 3300006942 | Ga0099824_1014958 | Ga0099824_10149584 | 209 |
| 497 | 3300006944 | Ga0099823_1057867 | Ga0099823_10578672 | 209 |
| 498 | 3300009093 | Ga0105240_10626137 | Ga0105240_106261372 | 209 |
| 499 | 3300009148 | Ga0105243_10418300 | Ga0105243_104183002 | 209 |
| 500 | 3300010375 | Ga0105239_10029633 | Ga0105239_100296335 | 209 |
| 501 | 3300011119 | Ga0105246_10890668 | Ga0105246_108906681 | 209 |
| 502 | 3300014745 | Ga0157377_10274558 | Ga0157377_102745582 | 209 |
| 503 | 3300021321 | Ga0214542_1000606 | Ga0214542_10006069 | 209 |
| 504 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003201 | 209 |
| 505 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002565 | 209 |
| 506 | 3300025297 | Ga0209758_1003647 | Ga0209758_10036475 | 209 |
| 507 | 3300025297 | Ga0209758_1017313 | Ga0209758_10173132 | 209 |
| 508 | 3300025901 | Ga0207688_10060730 | Ga0207688_100607301 | 209 |
| 509 | 3300025904 | Ga0207647_10093709 | Ga0207647_100937092 | 209 |
| 510 | 3300025919 | Ga0207657_10475179 | Ga0207657_104751792 | 209 |
| 511 | 3300025933 | Ga0207706_10216289 | Ga0207706_102162892 | 209 |
| 512 | 3300025939 | Ga0207665_10128387 | Ga0207665_101283872 | 209 |
| 513 | 3300026023 | Ga0207677_10574981 | Ga0207677_105749812 | 209 |
| 514 | 3300027296 | Ga0209389_1000043 | Ga0209389_10000438 | 209 |
| 515 | 3300027296 | Ga0209389_1000077 | Ga0209389_100007774 | 209 |
| 516 | 3300027357 | Ga0209589_1000047 | Ga0209589_1000047103 | 209 |
| 517 | 3300027361 | Ga0209489_100075 | Ga0209489_100075135 | 209 |
| 518 | 3300027361 | Ga0209489_100251 | Ga0209489_10025174 | 209 |
| 519 | 3300027363 | Ga0209700_100271 | Ga0209700_10027174 | 209 |
| 520 | 3300031238 | Ga0265332_10038748 | Ga0265332_100387482 | 209 |
| 521 | 3300031241 | Ga0265325_10084672 | Ga0265325_100846722 | 209 |
| 522 | 3300031250 | Ga0265331_10065277 | Ga0265331_100652772 | 209 |
| 523 | 3300031344 | Ga0265316_10085124 | Ga0265316_100851242 | 209 |
| 524 | 3300031712 | Ga0265342_10098074 | Ga0265342_100980742 | 209 |
| 525 | 3300046559 | Ga0495667_0223745 | Ga0495667_0223745_83_712 | 209 |
| 526 | 3300047320 | Ga0495672_0161760 | Ga0495672_0161760_18_647 | 209 |
| 527 | 3300047472 | Ga0495686_0082561 | Ga0495686_0082561_1247_1876 | 209 |
| 528 | 3300048924 | Ga0496121_0000214 | Ga0496121_0000214_97975_98604 | 209 |
| 529 | 3300050490 | nmdc:mga03n38_245955_c1 | nmdc:mga03n38_245955_c1_225_854 | 209 |
| 530 | 3300050490 | nmdc:mga03n38_290332_c1 | nmdc:mga03n38_290332_c1_39_668 | 209 |
| 531 | 3300050490 | nmdc:mga03n38_61415_c1 | nmdc:mga03n38_61415_c1_783_1412 | 209 |
| 532 | 3300050491 | nmdc:mga00v17_81879_c1 | nmdc:mga00v17_81879_c1_67_696 | 209 |
| 533 | 3300050492 | nmdc:mga0yw44_144353_c1 | nmdc:mga0yw44_144353_c1_580_1212 | 209 |
| 534 | 3300050492 | nmdc:mga0yw44_501039_c1 | nmdc:mga0yw44_501039_c1_166_795 | 209 |
| 535 | 3300050494 | nmdc:mga06z11_426866_c1 | nmdc:mga06z11_426866_c1_49_717 | 209 |
| 536 | 3300053096 | Ga0500641_0000956 | Ga0500641_0000956_1550_2200 | 209 |
| 537 | 3300053096 | Ga0500641_0006010 | Ga0500641_0006010_1794_2426 | 209 |
| 538 | 3300053119 | Ga0500595_006714 | Ga0500595_006714_2156_2785 | 209 |
| 539 | 3300053147 | Ga0500589_017471 | Ga0500589_017471_1136_1768 | 209 |
| 540 | iso_pu_bacteria | 2824600985 | 2824602984 | 209 |
| 541 | iso_pu_bacteria | 2888419890 | 2888425799 | 209 |
| 542 | 3300000549 | LJQas_1003694 | LJQas_10036942 | 210 |
| 543 | 3300005327 | Ga0070658_10087636 | Ga0070658_100876362 | 210 |
| 544 | 3300005328 | Ga0070676_10321747 | Ga0070676_103217472 | 210 |
| 545 | 3300005329 | Ga0070683_100353016 | Ga0070683_1003530162 | 210 |
| 546 | 3300005330 | Ga0070690_100094006 | Ga0070690_1000940062 | 210 |
| 547 | 3300005331 | Ga0070670_100303313 | Ga0070670_1003033131 | 210 |
| 548 | 3300005334 | Ga0068869_100326377 | Ga0068869_1003263772 | 210 |
| 549 | 3300005336 | Ga0070680_100088385 | Ga0070680_1000883852 | 210 |
| 550 | 3300005337 | Ga0070682_100107936 | Ga0070682_1001079362 | 210 |
| 551 | 3300005337 | Ga0070682_100269681 | Ga0070682_1002696811 | 210 |
| 552 | 3300005339 | Ga0070660_100069978 | Ga0070660_1000699782 | 210 |
| 553 | 3300005341 | Ga0070691_10062736 | Ga0070691_100627362 | 210 |
| 554 | 3300005344 | Ga0070661_100080291 | Ga0070661_1000802911 | 210 |
| 555 | 3300005364 | Ga0070673_100112266 | Ga0070673_1001122662 | 210 |
| 556 | 3300005366 | Ga0070659_100153865 | Ga0070659_1001538652 | 210 |
| 557 | 3300005366 | Ga0070659_100187774 | Ga0070659_1001877743 | 210 |
| 558 | 3300005434 | Ga0070709_10060796 | Ga0070709_100607962 | 210 |
| 559 | 3300005445 | Ga0070708_100284274 | Ga0070708_1002842742 | 210 |
| 560 | 3300005455 | Ga0070663_100010586 | Ga0070663_1000105863 | 210 |
| 561 | 3300005455 | Ga0070663_100034596 | Ga0070663_1000345962 | 210 |
| 562 | 3300005456 | Ga0070678_100737454 | Ga0070678_1007374541 | 210 |
| 563 | 3300005466 | Ga0070685_10719490 | Ga0070685_107194901 | 210 |
| 564 | 3300005467 | Ga0070706_100350994 | Ga0070706_1003509942 | 210 |
| 565 | 3300005468 | Ga0070707_100479566 | Ga0070707_1004795662 | 210 |
| 566 | 3300005535 | Ga0070684_100037005 | Ga0070684_1000370054 | 210 |
| 567 | 3300005536 | Ga0070697_100141672 | Ga0070697_1001416722 | 210 |
| 568 | 3300005536 | Ga0070697_100537843 | Ga0070697_1005378432 | 210 |
| 569 | 3300005539 | Ga0068853_100260398 | Ga0068853_1002603982 | 210 |
| 570 | 3300005548 | Ga0070665_100026407 | Ga0070665_1000264074 | 210 |
| 571 | 3300005577 | Ga0068857_100090725 | Ga0068857_1000907254 | 210 |
| 572 | 3300005616 | Ga0068852_100114739 | Ga0068852_1001147392 | 210 |
| 573 | 3300005616 | Ga0068852_100176400 | Ga0068852_1001764003 | 210 |
| 574 | 3300005719 | Ga0068861_100077725 | Ga0068861_1000777252 | 210 |
| 575 | 3300006038 | Ga0075365_10338822 | Ga0075365_103388222 | 210 |
| 576 | 3300006048 | Ga0075363_100026384 | Ga0075363_1000263842 | 210 |
| 577 | 3300006051 | Ga0075364_10057390 | Ga0075364_100573902 | 210 |
| 578 | 3300006178 | Ga0075367_10157223 | Ga0075367_101572232 | 210 |
| 579 | 3300006353 | Ga0075370_10014309 | Ga0075370_100143092 | 210 |
| 580 | 3300006358 | Ga0068871_100097853 | Ga0068871_1000978532 | 210 |
| 581 | 3300006844 | Ga0075428_100768388 | Ga0075428_1007683882 | 210 |
| 582 | 3300007265 | Ga0099794_10022730 | Ga0099794_100227303 | 210 |
| 583 | 3300009093 | Ga0105240_10096778 | Ga0105240_100967782 | 210 |
| 584 | 3300009098 | Ga0105245_11041984 | Ga0105245_110419841 | 210 |
| 585 | 3300009176 | Ga0105242_10372710 | Ga0105242_103727102 | 210 |
| 586 | 3300009545 | Ga0105237_10004604 | Ga0105237_100046043 | 210 |
| 587 | 3300009545 | Ga0105237_10124269 | Ga0105237_101242692 | 210 |
| 588 | 3300009551 | Ga0105238_10278327 | Ga0105238_102783272 | 210 |
| 589 | 3300010375 | Ga0105239_10072659 | Ga0105239_100726594 | 210 |
| 590 | 3300013104 | Ga0157370_10027778 | Ga0157370_100277788 | 210 |
| 591 | 3300013105 | Ga0157369_10124282 | Ga0157369_101242822 | 210 |
| 592 | 3300013306 | Ga0163162_10121401 | Ga0163162_101214012 | 210 |
| 593 | 3300013306 | Ga0163162_10126318 | Ga0163162_101263182 | 210 |
| 594 | 3300013306 | Ga0163162_10528349 | Ga0163162_105283492 | 210 |
| 595 | 3300013308 | Ga0157375_10732388 | Ga0157375_107323882 | 210 |
| 596 | 3300014325 | Ga0163163_10034261 | Ga0163163_100342612 | 210 |
| 597 | 3300014326 | Ga0157380_10048416 | Ga0157380_100484162 | 210 |
| 598 | 3300014326 | Ga0157380_10576415 | Ga0157380_105764152 | 210 |
| 599 | 3300014326 | Ga0157380_10606505 | Ga0157380_106065052 | 210 |
| 600 | 3300017792 | Ga0163161_10048644 | Ga0163161_100486443 | 210 |
| 601 | 3300025906 | Ga0207699_10076273 | Ga0207699_100762732 | 210 |
| 602 | 3300025910 | Ga0207684_10118318 | Ga0207684_101183182 | 210 |
| 603 | 3300025912 | Ga0207707_10013073 | Ga0207707_1001307311 | 210 |
| 604 | 3300025912 | Ga0207707_10751064 | Ga0207707_107510641 | 210 |
| 605 | 3300025913 | Ga0207695_10241475 | Ga0207695_102414752 | 210 |
| 606 | 3300025914 | Ga0207671_10205028 | Ga0207671_102050281 | 210 |
| 607 | 3300025917 | Ga0207660_10019729 | Ga0207660_100197295 | 210 |
| 608 | 3300025919 | Ga0207657_10090075 | Ga0207657_100900752 | 210 |
| 609 | 3300025921 | Ga0207652_10015037 | Ga0207652_100150374 | 210 |
| 610 | 3300025922 | Ga0207646_10179519 | Ga0207646_101795192 | 210 |
| 611 | 3300025924 | Ga0207694_10078792 | Ga0207694_100787923 | 210 |
| 612 | 3300025932 | Ga0207690_10280199 | Ga0207690_102801992 | 210 |
| 613 | 3300025933 | Ga0207706_10106148 | Ga0207706_101061483 | 210 |
| 614 | 3300025944 | Ga0207661_10081831 | Ga0207661_100818312 | 210 |
| 615 | 3300025945 | Ga0207679_10537008 | Ga0207679_105370082 | 210 |
| 616 | 3300025949 | Ga0207667_10109389 | Ga0207667_101093892 | 210 |
| 617 | 3300025960 | Ga0207651_10581454 | Ga0207651_105814542 | 210 |
| 618 | 3300025961 | Ga0207712_10098934 | Ga0207712_100989342 | 210 |
| 619 | 3300025981 | Ga0207640_10352000 | Ga0207640_103520002 | 210 |
| 620 | 3300025981 | Ga0207640_10718011 | Ga0207640_107180112 | 210 |
| 621 | 3300025986 | Ga0207658_10681798 | Ga0207658_106817982 | 210 |
| 622 | 3300026023 | Ga0207677_10176710 | Ga0207677_101767102 | 210 |
| 623 | 3300026041 | Ga0207639_10029947 | Ga0207639_100299473 | 210 |
| 624 | 3300026067 | Ga0207678_10009390 | Ga0207678_100093907 | 210 |
| 625 | 3300026116 | Ga0207674_10021202 | Ga0207674_100212022 | 210 |
| 626 | 3300026142 | Ga0207698_10183415 | Ga0207698_101834152 | 210 |
| 627 | 3300026142 | Ga0207698_10257474 | Ga0207698_102574742 | 210 |
| 628 | 3300026142 | Ga0207698_11036254 | Ga0207698_110362541 | 210 |
| 629 | 3300028379 | Ga0268266_10007087 | Ga0268266_100070873 | 210 |
| 630 | 3300031456 | Ga0307513_10352747 | Ga0307513_103527472 | 210 |
| 631 | 3300031649 | Ga0307514_10318034 | Ga0307514_103180342 | 210 |
| 632 | 3300031730 | Ga0307516_10036105 | Ga0307516_100361052 | 210 |
| 633 | 3300035112 | Ga0373932_0108269 | Ga0373932_0108269_72_704 | 210 |
| 634 | 3300035171 | Ga0373946_0225657 | Ga0373946_0225657_17_652 | 210 |
| 635 | 3300037068 | Ga0373925_0108644 | Ga0373925_0108644_886_1521 | 210 |
| 636 | 3300046459 | Ga0495629_0180725 | Ga0495629_0180725_670_1305 | 210 |
| 637 | 3300046531 | Ga0495665_0063420 | Ga0495665_0063420_852_1487 | 210 |
| 638 | 3300046664 | Ga0495659_0136332 | Ga0495659_0136332_283_915 | 210 |
| 639 | 3300046683 | Ga0495658_0113870 | Ga0495658_0113870_457_1092 | 210 |
| 640 | 3300047315 | Ga0495581_0233647 | Ga0495581_0233647_75_710 | 210 |
| 641 | 3300048904 | Ga0496101_0337427 | Ga0496101_0337427_313_945 | 210 |
| 642 | 3300048905 | Ga0496102_0138363 | Ga0496102_0138363_606_1238 | 210 |
| 643 | 3300048905 | Ga0496102_0414688 | Ga0496102_0414688_453_1088 | 210 |
| 644 | 3300048906 | Ga0496103_0069107 | Ga0496103_0069107_706_1338 | 210 |
| 645 | 3300048907 | Ga0496104_0162292 | Ga0496104_0162292_70_702 | 210 |
| 646 | 3300048908 | Ga0496105_0090827 | Ga0496105_0090827_1072_1704 | 210 |
| 647 | 3300048911 | Ga0496108_0141781 | Ga0496108_0141781_364_999 | 210 |
| 648 | 3300048911 | Ga0496108_0572521 | Ga0496108_0572521_104_739 | 210 |
| 649 | 3300048912 | Ga0496109_0122327 | Ga0496109_0122327_1163_1795 | 210 |
| 650 | 3300048913 | Ga0496110_0119295 | Ga0496110_0119295_1578_2210 | 210 |
| 651 | 3300048913 | Ga0496110_0130483 | Ga0496110_0130483_293_925 | 210 |
| 652 | 3300048914 | Ga0496111_0189917 | Ga0496111_0189917_219_851 | 210 |
| 653 | 3300048915 | Ga0496112_0187957 | Ga0496112_0187957_317_952 | 210 |
| 654 | 3300048916 | Ga0496113_0050393 | Ga0496113_0050393_1115_1747 | 210 |
| 655 | 3300048917 | Ga0496114_0109518 | Ga0496114_0109518_427_1059 | 210 |
| 656 | 3300048917 | Ga0496114_0365864 | Ga0496114_0365864_533_1168 | 210 |
| 657 | 3300048918 | Ga0496115_0100362 | Ga0496115_0100362_1163_1795 | 210 |
| 658 | 3300048924 | Ga0496121_0074968 | Ga0496121_0074968_1044_1688 | 210 |
| 659 | 3300048929 | Ga0496126_0053231 | Ga0496126_0053231_2005_2649 | 210 |
| 660 | 3300048929 | Ga0496126_0285606 | Ga0496126_0285606_443_1078 | 210 |
| 661 | 3300049460 | Ga0495682_0136717 | Ga0495682_0136717_124_756 | 210 |
| 662 | 3300050490 | nmdc:mga03n38_182606_c1 | nmdc:mga03n38_182606_c1_367_1002 | 210 |
| 663 | 3300050491 | nmdc:mga00v17_48296_c1 | nmdc:mga00v17_48296_c1_1004_1639 | 210 |
| 664 | 3300050492 | nmdc:mga0yw44_117199_c1 | nmdc:mga0yw44_117199_c1_272_907 | 210 |
| 665 | 3300050493 | nmdc:mga0k408_119032_c1 | nmdc:mga0k408_119032_c1_351_986 | 210 |
| 666 | 3300050494 | nmdc:mga06z11_27540_c1 | nmdc:mga06z11_27540_c1_1550_2185 | 210 |
| 667 | 3300053155 | Ga0500620_009594 | Ga0500620_009594_766_1401 | 210 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1tzz-assembly2.cif.gz_B | crystal structure of the protein l1841, unknown member of enolase superfamily from bradyrhizobium japonicum | 0.7554 | 65 | 104 |
| 1tzz-assembly1.cif.gz_A | crystal structure of the protein l1841, unknown member of enolase superfamily from bradyrhizobium japonicum | 0.748 | 65 | 104 |
| 3brw-assembly1.cif.gz_A | structure of the rap-rapgap complex | 0.7302 | 62 | 111 |
| 2qm0-assembly1.cif.gz_A | crystal structure of bes protein from bacillus cereus | 0.6912 | 64 | 91 |
| 2qm0-assembly1.cif.gz_B | crystal structure of bes protein from bacillus cereus | 0.6822 | 64 | 91 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4kbjA02 | Alpha Beta;Alpha-Beta Complex;Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3;RNA polymerase Rpb2, domain 2 | 0.8345 | 65 | 111 | 3.90.1110.10 |
| af_X2JDH0_779_875_3.30.1120.160 | Alpha Beta;2-Layer Sandwich;Arylsulfatase, C-terminal domain; | 0.7733 | 66 | 112 | 3.30.1120.160 |
| 1tzzA01 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.763 | 65 | 104 | 3.30.390.10 |
| af_H2L055_270_364_3.30.1120.160 | Alpha Beta;2-Layer Sandwich;Arylsulfatase, C-terminal domain; | 0.7569 | 70 | 115 | 3.30.1120.160 |
| af_Q8II57_290_513_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.6998 | 80 | 111 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A837CCD5-F1-model_v4 | Uncharacterized protein | 0.9343 | 98 | 210 |
|
| AF-H5YEF0-F1-model_v4 | Uncharacterized protein | 0.9163 | 98 | 210 |
|
| AF-A0A837CCD5-F1-model_v4 | Uncharacterized protein | 0.9108 | 98 | 210 |
|
| AF-H5YEF0-F1-model_v4 | Uncharacterized protein | 0.8933 | 98 | 210 |
|
| AF-A0A512NIT6-F1-model_v4 | Uncharacterized protein | 0.8891 | 66 | 210 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar