F473821

General Info

Members Datasets Scaffolds Average Seq Length
667 298 1334 57

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_101034680|Ga0070663_1010346802
Length 61
Sequence MASMMRSHFVLMVLFAFFVSLVFAVIAKDDVVAQLRFGGLMFAGFLASAVVLGWLMYPFPL

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
171 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
172 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
173 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
174 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
175 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
176 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
177 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
178 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
179 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
180 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
181 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
182 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
205 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
206 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
207 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
208 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
209 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
210 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
211 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
212 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
222 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
231 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
234 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
250 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
251 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
274 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
275 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
284 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
291 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
292 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
295 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
296 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 4.95
Rhizosphere 94.45
Stem 0
Stem Tuber 0
Unclassified 15.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_101034680 3300005455 Bacteria 715
2 JGI24751J29686_10021741 3300002459 Unclassified 1330
3 Ga0065712_10021813 3300005290 Bacteria 1834
4 Ga0065712_10132370 3300005290 Bacteria 1534
5 Ga0065712_10142212 3300005290 Unclassified 1439
6 Ga0065712_10360560 3300005290 Unclassified 775
7 Ga0065715_10024371 3300005293 Bacteria 2014
8 Ga0065715_10171569 3300005293 Bacteria 1543
9 Ga0065715_10204074 3300005293 Unclassified 1341
10 Ga0065715_10547893 3300005293 Unclassified 743
11 Ga0065707_10954672 3300005295 Unclassified 551
12 Ga0065707_11138845 3300005295 Unclassified 504
13 Ga0070676_10550276 3300005328 Bacteria 826
14 Ga0070676_10736190 3300005328 Bacteria 723
15 Ga0070683_100507917 3300005329 Bacteria 1152
16 Ga0070683_102099755 3300005329 Unclassified 543
17 Ga0070690_100098667 3300005330 Bacteria 1934
18 Ga0070690_100956486 3300005330 Bacteria 673
19 Ga0070670_100762041 3300005331 Bacteria 873
20 Ga0068869_101138771 3300005334 Bacteria 684
21 Ga0070666_10125593 3300005335 Bacteria 1781
22 Ga0070666_10177997 3300005335 Bacteria 1491
23 Ga0068868_100268389 3300005338 Bacteria 1441
24 Ga0068868_100486661 3300005338 Bacteria 1079
25 Ga0068868_100905032 3300005338 Unclassified 802
26 Ga0070689_100375253 3300005340 Bacteria 1198
27 Ga0070689_101631393 3300005340 Unclassified 586
28 Ga0070687_100310474 3300005343 Bacteria 1004
29 Ga0070687_100456838 3300005343 Bacteria 851
30 Ga0070661_100707863 3300005344 Bacteria 821
31 Ga0070692_10787528 3300005345 Bacteria 648
32 Ga0070668_101104645 3300005347 Unclassified 716
33 Ga0070669_100196269 3300005353 Bacteria 1586
34 Ga0070669_100240469 3300005353 Bacteria 1438
35 Ga0070669_100583507 3300005353 Bacteria 935
36 Ga0070675_100149448 3300005354 Unclassified 2002
37 Ga0070675_100211709 3300005354 Bacteria 1685
38 Ga0070675_100876347 3300005354 Unclassified 822
39 Ga0070675_100896096 3300005354 Unclassified 813
40 Ga0070675_101301871 3300005354 Bacteria 670
41 Ga0070675_101542347 3300005354 Bacteria 613
42 Ga0070671_100039770 3300005355 Bacteria 3904
43 Ga0070671_100283733 3300005355 Bacteria 1409
44 Ga0070674_100106711 3300005356 Bacteria 2050
45 Ga0070674_101240601 3300005356 Bacteria 663
46 Ga0070673_100099331 3300005364 Unclassified 2394
47 Ga0070673_100100609 3300005364 Bacteria 2380
48 Ga0070673_100143749 3300005364 Bacteria 2015
49 Ga0070673_101884074 3300005364 Unclassified 567
50 Ga0070673_102211826 3300005364 Bacteria 523
51 Ga0070688_100488463 3300005365 Bacteria 927
52 Ga0070688_100623765 3300005365 Bacteria 828
53 Ga0070659_100269219 3300005366 Bacteria 1415
54 Ga0070659_101454057 3300005366 Bacteria 610
55 Ga0070667_100008544 3300005367 Bacteria 8489
56 Ga0070667_100224782 3300005367 Bacteria 1672
57 Ga0070667_100327711 3300005367 Bacteria 1383
58 Ga0070709_10819740 3300005434 Bacteria 731
59 Ga0070714_100025808 3300005435 Bacteria 4853
60 Ga0070713_101140587 3300005436 Bacteria 754
61 Ga0070701_11137688 3300005438 Unclassified 551
62 Ga0070711_100138621 3300005439 Unclassified 1821
63 Ga0070705_100819547 3300005440 Bacteria 742
64 Ga0070700_100365881 3300005441 Bacteria 1074
65 Ga0070700_101860833 3300005441 Bacteria 520
66 Ga0070708_100561760 3300005445 Bacteria 1076
67 Ga0070708_101257356 3300005445 Bacteria 692
68 Ga0070708_101698096 3300005445 Bacteria 587
69 Ga0070708_102088014 3300005445 Unclassified 524
70 Ga0070678_100003319 3300005456 Bacteria 8951
71 Ga0070678_100319089 3300005456 Bacteria 1326
72 Ga0070678_100440998 3300005456 Bacteria 1139
73 Ga0070662_100533338 3300005457 Bacteria 982
74 Ga0068867_100355731 3300005459 Bacteria 1223
75 Ga0068867_100403817 3300005459 Bacteria 1153
76 Ga0070685_10143988 3300005466 Bacteria 1504
77 Ga0070685_10195338 3300005466 Bacteria 1312
78 Ga0070707_100236782 3300005468 Bacteria 1777
79 Ga0070707_102316002 3300005468 Bacteria 504
80 Ga0070698_100059703 3300005471 Bacteria 3851
81 Ga0070699_100245307 3300005518 Bacteria 1600
82 Ga0070699_100246152 3300005518 Bacteria 1597
83 Ga0070699_100616201 3300005518 Bacteria 990
84 Ga0070679_100101799 3300005530 Bacteria 2859
85 Ga0070679_100404308 3300005530 Bacteria 1311
86 Ga0070684_100803885 3300005535 Unclassified 879
87 Ga0070684_101084973 3300005535 Unclassified 752
88 Ga0070684_101549417 3300005535 Bacteria 625
89 Ga0070697_100299652 3300005536 Bacteria 1382
90 Ga0070697_100362397 3300005536 Unclassified 1253
91 Ga0070697_100410488 3300005536 Bacteria 1176
92 Ga0068853_102213844 3300005539 Bacteria 533
93 Ga0070672_100047197 3300005543 Bacteria 3341
94 Ga0070672_100315648 3300005543 Bacteria 1327
95 Ga0070672_100792009 3300005543 Bacteria 834
96 Ga0070672_100825170 3300005543 Unclassified 817
97 Ga0070672_101583336 3300005543 Bacteria 588
98 Ga0070672_101964732 3300005543 Bacteria 527
99 Ga0070686_100111264 3300005544 Bacteria 1866
100 Ga0070686_100279654 3300005544 Bacteria 1230
101 Ga0070686_100760905 3300005544 Bacteria 778
102 Ga0070695_100348288 3300005545 Unclassified 1109
103 Ga0070695_101785012 3300005545 Bacteria 516
104 Ga0070696_100875293 3300005546 Bacteria 744
105 Ga0070693_100033512 3300005547 Bacteria 2835
106 Ga0070665_100001145 3300005548 Bacteria 32593
107 Ga0070665_100009496 3300005548 Bacteria 9838
108 Ga0070665_100128963 3300005548 Bacteria 2532
109 Ga0070665_101561610 3300005548 Bacteria 668
110 Ga0070665_101720682 3300005548 Bacteria 634
111 Ga0070704_101704205 3300005549 Bacteria 582
112 Ga0068855_101215778 3300005563 Bacteria 783
113 Ga0070664_100635968 3300005564 Bacteria 991
114 Ga0070664_101907393 3300005564 Bacteria 564
115 Ga0070664_102185527 3300005564 Bacteria 525
116 Ga0068857_100186387 3300005577 Bacteria 1889
117 Ga0068857_101130595 3300005577 Bacteria 757
118 Ga0068857_102472198 3300005577 Unclassified 510
119 Ga0068854_100268405 3300005578 Bacteria 1369
120 Ga0070702_100722252 3300005615 Bacteria 762
121 Ga0070702_100871456 3300005615 Bacteria 702
122 Ga0068852_100232998 3300005616 Bacteria 1756
123 Ga0068852_102605418 3300005616 Bacteria 525
124 Ga0068859_100337894 3300005617 Bacteria 1600
125 Ga0068859_100352918 3300005617 Bacteria 1566
126 Ga0068859_100366146 3300005617 Bacteria 1537
127 Ga0068859_100607217 3300005617 Bacteria 1187
128 Ga0068859_100939191 3300005617 Bacteria 949
129 Ga0068859_101440222 3300005617 Bacteria 760
130 Ga0068859_102081329 3300005617 Bacteria 627
131 Ga0068859_103045861 3300005617 Bacteria 512
132 Ga0068864_100017150 3300005618 Bacteria 6039
133 Ga0068864_100049294 3300005618 Bacteria 3623
134 Ga0068864_100187331 3300005618 Bacteria 1895
135 Ga0068866_10137282 3300005718 Bacteria 1399
136 Ga0068866_10350417 3300005718 Bacteria 938
137 Ga0068861_100140179 3300005719 Bacteria 1973
138 Ga0068861_101264092 3300005719 Unclassified 716
139 Ga0068851_10522938 3300005834 Bacteria 714
140 Ga0068863_100002664 3300005841 Bacteria 17652
141 Ga0068863_100123536 3300005841 Bacteria 2470
142 Ga0068858_100008048 3300005842 Bacteria 10152
143 Ga0068858_100074660 3300005842 Bacteria 3148
144 Ga0068860_100170347 3300005843 Bacteria 2103
145 Ga0068860_100468922 3300005843 Unclassified 1254
146 Ga0068860_102345458 3300005843 Bacteria 554
147 Ga0068860_102395924 3300005843 Unclassified 548
148 Ga0068862_100011054 3300005844 Bacteria 7456
149 Ga0068862_101052797 3300005844 Bacteria 807
150 Ga0068862_101936094 3300005844 Bacteria 600
151 Ga0081455_10102328 3300005937 Bacteria 2297
152 Ga0081539_10401976 3300005985 Unclassified 569
153 Ga0070717_11154678 3300006028 Bacteria 705
154 Ga0070715_10182657 3300006163 Bacteria 1053
155 Ga0070715_10229584 3300006163 Bacteria 959
156 Ga0070716_100358798 3300006173 Bacteria 1034
157 Ga0070716_100813963 3300006173 Bacteria 724
158 Ga0097621_100004292 3300006237 Bacteria 9900
159 Ga0097621_100006029 3300006237 Bacteria 8567
160 Ga0097621_100050602 3300006237 Bacteria 3379
161 Ga0097621_100094579 3300006237 Bacteria 2505
162 Ga0097621_100131530 3300006237 Bacteria 2131
163 Ga0068871_100003753 3300006358 Bacteria 10458
164 Ga0068871_100046892 3300006358 Bacteria 3482
165 Ga0068871_100385550 3300006358 Bacteria 1245
166 Ga0068871_100686846 3300006358 Bacteria 937
167 Ga0075428_100056377 3300006844 Bacteria 4304
168 Ga0075430_101416093 3300006846 Bacteria 571
169 Ga0075431_100069140 3300006847 Bacteria 3644
170 Ga0075431_101450173 3300006847 Unclassified 645
171 Ga0075431_101498405 3300006847 Bacteria 633
172 Ga0075433_10368191 3300006852 Bacteria 1269
173 Ga0075433_10416702 3300006852 Bacteria 1184
174 Ga0075434_100004125 3300006871 Bacteria 13026
175 Ga0075434_100025112 3300006871 Bacteria 5829
176 Ga0075434_100464052 3300006871 Bacteria 1287
177 Ga0075434_100775870 3300006871 Bacteria 975
178 Ga0075434_101718261 3300006871 Unclassified 635
179 Ga0075434_101744257 3300006871 Unclassified 630
180 Ga0075434_101939863 3300006871 Bacteria 595
181 Ga0075434_102347992 3300006871 Unclassified 536
182 Ga0075429_100605956 3300006880 Bacteria 960
183 Ga0075436_100002722 3300006914 Bacteria 12151
184 Ga0075436_100039696 3300006914 Bacteria 3248
185 Ga0075436_100050435 3300006914 Bacteria 2872
186 Ga0075436_100136480 3300006914 Bacteria 1722
187 Ga0075436_101358498 3300006914 Bacteria 538
188 Ga0097620_100337929 3300006931 Bacteria 1600
189 Ga0097620_100352945 3300006931 Bacteria 1566
190 Ga0097620_100366164 3300006931 Bacteria 1537
191 Ga0097620_100607305 3300006931 Bacteria 1187
192 Ga0097620_100939251 3300006931 Bacteria 949
193 Ga0097620_101440292 3300006931 Bacteria 760
194 Ga0097620_102081412 3300006931 Bacteria 627
195 Ga0097620_103045556 3300006931 Bacteria 512
196 Ga0075435_100000084 3300007076 Bacteria 49470
197 Ga0075435_100001367 3300007076 Bacteria 15741
198 Ga0075435_100034892 3300007076 Bacteria 3989
199 Ga0075435_100045342 3300007076 Bacteria 3524
200 Ga0075435_100166513 3300007076 Bacteria 1859
201 Ga0075435_100377277 3300007076 Unclassified 1218
202 Ga0075435_101265878 3300007076 Bacteria 646
203 Ga0075435_101665057 3300007076 Bacteria 560
204 Ga0105251_10187034 3300009011 Unclassified 933
205 Ga0105250_10360495 3300009092 Bacteria 638
206 Ga0105240_10011092 3300009093 Bacteria 12600
207 Ga0105240_10296017 3300009093 Bacteria 1853
208 Ga0105240_10810304 3300009093 Bacteria 1014
209 Ga0105240_11204961 3300009093 Unclassified 802
210 Ga0105240_12210412 3300009093 Bacteria 570
211 Ga0111539_10029326 3300009094 Bacteria 6704
212 Ga0111539_10119743 3300009094 Bacteria 3085
213 Ga0111539_11194229 3300009094 Bacteria 883
214 Ga0105245_10045287 3300009098 Bacteria 3929
215 Ga0105245_10070349 3300009098 Bacteria 3175
216 Ga0105245_10531334 3300009098 Bacteria 1196
217 Ga0105245_11302063 3300009098 Bacteria 776
218 Ga0105245_11964375 3300009098 Bacteria 638
219 Ga0105247_10021551 3300009101 Bacteria 3878
220 Ga0105247_10552040 3300009101 Bacteria 847
221 Ga0105247_10834054 3300009101 Bacteria 706
222 Ga0114129_10004514 3300009147 Bacteria 19642
223 Ga0114129_10012248 3300009147 Bacteria 12204
224 Ga0114129_10059192 3300009147 Bacteria 5356
225 Ga0114129_10338375 3300009147 Bacteria 1997
226 Ga0105243_10263768 3300009148 Bacteria 1543
227 Ga0105243_10575718 3300009148 Bacteria 1080
228 Ga0105243_10699687 3300009148 Bacteria 988
229 Ga0105241_12229552 3300009174 Unclassified 544
230 Ga0105242_10002352 3300009176 Bacteria 14918
231 Ga0105242_10012814 3300009176 Bacteria 6459
232 Ga0105242_10014739 3300009176 Bacteria 6054
233 Ga0105242_10751268 3300009176 Bacteria 960
234 Ga0105242_11632470 3300009176 Bacteria 679
235 Ga0105242_11644685 3300009176 Bacteria 677
236 Ga0105242_11689459 3300009176 Unclassified 669
237 Ga0105242_11710618 3300009176 Bacteria 665
238 Ga0105248_10011730 3300009177 Bacteria 9664
239 Ga0105248_10039155 3300009177 Bacteria 5308
240 Ga0105248_10051904 3300009177 Bacteria 4602
241 Ga0105248_10105417 3300009177 Bacteria 3178
242 Ga0105248_10279377 3300009177 Bacteria 1880
243 Ga0105248_10309456 3300009177 Bacteria 1779
244 Ga0105248_10619076 3300009177 Bacteria 1221
245 Ga0105248_11743250 3300009177 Bacteria 706
246 Ga0105237_10427748 3300009545 Bacteria 1330
247 Ga0105238_10054686 3300009551 Bacteria 4008
248 Ga0105238_10529016 3300009551 Bacteria 1182
249 Ga0105249_11138335 3300009553 Unclassified 851
250 Ga0105249_11178793 3300009553 Unclassified 837
251 Ga0105249_11673511 3300009553 Bacteria 709
252 Ga0105239_11528778 3300010375 Bacteria 771
253 Ga0157313_1048657 3300012503 Unclassified 545
254 Ga0157374_10036446 3300013296 Bacteria 4505
255 Ga0157374_10369303 3300013296 Bacteria 1428
256 Ga0157378_10662054 3300013297 Unclassified 1061
257 Ga0157378_10697566 3300013297 Unclassified 1034
258 Ga0157378_12318945 3300013297 Bacteria 588
259 Ga0163162_10065887 3300013306 Bacteria 3671
260 Ga0163162_10670867 3300013306 Bacteria 1160
261 Ga0163162_11490080 3300013306 Bacteria 771
262 Ga0163162_13191648 3300013306 Unclassified 526
263 Ga0157372_13142463 3300013307 Unclassified 527
264 Ga0157375_10001923 3300013308 Bacteria 17871
265 Ga0157375_11279155 3300013308 Bacteria 862
266 Ga0157375_11895052 3300013308 Bacteria 708
267 Ga0157375_13614646 3300013308 Bacteria 514
268 Ga0163163_10030557 3300014325 Bacteria 5191
269 Ga0163163_10108630 3300014325 Bacteria 2801
270 Ga0163163_10444859 3300014325 Bacteria 1356
271 Ga0163163_10758674 3300014325 Bacteria 1033
272 Ga0163163_11894576 3300014325 Unclassified 656
273 Ga0157380_10036562 3300014326 Bacteria 3800
274 Ga0157380_10583176 3300014326 Bacteria 1103
275 Ga0157380_12718550 3300014326 Bacteria 561
276 Ga0157377_10481754 3300014745 Bacteria 863
277 Ga0157379_10028453 3300014968 Bacteria 4970
278 Ga0157379_10149368 3300014968 Bacteria 2108
279 Ga0157379_10476237 3300014968 Bacteria 1155
280 Ga0157379_10492272 3300014968 Bacteria 1136
281 Ga0157376_10019114 3300014969 Bacteria 5272
282 Ga0157376_10120095 3300014969 Bacteria 2328
283 Ga0157376_10787368 3300014969 Bacteria 963
284 Ga0157376_10788780 3300014969 Bacteria 962
285 Ga0157376_10913072 3300014969 Unclassified 897
286 Ga0157376_11102236 3300014969 Unclassified 820
287 Ga0163161_11494669 3300017792 Bacteria 593
288 Ga0207697_10080386 3300025315 Unclassified 1373
289 Ga0207697_10120828 3300025315 Bacteria 1127
290 Ga0207656_10285600 3300025321 Bacteria 814
291 Ga0207656_10359113 3300025321 Bacteria 728
292 Ga0207682_10582961 3300025893 Bacteria 528
293 Ga0207642_10315778 3300025899 Unclassified 911
294 Ga0207710_10015139 3300025900 Bacteria 3257
295 Ga0207710_10298671 3300025900 Bacteria 813
296 Ga0207688_10450594 3300025901 Bacteria 802
297 Ga0207688_10662380 3300025901 Bacteria 659
298 Ga0207680_10033826 3300025903 Bacteria 2919
299 Ga0207680_10045734 3300025903 Bacteria 2583
300 Ga0207685_10136555 3300025905 Bacteria 1095
301 Ga0207645_10305074 3300025907 Bacteria 1060
302 Ga0207645_10543704 3300025907 Bacteria 788
303 Ga0207695_10084400 3300025913 Bacteria 3207
304 Ga0207695_10789047 3300025913 Unclassified 830
305 Ga0207695_10895467 3300025913 Bacteria 767
306 Ga0207695_10898294 3300025913 Bacteria 765
307 Ga0207671_10971552 3300025914 Bacteria 670
308 Ga0207663_10275022 3300025916 Unclassified 1249
309 Ga0207662_10018583 3300025918 Bacteria 3948
310 Ga0207662_10166660 3300025918 Bacteria 1411
311 Ga0207662_10856684 3300025918 Unclassified 642
312 Ga0207652_10420854 3300025921 Bacteria 1205
313 Ga0207646_10314172 3300025922 Bacteria 1416
314 Ga0207681_10009496 3300025923 Bacteria 5944
315 Ga0207681_10024465 3300025923 Bacteria 3877
316 Ga0207681_10133129 3300025923 Unclassified 1841
317 Ga0207681_10319097 3300025923 Bacteria 1235
318 Ga0207694_10149147 3300025924 Bacteria 1883
319 Ga0207694_10492572 3300025924 Bacteria 1026
320 Ga0207694_11411459 3300025924 Bacteria 588
321 Ga0207650_10144898 3300025925 Bacteria 1870
322 Ga0207650_11721061 3300025925 Bacteria 531
323 Ga0207659_10081043 3300025926 Unclassified 2399
324 Ga0207659_10239972 3300025926 Bacteria 1466
325 Ga0207659_10411656 3300025926 Bacteria 1133
326 Ga0207659_10565325 3300025926 Bacteria 968
327 Ga0207659_11596957 3300025926 Bacteria 557
328 Ga0207687_10039027 3300025927 Bacteria 3249
329 Ga0207687_10405947 3300025927 Bacteria 1121
330 Ga0207687_10710875 3300025927 Bacteria 853
331 Ga0207700_10054067 3300025928 Bacteria 3012
332 Ga0207664_10186879 3300025929 Bacteria 1782
333 Ga0207644_10025908 3300025931 Bacteria 4036
334 Ga0207644_10141375 3300025931 Bacteria 1854
335 Ga0207644_10962779 3300025931 Bacteria 716
336 Ga0207690_10598489 3300025932 Bacteria 900
337 Ga0207690_11873796 3300025932 Unclassified 500
338 Ga0207706_10627663 3300025933 Bacteria 922
339 Ga0207706_11051041 3300025933 Bacteria 682
340 Ga0207686_10017035 3300025934 Bacteria 4086
341 Ga0207686_10019084 3300025934 Bacteria 3893
342 Ga0207709_11472157 3300025935 Bacteria 565
343 Ga0207670_10051083 3300025936 Bacteria 2774
344 Ga0207670_10507998 3300025936 Bacteria 980
345 Ga0207670_10641997 3300025936 Bacteria 875
346 Ga0207670_10906805 3300025936 Unclassified 738
347 Ga0207669_10116499 3300025937 Bacteria 1803
348 Ga0207669_10125108 3300025937 Bacteria 1755
349 Ga0207669_10879807 3300025937 Bacteria 747
350 Ga0207669_11791536 3300025937 Bacteria 524
351 Ga0207704_10018853 3300025938 Bacteria 3612
352 Ga0207704_11330759 3300025938 Bacteria 615
353 Ga0207665_10083769 3300025939 Bacteria 2200
354 Ga0207665_10303384 3300025939 Bacteria 1194
355 Ga0207691_10011005 3300025940 Bacteria 8679
356 Ga0207691_10018783 3300025940 Bacteria 6548
357 Ga0207691_10317563 3300025940 Bacteria 1336
358 Ga0207691_10352614 3300025940 Bacteria 1259
359 Ga0207691_10911818 3300025940 Bacteria 735
360 Ga0207711_10013249 3300025941 Bacteria 6851
361 Ga0207711_10066603 3300025941 Bacteria 3115
362 Ga0207711_10094408 3300025941 Bacteria 2636
363 Ga0207711_10205704 3300025941 Bacteria 1797
364 Ga0207711_10356422 3300025941 Bacteria 1355
365 Ga0207711_11185741 3300025941 Bacteria 705
366 Ga0207711_12057295 3300025941 Bacteria 514
367 Ga0207711_12103071 3300025941 Unclassified 507
368 Ga0207689_10502932 3300025942 Bacteria 1015
369 Ga0207689_11220256 3300025942 Bacteria 633
370 Ga0207661_11168952 3300025944 Bacteria 708
371 Ga0207661_11777593 3300025944 Unclassified 562
372 Ga0207679_10372691 3300025945 Bacteria 1250
373 Ga0207679_10408947 3300025945 Unclassified 1195
374 Ga0207679_11566448 3300025945 Bacteria 604
375 Ga0207667_10411261 3300025949 Bacteria 1377
376 Ga0207651_10030690 3300025960 Bacteria 3427
377 Ga0207651_10068046 3300025960 Bacteria 2509
378 Ga0207651_10081429 3300025960 Bacteria 2334
379 Ga0207651_10129841 3300025960 Bacteria 1927
380 Ga0207651_10584787 3300025960 Bacteria 974
381 Ga0207712_10393609 3300025961 Bacteria 1163
382 Ga0207712_10528504 3300025961 Bacteria 1012
383 Ga0207668_10874264 3300025972 Bacteria 799
384 Ga0207668_11563933 3300025972 Unclassified 595
385 Ga0207640_10389896 3300025981 Bacteria 1131
386 Ga0207658_10359137 3300025986 Bacteria 1270
387 Ga0207658_10818245 3300025986 Bacteria 846
388 Ga0207677_10073305 3300026023 Bacteria 2424
389 Ga0207677_10946828 3300026023 Unclassified 778
390 Ga0207677_10976104 3300026023 Bacteria 767
391 Ga0207703_10011917 3300026035 Bacteria 6770
392 Ga0207703_10660586 3300026035 Bacteria 992
393 Ga0207703_11679298 3300026035 Bacteria 611
394 Ga0207639_10820557 3300026041 Bacteria 867
395 Ga0207639_11370255 3300026041 Bacteria 664
396 Ga0207678_10452773 3300026067 Bacteria 1116
397 Ga0207708_10141789 3300026075 Bacteria 1886
398 Ga0207641_10008679 3300026088 Bacteria 8391
399 Ga0207641_10190207 3300026088 Bacteria 1886
400 Ga0207641_11058408 3300026088 Bacteria 809
401 Ga0207641_11821110 3300026088 Bacteria 610
402 Ga0207641_12446218 3300026088 Bacteria 521
403 Ga0207648_10080796 3300026089 Bacteria 2836
404 Ga0207648_11189472 3300026089 Bacteria 716
405 Ga0207648_11543638 3300026089 Bacteria 624
406 Ga0207676_10008874 3300026095 Bacteria 7151
407 Ga0207676_10192799 3300026095 Unclassified 1794
408 Ga0207676_10285086 3300026095 Bacteria 1501
409 Ga0207676_12037254 3300026095 Bacteria 573
410 Ga0207676_12439750 3300026095 Bacteria 520
411 Ga0207674_10464841 3300026116 Bacteria 1223
412 Ga0207674_10991823 3300026116 Bacteria 809
413 Ga0207674_11265955 3300026116 Bacteria 707
414 Ga0207675_100054622 3300026118 Bacteria 3726
415 Ga0207675_100210931 3300026118 Bacteria 1868
416 Ga0207675_100422155 3300026118 Bacteria 1317
417 Ga0207675_102389124 3300026118 Unclassified 541
418 Ga0207683_10007156 3300026121 Bacteria 9568
419 Ga0207683_10103217 3300026121 Unclassified 2547
420 Ga0207683_10363607 3300026121 Bacteria 1329
421 Ga0207683_10506749 3300026121 Bacteria 1115
422 Ga0207683_10956545 3300026121 Bacteria 795
423 Ga0207683_11201561 3300026121 Bacteria 703
424 Ga0207698_11064933 3300026142 Bacteria 821
425 Ga0207698_11547093 3300026142 Unclassified 679
426 Ga0207428_10021799 3300027907 Bacteria 5420
427 Ga0207428_10172835 3300027907 Unclassified 1635
428 Ga0207428_10749136 3300027907 Bacteria 696
429 Ga0268266_10007803 3300028379 Bacteria 9598
430 Ga0268266_10119874 3300028379 Bacteria 2340
431 Ga0268266_10144565 3300028379 Bacteria 2137
432 Ga0268266_11533887 3300028379 Bacteria 642
433 Ga0268265_10007584 3300028380 Bacteria 7318
434 Ga0268264_10154369 3300028381 Bacteria 2062
435 Ga0268264_10311989 3300028381 Bacteria 1484
436 Ga0268264_10618986 3300028381 Bacteria 1069
437 Ga0268264_10719733 3300028381 Unclassified 992
438 Ga0268264_11528115 3300028381 Bacteria 678
439 Ga0307408_102469430 3300031548 Bacteria 505
440 Ga0307411_10673322 3300032005 Unclassified 898
441 Ga0373930_0006146 3300034816 Bacteria 2019
442 Ga0373948_0000547 3300034817 Bacteria 4739
443 Ga0373950_0003073 3300034818 Unclassified 2356
444 Ga0373958_0051367 3300034819 Bacteria 871
445 Ga0373959_0004263 3300034820 Bacteria 2300
446 Ga0373938_0000455 3300034957 Bacteria 6664
447 Ga0373938_0154363 3300034957 Bacteria 613
448 Ga0373928_0000949 3300035084 Bacteria 5702
449 Ga0373929_0011082 3300035085 Bacteria 1693
450 Ga0373940_0004240 3300035088 Bacteria 3016
451 Ga0373944_0291344 3300035089 Bacteria 611
452 Ga0373949_0000162 3300035090 Bacteria 25518
453 Ga0373951_0000284 3300035091 Bacteria 16235
454 Ga0373952_0003025 3300035092 Bacteria 3034
455 Ga0373923_0340806 3300035111 Unclassified 715
456 Ga0373923_0401302 3300035111 Bacteria 660
457 Ga0373923_0640938 3300035111 Bacteria 525
458 Ga0373932_0068445 3300035112 Bacteria 1095
459 Ga0373939_0000854 3300035114 Bacteria 7534
460 Ga0373941_0000610 3300035115 Bacteria 7212
461 Ga0373941_0035978 3300035115 Bacteria 1503
462 Ga0373945_0286253 3300035116 Bacteria 703
463 Ga0373956_0151370 3300035119 Bacteria 1092
464 Ga0373956_0166193 3300035119 Bacteria 1041
465 Ga0373956_0304770 3300035119 Bacteria 759
466 Ga0373956_0622518 3300035119 Unclassified 515
467 Ga0373960_0003285 3300035121 Bacteria 3657
468 Ga0373943_0308909 3300035170 Bacteria 899
469 Ga0373943_0660830 3300035170 Unclassified 618
470 Ga0373943_0715525 3300035170 Unclassified 594
471 Ga0373955_0236015 3300035172 Bacteria 1095
472 Ga0373955_0356002 3300035172 Bacteria 887
473 Ga0373942_0000660 3300035207 Bacteria 9662
474 Ga0373961_0000449 3300035241 Bacteria 16580
475 Ga0373961_0126693 3300035241 Bacteria 851
476 Ga0373962_0000291 3300035242 Bacteria 10766
477 Ga0373962_0032013 3300035242 Bacteria 1445
478 Ga0373962_0338107 3300035242 Unclassified 542
479 Ga0373924_0027411 3300035410 Bacteria 2265
480 Ga0373924_0124884 3300035410 Bacteria 1118
481 Ga0373931_0005981 3300035691 Bacteria 5657
482 Ga0373935_0298124 3300035692 Bacteria 1139
483 Ga0373935_0426009 3300035692 Bacteria 956
484 Ga0373935_0920859 3300035692 Unclassified 648
485 Ga0373927_0424360 3300035695 Bacteria 878
486 Ga0373933_0228325 3300035724 Bacteria 1195
487 Ga0373933_0359456 3300035724 Bacteria 947
488 Ga0373933_0460835 3300035724 Bacteria 832
489 Ga0373947_0613145 3300035725 Unclassified 742
490 Ga0373947_0633143 3300035725 Bacteria 729
491 Ga0373947_0916291 3300035725 Bacteria 598
492 Ga0373937_0103272 3300036401 Bacteria 2647
493 Ga0373937_0144210 3300036401 Bacteria 2229
494 Ga0373937_0693095 3300036401 Unclassified 965
495 Ga0373937_2025789 3300036401 Unclassified 522
496 Ga0373925_0168961 3300037068 Bacteria 1726
497 Ga0373925_0661174 3300037068 Bacteria 861
498 Ga0373925_0919766 3300037068 Bacteria 721
499 Ga0395901_0911782 3300038443 Bacteria 860
500 Ga0451847_0066334 3300041503 Bacteria 741
501 Ga0451849_0493387 3300041505 Unclassified 622
502 Ga0451853_2387358 3300041512 Bacteria 541
503 Ga0439448_0352358 3300042005 Unclassified 525
504 Ga0439450_065641 3300042008 Unclassified 884
505 Ga0450905_037674 3300042142 Bacteria 761
506 Ga0450889_036122 3300042144 Bacteria 588
507 Ga0439464_0005969 3300042439 Bacteria 3166
508 Ga0439464_0329720 3300042439 Bacteria 501
509 Ga0439440_0082213 3300042993 Bacteria 853
510 Ga0466957_1410497 3300044842 Bacteria 507
511 Ga0451576_0005989 3300045051 Bacteria 15034
512 Ga0466958_1053712 3300045836 Unclassified 531
513 Ga0466967_2433042 3300045976 Bacteria 519
514 Ga0495603_0447237 3300046455 Bacteria 740
515 Ga0495603_0831301 3300046455 Bacteria 526
516 Ga0495629_0221178 3300046459 Bacteria 1306
517 Ga0495629_0454662 3300046459 Unclassified 867
518 Ga0495629_0729021 3300046459 Bacteria 657
519 Ga0495629_1026513 3300046459 Bacteria 536
520 Ga0495580_0323542 3300046472 Bacteria 1048
521 Ga0495580_0864582 3300046472 Bacteria 583
522 Ga0495582_0080311 3300046473 Bacteria 1811
523 Ga0495582_0305879 3300046473 Unclassified 914
524 Ga0495582_0401035 3300046473 Bacteria 791
525 Ga0495582_0758362 3300046473 Bacteria 561
526 Ga0495639_0078555 3300046475 Bacteria 1534
527 Ga0495639_0469025 3300046475 Bacteria 641
528 Ga0495639_0515090 3300046475 Bacteria 611
529 Ga0495584_0373764 3300046491 Bacteria 724
530 Ga0495618_0718020 3300046514 Bacteria 587
531 Ga0495628_0087790 3300046516 Bacteria 2411
532 Ga0495628_0987748 3300046516 Unclassified 580
533 Ga0495642_0430225 3300046528 Bacteria 583
534 Ga0495652_0710235 3300046529 Bacteria 676
535 Ga0495665_0375244 3300046531 Bacteria 723
536 Ga0495640_0393126 3300046533 Bacteria 852
537 Ga0495586_0117047 3300046535 Bacteria 1487
538 Ga0495598_0157146 3300046537 Bacteria 798
539 Ga0495621_0213738 3300046539 Bacteria 779
540 Ga0495622_0363458 3300046557 Bacteria 626
541 Ga0495633_0388895 3300046558 Bacteria 631
542 Ga0495656_0268924 3300046615 Bacteria 866
543 Ga0495668_0686500 3300046616 Bacteria 566
544 Ga0495634_0364064 3300046642 Bacteria 864
545 Ga0495635_0315531 3300046663 Bacteria 1047
546 Ga0495635_0365716 3300046663 Bacteria 961
547 Ga0495635_0781213 3300046663 Bacteria 616
548 Ga0495647_0270021 3300046681 Bacteria 761
549 Ga0495647_0299215 3300046681 Unclassified 725
550 Ga0495658_0018967 3300046683 Bacteria 3585
551 Ga0495658_0120442 3300046683 Bacteria 1587
552 Ga0495658_0231788 3300046683 Bacteria 1158
553 Ga0495658_0532455 3300046683 Unclassified 752
554 Ga0495658_1045664 3300046683 Bacteria 521
555 Ga0495669_0251497 3300046684 Bacteria 849
556 Ga0495613_0115298 3300046689 Bacteria 1934
557 Ga0495613_0583715 3300046689 Bacteria 745
558 Ga0495670_0407762 3300046691 Bacteria 735
559 Ga0495600_0122304 3300046809 Bacteria 1693
560 Ga0495581_0707489 3300047315 Bacteria 581
561 Ga0495674_0115593 3300047319 Bacteria 2271
562 Ga0495676_0797490 3300047321 Unclassified 608
563 Ga0495680_0396771 3300047322 Bacteria 953
564 Ga0495684_0287711 3300047471 Bacteria 1184
565 Ga0495593_0464587 3300047673 Bacteria 634
566 Ga0495602_0198657 3300048088 Bacteria 1532
567 Ga0495614_0293971 3300048089 Bacteria 750
568 Ga0496100_0491610 3300048903 Bacteria 945
569 Ga0496101_0000261 3300048904 Bacteria 37482
570 Ga0496102_0183398 3300048905 Bacteria 1972
571 Ga0496102_0834634 3300048905 Bacteria 844
572 Ga0496102_1206315 3300048905 Bacteria 676
573 Ga0496104_0089637 3300048907 Bacteria 2938
574 Ga0496104_0221044 3300048907 Bacteria 1806
575 Ga0496104_1496719 3300048907 Bacteria 578
576 Ga0496104_1627642 3300048907 Bacteria 548
577 Ga0496105_0168729 3300048908 Bacteria 1795
578 Ga0496106_0036384 3300048909 Bacteria 3683
579 Ga0496106_0049220 3300048909 Bacteria 3175
580 Ga0496106_0343798 3300048909 Bacteria 1198
581 Ga0496106_0345383 3300048909 Bacteria 1195
582 Ga0496106_0443142 3300048909 Unclassified 1043
583 Ga0496106_0598972 3300048909 Bacteria 883
584 Ga0496107_0095264 3300048910 Bacteria 2178
585 Ga0496107_0305230 3300048910 Bacteria 1185
586 Ga0496108_0281478 3300048911 Bacteria 1448
587 Ga0496108_0518632 3300048911 Bacteria 1040
588 Ga0496109_0078084 3300048912 Bacteria 3048
589 Ga0496110_0230331 3300048913 Bacteria 1685
590 Ga0496110_1686370 3300048913 Bacteria 544
591 Ga0496111_0067897 3300048914 Bacteria 2591
592 Ga0496111_0313766 3300048914 Bacteria 1162
593 Ga0496112_0043576 3300048915 Unclassified 4393
594 Ga0496112_1187911 3300048915 Bacteria 680
595 Ga0496112_1791444 3300048915 Bacteria 526
596 Ga0496114_0094027 3300048917 Bacteria 2550
597 Ga0496114_0141095 3300048917 Bacteria 2086
598 Ga0496114_0315892 3300048917 Bacteria 1380
599 Ga0496114_0380099 3300048917 Bacteria 1250
600 Ga0496115_0144503 3300048918 Bacteria 1963
601 Ga0501032_0130236 3300049569 Bacteria 1660
602 Ga0501034_0315082 3300049571 Bacteria 1498
603 Ga0501036_1321553 3300049572 Unclassified 586
604 Ga0501037_0443567 3300049573 Unclassified 886
605 Ga0501046_0572722 3300049580 Bacteria 803
606 Ga0501047_0008630 3300049581 Bacteria 9625
607 Ga0501047_0978361 3300049581 Unclassified 659
608 Ga0501071_1201964 3300049587 Unclassified 586
609 Ga0501077_0421345 3300049593 Unclassified 854
610 Ga0501251_046648 3300049681 Bacteria 674
611 Ga0501225_0310810 3300049705 Bacteria 536
612 Ga0501080_1221874 3300049742 Bacteria 645
613 Ga0501081_0432178 3300049743 Bacteria 977
614 Ga0501083_0371738 3300049744 Unclassified 930
615 Ga0501035_0370170 3300049822 Bacteria 1196
616 Ga0501044_0023611 3300049823 Bacteria 6539
617 Ga0501045_0860624 3300049824 Bacteria 667
618 nmdc:mga05p37_16604_c1 3300050507 Bacteria 8868
619 nmdc:mga05p37_3632_c1 3300050507 Bacteria 18032
620 nmdc:mga05p37_44508_c1 3300050507 Bacteria 5461
621 nmdc:mga05p37_98111_c1 3300050507 Bacteria 3609
622 nmdc:mga09592_768785_c1 3300050508 Bacteria 816
623 nmdc:mga06r32_84304_c1 3300050510 Bacteria 3097
624 nmdc:mga08y16_110466_c1 3300050511 Bacteria 2863
625 nmdc:mga08y16_1581456_c1 3300050511 Bacteria 614
626 nmdc:mga08y16_2118565_c1 3300050511 Unclassified 510
627 nmdc:mga08y16_283314_c1 3300050511 Bacteria 1709
628 nmdc:mga08y16_46634_c1 3300050511 Bacteria 4537
629 nmdc:mga0n895_1028124_c1 3300050512 Bacteria 804
630 nmdc:mga0n895_1142003_c1 3300050512 Bacteria 755
631 nmdc:mga0n895_1564038_c1 3300050512 Bacteria 624
632 nmdc:mga0n895_1706363_c1 3300050512 Bacteria 592
633 nmdc:mga0n895_191419_c1 3300050512 Unclassified 2076
634 nmdc:mga0n895_191652_c1 3300050512 Bacteria 2075
635 nmdc:mga0n895_2018_c1 3300050512 Bacteria 15602
636 nmdc:mga0n895_2113194_c1 3300050512 Unclassified 519
637 nmdc:mga0n895_701444_c1 3300050512 Bacteria 1008
638 nmdc:mga0rr50_1179375_c1 3300050513 Bacteria 651
639 nmdc:mga0rr50_1457429_c1 3300050513 Bacteria 579
640 nmdc:mga0rr50_1704_c1 3300050513 Bacteria 12133
641 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
642 nmdc:mga0rr50_36173_c1 3300050513 Bacteria 3553
643 nmdc:mga0rr50_48885_c1 3300050513 Bacteria 3129
644 nmdc:mga0rr50_803671_c1 3300050513 Bacteria 802
645 nmdc:mga08x19_1129043_c1 3300050514 Bacteria 556
646 nmdc:mga08x19_155095_c1 3300050514 Bacteria 1553
647 nmdc:mga08x19_18408_c1 3300050514 Bacteria 4281
648 nmdc:mga08x19_340_c1 3300050514 Bacteria 33767
649 nmdc:mga08x19_662171_c1 3300050514 Bacteria 741
650 nmdc:mga08x19_97895_c1 3300050514 Bacteria 1943
651 nmdc:mga0a205_110158_c1 3300050515 Bacteria 2652
652 nmdc:mga0a205_1156219_c1 3300050515 Unclassified 621
653 nmdc:mga0a205_462862_c1 3300050515 Bacteria 1127
654 Ga0495601_0075085 3300053077 Bacteria 2164
655 Ga0495601_0342649 3300053077 Bacteria 972
656 Ga0495612_0087273 3300053078 Bacteria 1317
657 Ga0495595_0179238 3300053084 Bacteria 1050
658 Ga0495595_0388353 3300053084 Bacteria 707
659 Ga0495619_0057467 3300053085 Bacteria 2582
660 Ga0495619_0161256 3300053085 Bacteria 1549
661 Ga0495619_0474916 3300053085 Bacteria 861
662 Ga0500566_0449380 3300053094 Bacteria 565
663 Ga0501084_0855672 3300054114 Bacteria 765
664 Ga0590071_163964 3300059421 Bacteria 579
665 Ga0501082_0380957 3300060353 Bacteria 1231
666 Ga0501082_0721477 3300060353 Bacteria 872
667 Ga0530510_0640777 3300061734 Bacteria 809
668 Ga0070663_101034680
669 JGI24751J29686_10021741
670 Ga0065712_10021813
671 Ga0065712_10132370
672 Ga0065712_10142212
673 Ga0065712_10360560
674 Ga0065715_10024371
675 Ga0065715_10171569
676 Ga0065715_10204074
677 Ga0065715_10547893
678 Ga0065707_10954672
679 Ga0065707_11138845
680 Ga0070676_10550276
681 Ga0070676_10736190
682 Ga0070683_100507917
683 Ga0070683_102099755
684 Ga0070690_100098667
685 Ga0070690_100956486
686 Ga0070670_100762041
687 Ga0068869_101138771
688 Ga0070666_10125593
689 Ga0070666_10177997
690 Ga0068868_100268389
691 Ga0068868_100486661
692 Ga0068868_100905032
693 Ga0070689_100375253
694 Ga0070689_101631393
695 Ga0070687_100310474
696 Ga0070687_100456838
697 Ga0070661_100707863
698 Ga0070692_10787528
699 Ga0070668_101104645
700 Ga0070669_100196269
701 Ga0070669_100240469
702 Ga0070669_100583507
703 Ga0070675_100149448
704 Ga0070675_100211709
705 Ga0070675_100876347
706 Ga0070675_100896096
707 Ga0070675_101301871
708 Ga0070675_101542347
709 Ga0070671_100039770
710 Ga0070671_100283733
711 Ga0070674_100106711
712 Ga0070674_101240601
713 Ga0070673_100099331
714 Ga0070673_100100609
715 Ga0070673_100143749
716 Ga0070673_101884074
717 Ga0070673_102211826
718 Ga0070688_100488463
719 Ga0070688_100623765
720 Ga0070659_100269219
721 Ga0070659_101454057
722 Ga0070667_100008544
723 Ga0070667_100224782
724 Ga0070667_100327711
725 Ga0070709_10819740
726 Ga0070714_100025808
727 Ga0070713_101140587
728 Ga0070701_11137688
729 Ga0070711_100138621
730 Ga0070705_100819547
731 Ga0070700_100365881
732 Ga0070700_101860833
733 Ga0070708_100561760
734 Ga0070708_101257356
735 Ga0070708_101698096
736 Ga0070708_102088014
737 Ga0070678_100003319
738 Ga0070678_100319089
739 Ga0070678_100440998
740 Ga0070662_100533338
741 Ga0068867_100355731
742 Ga0068867_100403817
743 Ga0070685_10143988
744 Ga0070685_10195338
745 Ga0070707_100236782
746 Ga0070707_102316002
747 Ga0070698_100059703
748 Ga0070699_100245307
749 Ga0070699_100246152
750 Ga0070699_100616201
751 Ga0070679_100101799
752 Ga0070679_100404308
753 Ga0070684_100803885
754 Ga0070684_101084973
755 Ga0070684_101549417
756 Ga0070697_100299652
757 Ga0070697_100362397
758 Ga0070697_100410488
759 Ga0068853_102213844
760 Ga0070672_100047197
761 Ga0070672_100315648
762 Ga0070672_100792009
763 Ga0070672_100825170
764 Ga0070672_101583336
765 Ga0070672_101964732
766 Ga0070686_100111264
767 Ga0070686_100279654
768 Ga0070686_100760905
769 Ga0070695_100348288
770 Ga0070695_101785012
771 Ga0070696_100875293
772 Ga0070693_100033512
773 Ga0070665_100001145
774 Ga0070665_100009496
775 Ga0070665_100128963
776 Ga0070665_101561610
777 Ga0070665_101720682
778 Ga0070704_101704205
779 Ga0068855_101215778
780 Ga0070664_100635968
781 Ga0070664_101907393
782 Ga0070664_102185527
783 Ga0068857_100186387
784 Ga0068857_101130595
785 Ga0068857_102472198
786 Ga0068854_100268405
787 Ga0070702_100722252
788 Ga0070702_100871456
789 Ga0068852_100232998
790 Ga0068852_102605418
791 Ga0068859_100337894
792 Ga0068859_100352918
793 Ga0068859_100366146
794 Ga0068859_100607217
795 Ga0068859_100939191
796 Ga0068859_101440222
797 Ga0068859_102081329
798 Ga0068859_103045861
799 Ga0068864_100017150
800 Ga0068864_100049294
801 Ga0068864_100187331
802 Ga0068866_10137282
803 Ga0068866_10350417
804 Ga0068861_100140179
805 Ga0068861_101264092
806 Ga0068851_10522938
807 Ga0068863_100002664
808 Ga0068863_100123536
809 Ga0068858_100008048
810 Ga0068858_100074660
811 Ga0068860_100170347
812 Ga0068860_100468922
813 Ga0068860_102345458
814 Ga0068860_102395924
815 Ga0068862_100011054
816 Ga0068862_101052797
817 Ga0068862_101936094
818 Ga0081455_10102328
819 Ga0081539_10401976
820 Ga0070717_11154678
821 Ga0070715_10182657
822 Ga0070715_10229584
823 Ga0070716_100358798
824 Ga0070716_100813963
825 Ga0097621_100004292
826 Ga0097621_100006029
827 Ga0097621_100050602
828 Ga0097621_100094579
829 Ga0097621_100131530
830 Ga0068871_100003753
831 Ga0068871_100046892
832 Ga0068871_100385550
833 Ga0068871_100686846
834 Ga0075428_100056377
835 Ga0075430_101416093
836 Ga0075431_100069140
837 Ga0075431_101450173
838 Ga0075431_101498405
839 Ga0075433_10368191
840 Ga0075433_10416702
841 Ga0075434_100004125
842 Ga0075434_100025112
843 Ga0075434_100464052
844 Ga0075434_100775870
845 Ga0075434_101718261
846 Ga0075434_101744257
847 Ga0075434_101939863
848 Ga0075434_102347992
849 Ga0075429_100605956
850 Ga0075436_100002722
851 Ga0075436_100039696
852 Ga0075436_100050435
853 Ga0075436_100136480
854 Ga0075436_101358498
855 Ga0097620_100337929
856 Ga0097620_100352945
857 Ga0097620_100366164
858 Ga0097620_100607305
859 Ga0097620_100939251
860 Ga0097620_101440292
861 Ga0097620_102081412
862 Ga0097620_103045556
863 Ga0075435_100000084
864 Ga0075435_100001367
865 Ga0075435_100034892
866 Ga0075435_100045342
867 Ga0075435_100166513
868 Ga0075435_100377277
869 Ga0075435_101265878
870 Ga0075435_101665057
871 Ga0105251_10187034
872 Ga0105250_10360495
873 Ga0105240_10011092
874 Ga0105240_10296017
875 Ga0105240_10810304
876 Ga0105240_11204961
877 Ga0105240_12210412
878 Ga0111539_10029326
879 Ga0111539_10119743
880 Ga0111539_11194229
881 Ga0105245_10045287
882 Ga0105245_10070349
883 Ga0105245_10531334
884 Ga0105245_11302063
885 Ga0105245_11964375
886 Ga0105247_10021551
887 Ga0105247_10552040
888 Ga0105247_10834054
889 Ga0114129_10004514
890 Ga0114129_10012248
891 Ga0114129_10059192
892 Ga0114129_10338375
893 Ga0105243_10263768
894 Ga0105243_10575718
895 Ga0105243_10699687
896 Ga0105241_12229552
897 Ga0105242_10002352
898 Ga0105242_10012814
899 Ga0105242_10014739
900 Ga0105242_10751268
901 Ga0105242_11632470
902 Ga0105242_11644685
903 Ga0105242_11689459
904 Ga0105242_11710618
905 Ga0105248_10011730
906 Ga0105248_10039155
907 Ga0105248_10051904
908 Ga0105248_10105417
909 Ga0105248_10279377
910 Ga0105248_10309456
911 Ga0105248_10619076
912 Ga0105248_11743250
913 Ga0105237_10427748
914 Ga0105238_10054686
915 Ga0105238_10529016
916 Ga0105249_11138335
917 Ga0105249_11178793
918 Ga0105249_11673511
919 Ga0105239_11528778
920 Ga0157313_1048657
921 Ga0157374_10036446
922 Ga0157374_10369303
923 Ga0157378_10662054
924 Ga0157378_10697566
925 Ga0157378_12318945
926 Ga0163162_10065887
927 Ga0163162_10670867
928 Ga0163162_11490080
929 Ga0163162_13191648
930 Ga0157372_13142463
931 Ga0157375_10001923
932 Ga0157375_11279155
933 Ga0157375_11895052
934 Ga0157375_13614646
935 Ga0163163_10030557
936 Ga0163163_10108630
937 Ga0163163_10444859
938 Ga0163163_10758674
939 Ga0163163_11894576
940 Ga0157380_10036562
941 Ga0157380_10583176
942 Ga0157380_12718550
943 Ga0157377_10481754
944 Ga0157379_10028453
945 Ga0157379_10149368
946 Ga0157379_10476237
947 Ga0157379_10492272
948 Ga0157376_10019114
949 Ga0157376_10120095
950 Ga0157376_10787368
951 Ga0157376_10788780
952 Ga0157376_10913072
953 Ga0157376_11102236
954 Ga0163161_11494669
955 Ga0207697_10080386
956 Ga0207697_10120828
957 Ga0207656_10285600
958 Ga0207656_10359113
959 Ga0207682_10582961
960 Ga0207642_10315778
961 Ga0207710_10015139
962 Ga0207710_10298671
963 Ga0207688_10450594
964 Ga0207688_10662380
965 Ga0207680_10033826
966 Ga0207680_10045734
967 Ga0207685_10136555
968 Ga0207645_10305074
969 Ga0207645_10543704
970 Ga0207695_10084400
971 Ga0207695_10789047
972 Ga0207695_10895467
973 Ga0207695_10898294
974 Ga0207671_10971552
975 Ga0207663_10275022
976 Ga0207662_10018583
977 Ga0207662_10166660
978 Ga0207662_10856684
979 Ga0207652_10420854
980 Ga0207646_10314172
981 Ga0207681_10009496
982 Ga0207681_10024465
983 Ga0207681_10133129
984 Ga0207681_10319097
985 Ga0207694_10149147
986 Ga0207694_10492572
987 Ga0207694_11411459
988 Ga0207650_10144898
989 Ga0207650_11721061
990 Ga0207659_10081043
991 Ga0207659_10239972
992 Ga0207659_10411656
993 Ga0207659_10565325
994 Ga0207659_11596957
995 Ga0207687_10039027
996 Ga0207687_10405947
997 Ga0207687_10710875
998 Ga0207700_10054067
999 Ga0207664_10186879
1000 Ga0207644_10025908
1001 Ga0207644_10141375
1002 Ga0207644_10962779
1003 Ga0207690_10598489
1004 Ga0207690_11873796
1005 Ga0207706_10627663
1006 Ga0207706_11051041
1007 Ga0207686_10017035
1008 Ga0207686_10019084
1009 Ga0207709_11472157
1010 Ga0207670_10051083
1011 Ga0207670_10507998
1012 Ga0207670_10641997
1013 Ga0207670_10906805
1014 Ga0207669_10116499
1015 Ga0207669_10125108
1016 Ga0207669_10879807
1017 Ga0207669_11791536
1018 Ga0207704_10018853
1019 Ga0207704_11330759
1020 Ga0207665_10083769
1021 Ga0207665_10303384
1022 Ga0207691_10011005
1023 Ga0207691_10018783
1024 Ga0207691_10317563
1025 Ga0207691_10352614
1026 Ga0207691_10911818
1027 Ga0207711_10013249
1028 Ga0207711_10066603
1029 Ga0207711_10094408
1030 Ga0207711_10205704
1031 Ga0207711_10356422
1032 Ga0207711_11185741
1033 Ga0207711_12057295
1034 Ga0207711_12103071
1035 Ga0207689_10502932
1036 Ga0207689_11220256
1037 Ga0207661_11168952
1038 Ga0207661_11777593
1039 Ga0207679_10372691
1040 Ga0207679_10408947
1041 Ga0207679_11566448
1042 Ga0207667_10411261
1043 Ga0207651_10030690
1044 Ga0207651_10068046
1045 Ga0207651_10081429
1046 Ga0207651_10129841
1047 Ga0207651_10584787
1048 Ga0207712_10393609
1049 Ga0207712_10528504
1050 Ga0207668_10874264
1051 Ga0207668_11563933
1052 Ga0207640_10389896
1053 Ga0207658_10359137
1054 Ga0207658_10818245
1055 Ga0207677_10073305
1056 Ga0207677_10946828
1057 Ga0207677_10976104
1058 Ga0207703_10011917
1059 Ga0207703_10660586
1060 Ga0207703_11679298
1061 Ga0207639_10820557
1062 Ga0207639_11370255
1063 Ga0207678_10452773
1064 Ga0207708_10141789
1065 Ga0207641_10008679
1066 Ga0207641_10190207
1067 Ga0207641_11058408
1068 Ga0207641_11821110
1069 Ga0207641_12446218
1070 Ga0207648_10080796
1071 Ga0207648_11189472
1072 Ga0207648_11543638
1073 Ga0207676_10008874
1074 Ga0207676_10192799
1075 Ga0207676_10285086
1076 Ga0207676_12037254
1077 Ga0207676_12439750
1078 Ga0207674_10464841
1079 Ga0207674_10991823
1080 Ga0207674_11265955
1081 Ga0207675_100054622
1082 Ga0207675_100210931
1083 Ga0207675_100422155
1084 Ga0207675_102389124
1085 Ga0207683_10007156
1086 Ga0207683_10103217
1087 Ga0207683_10363607
1088 Ga0207683_10506749
1089 Ga0207683_10956545
1090 Ga0207683_11201561
1091 Ga0207698_11064933
1092 Ga0207698_11547093
1093 Ga0207428_10021799
1094 Ga0207428_10172835
1095 Ga0207428_10749136
1096 Ga0268266_10007803
1097 Ga0268266_10119874
1098 Ga0268266_10144565
1099 Ga0268266_11533887
1100 Ga0268265_10007584
1101 Ga0268264_10154369
1102 Ga0268264_10311989
1103 Ga0268264_10618986
1104 Ga0268264_10719733
1105 Ga0268264_11528115
1106 Ga0307408_102469430
1107 Ga0307411_10673322
1108 Ga0373930_0006146
1109 Ga0373948_0000547
1110 Ga0373950_0003073
1111 Ga0373958_0051367
1112 Ga0373959_0004263
1113 Ga0373938_0000455
1114 Ga0373938_0154363
1115 Ga0373928_0000949
1116 Ga0373929_0011082
1117 Ga0373940_0004240
1118 Ga0373944_0291344
1119 Ga0373949_0000162
1120 Ga0373951_0000284
1121 Ga0373952_0003025
1122 Ga0373923_0340806
1123 Ga0373923_0401302
1124 Ga0373923_0640938
1125 Ga0373932_0068445
1126 Ga0373939_0000854
1127 Ga0373941_0000610
1128 Ga0373941_0035978
1129 Ga0373945_0286253
1130 Ga0373956_0151370
1131 Ga0373956_0166193
1132 Ga0373956_0304770
1133 Ga0373956_0622518
1134 Ga0373960_0003285
1135 Ga0373943_0308909
1136 Ga0373943_0660830
1137 Ga0373943_0715525
1138 Ga0373955_0236015
1139 Ga0373955_0356002
1140 Ga0373942_0000660
1141 Ga0373961_0000449
1142 Ga0373961_0126693
1143 Ga0373962_0000291
1144 Ga0373962_0032013
1145 Ga0373962_0338107
1146 Ga0373924_0027411
1147 Ga0373924_0124884
1148 Ga0373931_0005981
1149 Ga0373935_0298124
1150 Ga0373935_0426009
1151 Ga0373935_0920859
1152 Ga0373927_0424360
1153 Ga0373933_0228325
1154 Ga0373933_0359456
1155 Ga0373933_0460835
1156 Ga0373947_0613145
1157 Ga0373947_0633143
1158 Ga0373947_0916291
1159 Ga0373937_0103272
1160 Ga0373937_0144210
1161 Ga0373937_0693095
1162 Ga0373937_2025789
1163 Ga0373925_0168961
1164 Ga0373925_0661174
1165 Ga0373925_0919766
1166 Ga0395901_0911782
1167 Ga0451847_0066334
1168 Ga0451849_0493387
1169 Ga0451853_2387358
1170 Ga0439448_0352358
1171 Ga0439450_065641
1172 Ga0450905_037674
1173 Ga0450889_036122
1174 Ga0439464_0005969
1175 Ga0439464_0329720
1176 Ga0439440_0082213
1177 Ga0466957_1410497
1178 Ga0451576_0005989
1179 Ga0466958_1053712
1180 Ga0466967_2433042
1181 Ga0495603_0447237
1182 Ga0495603_0831301
1183 Ga0495629_0221178
1184 Ga0495629_0454662
1185 Ga0495629_0729021
1186 Ga0495629_1026513
1187 Ga0495580_0323542
1188 Ga0495580_0864582
1189 Ga0495582_0080311
1190 Ga0495582_0305879
1191 Ga0495582_0401035
1192 Ga0495582_0758362
1193 Ga0495639_0078555
1194 Ga0495639_0469025
1195 Ga0495639_0515090
1196 Ga0495584_0373764
1197 Ga0495618_0718020
1198 Ga0495628_0087790
1199 Ga0495628_0987748
1200 Ga0495642_0430225
1201 Ga0495652_0710235
1202 Ga0495665_0375244
1203 Ga0495640_0393126
1204 Ga0495586_0117047
1205 Ga0495598_0157146
1206 Ga0495621_0213738
1207 Ga0495622_0363458
1208 Ga0495633_0388895
1209 Ga0495656_0268924
1210 Ga0495668_0686500
1211 Ga0495634_0364064
1212 Ga0495635_0315531
1213 Ga0495635_0365716
1214 Ga0495635_0781213
1215 Ga0495647_0270021
1216 Ga0495647_0299215
1217 Ga0495658_0018967
1218 Ga0495658_0120442
1219 Ga0495658_0231788
1220 Ga0495658_0532455
1221 Ga0495658_1045664
1222 Ga0495669_0251497
1223 Ga0495613_0115298
1224 Ga0495613_0583715
1225 Ga0495670_0407762
1226 Ga0495600_0122304
1227 Ga0495581_0707489
1228 Ga0495674_0115593
1229 Ga0495676_0797490
1230 Ga0495680_0396771
1231 Ga0495684_0287711
1232 Ga0495593_0464587
1233 Ga0495602_0198657
1234 Ga0495614_0293971
1235 Ga0496100_0491610
1236 Ga0496101_0000261
1237 Ga0496102_0183398
1238 Ga0496102_0834634
1239 Ga0496102_1206315
1240 Ga0496104_0089637
1241 Ga0496104_0221044
1242 Ga0496104_1496719
1243 Ga0496104_1627642
1244 Ga0496105_0168729
1245 Ga0496106_0036384
1246 Ga0496106_0049220
1247 Ga0496106_0343798
1248 Ga0496106_0345383
1249 Ga0496106_0443142
1250 Ga0496106_0598972
1251 Ga0496107_0095264
1252 Ga0496107_0305230
1253 Ga0496108_0281478
1254 Ga0496108_0518632
1255 Ga0496109_0078084
1256 Ga0496110_0230331
1257 Ga0496110_1686370
1258 Ga0496111_0067897
1259 Ga0496111_0313766
1260 Ga0496112_0043576
1261 Ga0496112_1187911
1262 Ga0496112_1791444
1263 Ga0496114_0094027
1264 Ga0496114_0141095
1265 Ga0496114_0315892
1266 Ga0496114_0380099
1267 Ga0496115_0144503
1268 Ga0501032_0130236
1269 Ga0501034_0315082
1270 Ga0501036_1321553
1271 Ga0501037_0443567
1272 Ga0501046_0572722
1273 Ga0501047_0008630
1274 Ga0501047_0978361
1275 Ga0501071_1201964
1276 Ga0501077_0421345
1277 Ga0501251_046648
1278 Ga0501225_0310810
1279 Ga0501080_1221874
1280 Ga0501081_0432178
1281 Ga0501083_0371738
1282 Ga0501035_0370170
1283 Ga0501044_0023611
1284 Ga0501045_0860624
1285 nmdc:mga05p37_16604_c1
1286 nmdc:mga05p37_3632_c1
1287 nmdc:mga05p37_44508_c1
1288 nmdc:mga05p37_98111_c1
1289 nmdc:mga09592_768785_c1
1290 nmdc:mga06r32_84304_c1
1291 nmdc:mga08y16_110466_c1
1292 nmdc:mga08y16_1581456_c1
1293 nmdc:mga08y16_2118565_c1
1294 nmdc:mga08y16_283314_c1
1295 nmdc:mga08y16_46634_c1
1296 nmdc:mga0n895_1028124_c1
1297 nmdc:mga0n895_1142003_c1
1298 nmdc:mga0n895_1564038_c1
1299 nmdc:mga0n895_1706363_c1
1300 nmdc:mga0n895_191419_c1
1301 nmdc:mga0n895_191652_c1
1302 nmdc:mga0n895_2018_c1
1303 nmdc:mga0n895_2113194_c1
1304 nmdc:mga0n895_701444_c1
1305 nmdc:mga0rr50_1179375_c1
1306 nmdc:mga0rr50_1457429_c1
1307 nmdc:mga0rr50_1704_c1
1308 nmdc:mga0rr50_2_c1
1309 nmdc:mga0rr50_36173_c1
1310 nmdc:mga0rr50_48885_c1
1311 nmdc:mga0rr50_803671_c1
1312 nmdc:mga08x19_1129043_c1
1313 nmdc:mga08x19_155095_c1
1314 nmdc:mga08x19_18408_c1
1315 nmdc:mga08x19_340_c1
1316 nmdc:mga08x19_662171_c1
1317 nmdc:mga08x19_97895_c1
1318 nmdc:mga0a205_110158_c1
1319 nmdc:mga0a205_1156219_c1
1320 nmdc:mga0a205_462862_c1
1321 Ga0495601_0075085
1322 Ga0495601_0342649
1323 Ga0495612_0087273
1324 Ga0495595_0179238
1325 Ga0495595_0388353
1326 Ga0495619_0057467
1327 Ga0495619_0161256
1328 Ga0495619_0474916
1329 Ga0500566_0449380
1330 Ga0501084_0855672
1331 Ga0590071_163964
1332 Ga0501082_0380957
1333 Ga0501082_0721477
1334 Ga0530510_0640777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kva-assembly1.cif.gz_b structure of west nile virus (kunjin) 0.9499 13 38
7kvb-assembly1.cif.gz_a chimeric flavivirus between binjari virus and murray valley encephalitis virus 0.9247 13 39
7lcg-assembly1.cif.gz_F the mature usutu saar-1776, model a 0.8952 13 38
3kof-assembly2.cif.gz_B crystal structure of the double mutant f178y/r181e of e.coli transaldolase b 0.895 9 47
4s2c-assembly1.cif.gz_B covalent complex of e. coli transaldolase talb with fructose-6-phosphate 0.8825 12 47
ID Description Score Start End Superfamily
1r5zB02 Mainly Alpha;Up-down Bundle;V-type ATP synthase subunit C fold;V-type ATP synthase subunit C domain 0.8928 13 46 1.20.1690.10
3ia3C00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;AHSP 0.8061 2 45 1.20.58.420
6co8F00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Flavivirus envelope glycoprotein M-like 0.7967 13 46 1.10.8.970
1z8uA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;AHSP 0.7961 2 45 1.20.58.420
3ovuA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;AHSP 0.7896 2 45 1.20.58.420
ID Description Score Start End GO Terms
AF-A0A7X5VLS8-F1-model_v4 Uncharacterized protein 0.9681 1 54 GO:0016020
AF-A0A2V9D4I7-F1-model_v4 DUF2768 domain-containing protein 0.965 3 54 GO:0016020
AF-A0A0C5X3T7-F1-model_v4 deleted 0.959 12 48
AF-A0A7X5VLS8-F1-model_v4 Uncharacterized protein 0.9509 1 54 GO:0016020
AF-A0A348V080-F1-model_v4 DUF2768 domain-containing protein 0.9371 1 53 GO:0016020

Map