F473758

General Info

Members Datasets Scaffolds Average Seq Length
666 320 511 199

Family's Representative Sequence

Representative Sequence 3300005272|Ga0065703_1018967|Ga0065703_10189672
Length 206
Sequence MTRISPRASAKKPPQAAAGQIRIIGGQWRGRKLPVPNSPGLRPTTDRVRETLFNWLAPVIQGARCLDCFAGSGALGLEALSRYAGSVTLLEFERPVAQQLEKNLALLQGKGHVVNTNALSWLANNAQPFDVVFLDPPFRKGLLAETVTLLEQQGWLADEAWIYVEAEAESAATDVPANWQLHREKVAGQVAYRLYIRSQEKTDNAD

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
4 2506520008 Serratia plymuthica AS12 Isolate Unclassified
5 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
6 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
7 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
8 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
9 2547132181 Kosakonia sacchari SP1 Isolate Stem
10 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
11 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
12 2561511199 Enterobacter sp. R4-368 Isolate Nodule
13 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
14 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
15 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
16 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
17 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
18 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
19 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
20 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
21 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
22 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
23 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
24 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
25 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
26 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
27 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
28 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
29 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
30 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
31 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
32 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
33 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
34 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
35 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
36 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
37 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
38 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
39 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
40 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
41 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
42 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
43 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
44 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
45 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
46 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
47 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
48 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
49 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
50 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
51 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
52 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
53 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
54 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
55 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
56 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
57 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
58 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
59 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
60 2636415599 Klebsiella variicola DX120E Isolate Unclassified
61 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
62 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
63 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
64 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
65 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
66 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
67 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
68 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
69 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
70 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
71 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
72 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
73 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
74 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
75 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
76 2751185917 Enterobacter sp. HK169 Isolate Unclassified
77 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
78 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
79 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
80 2775507074 Klebsiella sp. D5A Isolate Unclassified
81 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
82 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
83 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
84 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
85 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
86 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
87 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
88 2821118458 Enterobacter asburiae 609 Isolate Unclassified
89 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
90 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
91 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
92 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
93 2847085930 Erwinia persicina B64 Isolate Bulb
94 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
95 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
96 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
97 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
98 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
99 2865014394 Pantoea sp. R-71966 Isolate Unclassified
100 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
101 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
102 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
103 2876601092 Pantoea endophytica 596 Isolate Unclassified
104 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
105 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
106 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
107 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
108 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
109 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
110 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
111 2904504865 Serratia marcescens 1822 Isolate Unclassified
112 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
113 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
114 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
115 2919150387 Rahnella aceris 1817 Isolate Unclassified
116 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
117 2927143783 Rahnella sp. 2050 Isolate Unclassified
118 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
119 2932406140 Serratia sp. 2723 Isolate Rhizosphere
120 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
121 2937539931 Pantoea sp. LS15 Isolate Unclassified
122 2937967321 Serratia sp. YC16 Isolate Unclassified
123 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
124 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
125 2939577877 Serratia sp. 509 Isolate Rhizosphere
126 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
127 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
128 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
129 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
130 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
131 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
132 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
133 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
134 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
135 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
136 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
137 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
138 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
139 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
140 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
141 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
142 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
143 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
144 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
145 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
146 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
147 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
148 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
149 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
150 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
151 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
152 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
153 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
154 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
155 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
156 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
157 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
158 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
159 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
160 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
161 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
162 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
163 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
164 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
165 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
166 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
167 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
168 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
169 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
170 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
171 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
172 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
173 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
174 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
175 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
176 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
177 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
178 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
179 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
180 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
181 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
182 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
183 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
184 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
185 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
186 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
187 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
188 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
189 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
190 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
191 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
192 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
193 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
194 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
195 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
200 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
201 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
203 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
204 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
218 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
224 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
225 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
226 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
227 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
228 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
229 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
230 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
231 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
232 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
233 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
234 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
235 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
236 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
237 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
238 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
241 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
242 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
243 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
244 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
245 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
246 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
247 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
248 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
249 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
250 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
251 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
252 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
253 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
254 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
255 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
256 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
257 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
258 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
259 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
260 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
261 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
265 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
266 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
267 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
268 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
269 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
270 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
271 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
272 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
273 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
283 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
284 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
285 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
286 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
287 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
288 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
289 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
290 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
291 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
292 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
293 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
294 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
295 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
301 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
302 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
303 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
304 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
305 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
306 640753048 Serratia proteamaculans 568 Isolate Endosphere
307 8004592986 Serratia sp. S119 Isolate Unclassified
308 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
309 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
310 8018221730 Enterobacter sp. CM29 Isolate Unclassified
311 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
312 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
313 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
314 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
315 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
316 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
317 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
318 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
319 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
320 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.73
Metatranscriptomes 0
Isolates 23.27

Biome Distribution

Category Percentage (%)
Aerial Root 0.6
Bulb 0.15
Endosphere 5.41
Nodule 3.3
Rhizoplane 10.81
Rhizosphere 53.75
Stem 0.15
Stem Tuber 0.9
Unclassified 24.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_FSXC78089_g1 2010549000 Bacteria 828
2 SwRhRL2b_contig_3577562 2162886007 Bacteria 1068
3 SwRhRL2b_contig_416340 2162886007 Bacteria 2496
4 JGI25162J39368_1000116 3300002737 Bacteria 87942
5 JGI25162J39368_1002893 3300002737 Bacteria 5870
6 JGI25163J39215_1000099 3300002771 Bacteria 35819
7 JGI25164J39214_1000095 3300002772 Bacteria 87499
8 rootH1_10094035 3300003316 Bacteria 1251
9 rootH2_10016560 3300003320 Bacteria 3379
10 rootH2_10016561 3300003320 Bacteria 1998
11 rootL2_10039875 3300003322 Bacteria 2278
12 rootH1_10063555 3300003323 Bacteria 2522
13 rootH1_10209991 3300003323 Bacteria 1453
14 Ga0055538_1000077 3300003751 Bacteria 87507
15 Ga0055539_1000114 3300003752 Bacteria 89618
16 Ga0055533_1000122 3300003756 Bacteria 89163
17 Ga0055525_1000155 3300003759 Bacteria 91530
18 Ga0055541_1000078 3300003841 Bacteria 88505
19 Ga0058692_1000039 3300003856 Bacteria 133315
20 Ga0058692_1000177 3300003856 Bacteria 39148
21 Ga0058692_1001326 3300003856 Bacteria 9281
22 Ga0058692_1001347 3300003856 Bacteria 9161
23 Ga0058692_1005570 3300003856 Bacteria 3573
24 Ga0058692_1005679 3300003856 Bacteria 3529
25 Ga0058692_1012134 3300003856 Bacteria 2054
26 Ga0058692_1016115 3300003856 Bacteria 1669
27 Ga0058692_1029964 3300003856 Bacteria 1037
28 Ga0065703_1018967 3300005272 Bacteria 4687
29 Ga0065704_10001437 3300005289 Bacteria 28307
30 Ga0065704_10073012 3300005289 Bacteria 7686
31 Ga0065704_10079243 3300005289 Bacteria 4216
32 Ga0070668_100035599 3300005347 Bacteria 3797
33 Ga0070667_101078913 3300005367 Bacteria 750
34 Ga0070662_100001522 3300005457 Bacteria 14266
35 Ga0070665_100000117 3300005548 Bacteria 149831
36 Ga0070665_100046172 3300005548 Bacteria 4376
37 Ga0070665_100066359 3300005548 Bacteria 3620
38 Ga0068857_100919869 3300005577 Bacteria 839
39 Ga0068851_10002564 3300005834 Bacteria 7995
40 Ga0075364_10001376 3300006051 Bacteria 13116
41 Ga0075364_10002215 3300006051 Bacteria 10903
42 Ga0075364_10015691 3300006051 Bacteria 4702
43 Ga0075364_10048334 3300006051 Bacteria 2772
44 Ga0075364_10063771 3300006051 Bacteria 2419
45 Ga0079104_1000036 3300006946 Bacteria 194741
46 Ga0079104_1000078 3300006946 Bacteria 141909
47 Ga0079104_1000398 3300006946 Bacteria 50358
48 Ga0079104_1000564 3300006946 Bacteria 37815
49 Ga0079104_1001111 3300006946 Bacteria 19867
50 Ga0079104_1001247 3300006946 Bacteria 17757
51 Ga0079104_1002824 3300006946 Bacteria 8739
52 Ga0079104_1002858 3300006946 Bacteria 8652
53 Ga0079104_1003368 3300006946 Bacteria 7502
54 Ga0105251_10000386 3300009011 Bacteria 43038
55 Ga0105251_10000475 3300009011 Bacteria 38047
56 Ga0105251_10000791 3300009011 Bacteria 28655
57 Ga0105251_10001188 3300009011 Bacteria 22557
58 Ga0105251_10001812 3300009011 Bacteria 17696
59 Ga0105251_10002251 3300009011 Bacteria 15336
60 Ga0105251_10003272 3300009011 Bacteria 11879
61 Ga0105251_10013833 3300009011 Bacteria 4491
62 Ga0105251_10026162 3300009011 Bacteria 2974
63 Ga0105251_10026178 3300009011 Bacteria 2972
64 Ga0105251_10036897 3300009011 Bacteria 2402
65 Ga0105251_10076929 3300009011 Bacteria 1548
66 Ga0105251_10211345 3300009011 Bacteria 873
67 Ga0105244_10000017 3300009036 Bacteria 253386
68 Ga0105244_10000021 3300009036 Bacteria 238820
69 Ga0105244_10000119 3300009036 Bacteria 83366
70 Ga0105244_10000465 3300009036 Bacteria 37006
71 Ga0105244_10000588 3300009036 Bacteria 32617
72 Ga0105244_10001376 3300009036 Bacteria 19775
73 Ga0105244_10002123 3300009036 Bacteria 15231
74 Ga0105244_10003857 3300009036 Bacteria 10564
75 Ga0105244_10003991 3300009036 Bacteria 10327
76 Ga0105244_10004924 3300009036 Bacteria 9034
77 Ga0105244_10009693 3300009036 Bacteria 5893
78 Ga0105244_10022443 3300009036 Bacteria 3474
79 Ga0105244_10022455 3300009036 Bacteria 3473
80 Ga0105244_10043993 3300009036 Bacteria 2301
81 Ga0105244_10067018 3300009036 Bacteria 1796
82 Ga0105244_10072072 3300009036 Bacteria 1721
83 Ga0105244_10108828 3300009036 Bacteria 1350
84 Ga0105244_10125124 3300009036 Bacteria 1243
85 Ga0105244_10317309 3300009036 Bacteria 720
86 Ga0105244_10340568 3300009036 Bacteria 691
87 Ga0105250_10000012 3300009092 Bacteria 274899
88 Ga0105250_10000049 3300009092 Bacteria 121303
89 Ga0105250_10000783 3300009092 Bacteria 19147
90 Ga0105250_10001603 3300009092 Bacteria 12114
91 Ga0105250_10002575 3300009092 Bacteria 9040
92 Ga0105250_10002801 3300009092 Bacteria 8554
93 Ga0105250_10005633 3300009092 Bacteria 5594
94 Ga0105250_10024017 3300009092 Bacteria 2457
95 Ga0105250_10036495 3300009092 Bacteria 1973
96 Ga0105250_10037502 3300009092 Bacteria 1945
97 Ga0105250_10095346 3300009092 Bacteria 1213
98 Ga0105250_10239652 3300009092 Bacteria 773
99 Ga0105240_10102275 3300009093 Bacteria 3482
100 Ga0105247_10000171 3300009101 Bacteria 64198
101 Ga0105243_10000918 3300009148 Bacteria 27604
102 Ga0105241_10000010 3300009174 Bacteria 253836
103 Ga0105242_11598264 3300009176 Bacteria 685
104 Ga0105248_10045682 3300009177 Bacteria 4911
105 Ga0105237_10069974 3300009545 Bacteria 3504
106 Ga0105239_10455858 3300010375 Bacteria 1451
107 Ga0105239_10786294 3300010375 Bacteria 1090
108 Ga0105246_10054219 3300011119 Bacteria 2762
109 Ga0105246_10210460 3300011119 Bacteria 1517
110 Ga0105246_10215148 3300011119 Bacteria 1503
111 Ga0157373_10000369 3300013100 Bacteria 36006
112 Ga0157373_10057353 3300013100 Bacteria 2763
113 Ga0157373_10073718 3300013100 Bacteria 2408
114 Ga0157373_10153151 3300013100 Bacteria 1622
115 Ga0157373_10342556 3300013100 Bacteria 1065
116 Ga0157371_10000102 3300013102 Bacteria 129057
117 Ga0157371_10001010 3300013102 Bacteria 31017
118 Ga0157371_10001827 3300013102 Bacteria 21447
119 Ga0157371_10002090 3300013102 Bacteria 19507
120 Ga0157371_10272202 3300013102 Bacteria 1222
121 Ga0157371_10276407 3300013102 Bacteria 1213
122 Ga0157371_10737277 3300013102 Bacteria 739
123 Ga0157371_10751245 3300013102 Bacteria 732
124 Ga0157370_10000701 3300013104 Bacteria 41856
125 Ga0157370_10001324 3300013104 Bacteria 30819
126 Ga0157370_10133362 3300013104 Bacteria 2316
127 Ga0157370_10509118 3300013104 Bacteria 1105
128 Ga0157369_10002935 3300013105 Bacteria 20401
129 Ga0157369_11492055 3300013105 Bacteria 688
130 Ga0163162_10082996 3300013306 Bacteria 3277
131 Ga0163162_10203968 3300013306 Bacteria 2106
132 Ga0157372_10000177 3300013307 Bacteria 70496
133 Ga0157372_10003762 3300013307 Bacteria 16301
134 Ga0157372_10011267 3300013307 Bacteria 9511
135 Ga0157372_10561298 3300013307 Bacteria 1331
136 Ga0157372_11878461 3300013307 Bacteria 688
137 Ga0157372_11879566 3300013307 Bacteria 688
138 Ga0182008_10018478 3300014497 Bacteria 3609
139 Ga0182006_1000009 3300015261 Bacteria 438243
140 Ga0182006_1042373 3300015261 Bacteria 1784
141 Ga0182007_10002516 3300015262 Bacteria 9046
142 Ga0183366_1006 3300015679 Bacteria 136391
143 Ga0183370_1006 3300015680 Bacteria 136391
144 Ga0183365_10001 3300015684 Bacteria 2090444
145 Ga0183369_1017 3300015685 Bacteria 136391
146 Ga0183368_1010 3300015687 Bacteria 136391
147 Ga0183361_14716 3300016635 Bacteria 739
148 Ga0163161_10000006 3300017792 Bacteria 302708
149 Ga0163161_10004281 3300017792 Bacteria 9953
150 Ga0163161_10162531 3300017792 Bacteria 1703
151 Ga0213876_10000039 3300021384 Bacteria 173104
152 Ga0209760_100066 3300025207 Bacteria 88259
153 Ga0209760_101785 3300025207 Bacteria 2146
154 Ga0209784_100064 3300025224 Bacteria 158058
155 Ga0209566_100079 3300025225 Bacteria 158058
156 Ga0209674_100159 3300025226 Bacteria 88259
157 Ga0209563_100135 3300025230 Bacteria 88259
158 Ga0207427_100136 3300025231 Bacteria 88259
159 Ga0209437_100136 3300025233 Bacteria 176190
160 Ga0209437_100149 3300025233 Bacteria 158058
161 Ga0209677_100110 3300025253 Bacteria 88259
162 Ga0209129_1000021 3300025258 Bacteria 445018
163 Ga0209233_1006388 3300025261 Bacteria 3805
164 Ga0207656_10039749 3300025321 Bacteria 1991
165 Ga0207696_1000040 3300025711 Bacteria 318695
166 Ga0207696_1000046 3300025711 Bacteria 291327
167 Ga0207696_1000146 3300025711 Bacteria 121312
168 Ga0207696_1000332 3300025711 Bacteria 49596
169 Ga0207696_1000337 3300025711 Bacteria 48918
170 Ga0207696_1000421 3300025711 Bacteria 38950
171 Ga0207696_1000557 3300025711 Bacteria 29652
172 Ga0207696_1000558 3300025711 Bacteria 29569
173 Ga0207696_1001036 3300025711 Bacteria 16584
174 Ga0207696_1001099 3300025711 Bacteria 15853
175 Ga0207696_1002963 3300025711 Bacteria 7950
176 Ga0207696_1034830 3300025711 Bacteria 1502
177 Ga0207655_1000024 3300025728 Bacteria 459774
178 Ga0207655_1000043 3300025728 Bacteria 332919
179 Ga0207655_1000053 3300025728 Bacteria 284129
180 Ga0207655_1000082 3300025728 Bacteria 213760
181 Ga0207655_1000170 3300025728 Bacteria 119267
182 Ga0207655_1000208 3300025728 Bacteria 102775
183 Ga0207655_1000264 3300025728 Bacteria 82670
184 Ga0207655_1000284 3300025728 Bacteria 77444
185 Ga0207655_1001832 3300025728 Bacteria 18389
186 Ga0207655_1023169 3300025728 Bacteria 3088
187 Ga0207655_1034201 3300025728 Bacteria 2288
188 Ga0207655_1039852 3300025728 Bacteria 2035
189 Ga0207655_1046970 3300025728 Bacteria 1787
190 Ga0207655_1046973 3300025728 Bacteria 1786
191 Ga0207713_1000017 3300025735 Bacteria 394495
192 Ga0207713_1000043 3300025735 Bacteria 241808
193 Ga0207713_1000053 3300025735 Bacteria 222068
194 Ga0207713_1000056 3300025735 Bacteria 217615
195 Ga0207713_1000066 3300025735 Bacteria 195645
196 Ga0207713_1000075 3300025735 Bacteria 179242
197 Ga0207713_1000613 3300025735 Bacteria 35114
198 Ga0207713_1000780 3300025735 Bacteria 29431
199 Ga0207713_1005119 3300025735 Bacteria 8298
200 Ga0207713_1009635 3300025735 Bacteria 5420
201 Ga0207713_1014842 3300025735 Bacteria 4021
202 Ga0207713_1015490 3300025735 Bacteria 3910
203 Ga0207713_1065381 3300025735 Bacteria 1365
204 Ga0207710_10000024 3300025900 Bacteria 319633
205 Ga0207654_10000010 3300025911 Bacteria 304367
206 Ga0207695_10155439 3300025913 Bacteria 2222
207 Ga0207671_10102129 3300025914 Bacteria 2173
208 Ga0207690_10032868 3300025932 Bacteria 3332
209 Ga0207706_10021654 3300025933 Bacteria 5770
210 Ga0207709_10000505 3300025935 Bacteria 34640
211 Ga0207668_10076901 3300025972 Bacteria 2404
212 Ga0207674_10000179 3300026116 Bacteria 77729
213 Ga0209281_1000031 3300027111 Bacteria 422772
214 Ga0209281_1000065 3300027111 Bacteria 285579
215 Ga0209281_1000080 3300027111 Bacteria 261394
216 Ga0209281_1000112 3300027111 Bacteria 213847
217 Ga0209281_1000139 3300027111 Bacteria 179588
218 Ga0209281_1000162 3300027111 Bacteria 159535
219 Ga0209281_1000233 3300027111 Bacteria 117525
220 Ga0209281_1000316 3300027111 Bacteria 85644
221 Ga0209281_1001239 3300027111 Bacteria 16757
222 Ga0209281_1001932 3300027111 Bacteria 9743
223 Ga0209281_1002071 3300027111 Bacteria 9013
224 Ga0209281_1002441 3300027111 Bacteria 7463
225 Ga0209371_1000027 3300027312 Bacteria 448853
226 Ga0209371_1000029 3300027312 Bacteria 424797
227 Ga0209371_1000061 3300027312 Bacteria 223014
228 Ga0209371_1000082 3300027312 Bacteria 184560
229 Ga0209371_1000115 3300027312 Bacteria 137627
230 Ga0209371_1000119 3300027312 Bacteria 133367
231 Ga0209371_1000230 3300027312 Bacteria 71436
232 Ga0209371_1000478 3300027312 Bacteria 38966
233 Ga0209371_1000491 3300027312 Bacteria 38538
234 Ga0209371_1000733 3300027312 Bacteria 27592
235 Ga0209371_1000761 3300027312 Bacteria 26871
236 Ga0209371_1001831 3300027312 Bacteria 13167
237 Ga0209371_1002309 3300027312 Bacteria 10870
238 Ga0209371_1002918 3300027312 Bacteria 8925
239 Ga0209371_1004469 3300027312 Bacteria 6065
240 Ga0209371_1004503 3300027312 Bacteria 6014
241 Ga0209371_1006503 3300027312 Bacteria 4309
242 Ga0209371_1017778 3300027312 Bacteria 1830
243 Ga0268266_10000079 3300028379 Bacteria 213545
244 Ga0268266_10009123 3300028379 Bacteria 8751
245 Ga0268256_1000032 3300030500 Bacteria 424603
246 Ga0268256_1000045 3300030500 Bacteria 330053
247 Ga0268256_1000059 3300030500 Bacteria 223875
248 Ga0268256_1000072 3300030500 Bacteria 184436
249 Ga0268256_1000096 3300030500 Bacteria 139457
250 Ga0268256_1000097 3300030500 Bacteria 137685
251 Ga0268256_1000223 3300030500 Bacteria 62142
252 Ga0268256_1000406 3300030500 Bacteria 39238
253 Ga0268256_1000415 3300030500 Bacteria 38538
254 Ga0268256_1000901 3300030500 Bacteria 20478
255 Ga0268256_1001531 3300030500 Bacteria 13649
256 Ga0268256_1002052 3300030500 Bacteria 10870
257 Ga0268256_1002213 3300030500 Bacteria 10234
258 Ga0268256_1006548 3300030500 Bacteria 4309
259 Ga0268256_1012164 3300030500 Bacteria 2677
260 Ga0268256_1013282 3300030500 Bacteria 2504
261 Ga0268256_1014182 3300030500 Bacteria 2378
262 Ga0395905_0000593 3300037471 Bacteria 48559
263 Ga0395905_0306852 3300037471 Bacteria 1475
264 Ga0436365_0171687 3300039437 Bacteria 172237
265 Ga0439438_000049 3300041405 Bacteria 57788
266 Ga0439438_000191 3300041405 Bacteria 27664
267 Ga0439438_000899 3300041405 Bacteria 13222
268 Ga0439438_005930 3300041405 Bacteria 4409
269 Ga0439438_026577 3300041405 Bacteria 1568
270 Ga0439438_060036 3300041405 Bacteria 953
271 Ga0439447_000586 3300041407 Bacteria 13595
272 Ga0439447_001340 3300041407 Bacteria 8963
273 Ga0439447_004003 3300041407 Bacteria 5156
274 Ga0439466_0000011 3300041411 Bacteria 221134
275 Ga0451853_2847756 3300041512 Bacteria 2777
276 Ga0439432_000551 3300042006 Bacteria 13999
277 Ga0439432_001750 3300042006 Bacteria 8133
278 Ga0439432_072314 3300042006 Bacteria 1050
279 Ga0439452_000010 3300042010 Bacteria 459139
280 Ga0439452_000012 3300042010 Bacteria 412478
281 Ga0439452_000026 3300042010 Bacteria 223971
282 Ga0439452_000039 3300042010 Bacteria 145243
283 Ga0439452_000212 3300042010 Bacteria 41258
284 Ga0439452_000227 3300042010 Bacteria 39915
285 Ga0439463_045202 3300042016 Bacteria 1121
286 Ga0450900_004694 3300042136 Bacteria 1582
287 Ga0450902_015574 3300042137 Bacteria 1234
288 Ga0450902_045876 3300042137 Bacteria 747
289 Ga0450907_000007 3300042146 Bacteria 111445
290 Ga0439464_0000487 3300042439 Bacteria 8024
291 Ga0439464_0009301 3300042439 Bacteria 2585
292 Ga0439464_0037514 3300042439 Bacteria 1374
293 Ga0450893_0001177 3300042532 Bacteria 3942
294 Ga0466969_0002265 3300044656 Bacteria 10277
295 Ga0466981_0000025 3300044669 Bacteria 75290
296 Ga0466966_0053710 3300044684 Bacteria 2555
297 Ga0466961_0000182 3300044693 Bacteria 42657
298 Ga0466961_0341858 3300044693 Bacteria 911
299 Ga0466963_0077950 3300044694 Bacteria 2240
300 Ga0466971_0000562 3300044719 Bacteria 14692
301 Ga0466970_0217214 3300044765 Bacteria 1066
302 Ga0466957_0021225 3300044842 Bacteria 3825
303 Ga0466959_0000028 3300045049 Bacteria 114144
304 Ga0466959_0458006 3300045049 Bacteria 864
305 Ga0451576_0303955 3300045051 Unclassified 1669
306 Ga0466958_0000162 3300045836 Bacteria 23703
307 Ga0495617_059412 3300046452 Bacteria 1266
308 Ga0495627_000200 3300046453 Bacteria 65358
309 Ga0495627_028763 3300046453 Bacteria 1773
310 Ga0495591_000010 3300046458 Bacteria 327794
311 Ga0495591_000029 3300046458 Bacteria 179657
312 Ga0495591_003864 3300046458 Bacteria 7567
313 Ga0495591_006489 3300046458 Bacteria 5167
314 Ga0495638_0006407 3300046460 Bacteria 8566
315 Ga0495650_0000034 3300046471 Bacteria 410132
316 Ga0495650_0000103 3300046471 Bacteria 210023
317 Ga0495650_0000199 3300046471 Bacteria 130411
318 Ga0495650_0007866 3300046471 Bacteria 6331
319 Ga0495585_0009410 3300046492 Bacteria 5862
320 Ga0495596_0002829 3300046500 Bacteria 9066
321 Ga0495607_0031577 3300046501 Bacteria 3241
322 Ga0495606_0000511 3300046507 Bacteria 63022
323 Ga0495616_0070905 3300046513 Bacteria 1686
324 Ga0495620_0003527 3300046515 Bacteria 8946
325 Ga0495643_0041106 3300046522 Bacteria 2522
326 Ga0495643_0082366 3300046522 Bacteria 1672
327 Ga0495644_0004874 3300046523 Bacteria 5269
328 Ga0495648_0002804 3300046524 Bacteria 15687
329 Ga0495648_0005670 3300046524 Bacteria 10330
330 Ga0495654_0000151 3300046530 Bacteria 71530
331 Ga0495654_0000598 3300046530 Bacteria 28818
332 Ga0495654_0000823 3300046530 Bacteria 23556
333 Ga0495654_0007997 3300046530 Bacteria 5871
334 Ga0495654_0017719 3300046530 Bacteria 3738
335 Ga0495654_0112312 3300046530 Bacteria 1242
336 Ga0495597_0000546 3300046542 Bacteria 31193
337 Ga0495668_0022890 3300046616 Bacteria 3568
338 Ga0495625_0013106 3300046660 Bacteria 6680
339 Ga0495671_0007051 3300046692 Bacteria 6439
340 Ga0495649_0004891 3300046694 Bacteria 8647
341 Ga0495649_0052832 3300046694 Bacteria 2201
342 Ga0495589_0000121 3300046794 Bacteria 73070
343 Ga0495589_0016884 3300046794 Bacteria 3748
344 Ga0495660_0000020 3300046810 Bacteria 304768
345 Ga0495660_0000045 3300046810 Bacteria 150303
346 Ga0495660_0026735 3300046810 Bacteria 3268
347 Ga0495672_0000011 3300047320 Bacteria 535362
348 Ga0495672_0000039 3300047320 Bacteria 272506
349 Ga0495672_0000040 3300047320 Bacteria 268573
350 Ga0495676_0085062 3300047321 Bacteria 2384
351 Ga0495683_0110235 3300047323 Bacteria 1314
352 Ga0495679_000016 3300047446 Bacteria 282024
353 Ga0495679_001180 3300047446 Bacteria 15517
354 Ga0495679_001466 3300047446 Bacteria 13378
355 Ga0495673_0000020 3300047469 Bacteria 548327
356 Ga0495673_0000079 3300047469 Bacteria 202569
357 Ga0495681_0051696 3300047470 Bacteria 1931
358 Ga0496100_0004088 3300048903 Bacteria 7694
359 Ga0496100_0031847 3300048903 Bacteria 3282
360 Ga0496101_0000053 3300048904 Bacteria 139859
361 Ga0496101_0041825 3300048904 Bacteria 3270
362 Ga0496102_0011675 3300048905 Bacteria 7583
363 Ga0496103_0168669 3300048906 Bacteria 1405
364 Ga0496104_0000113 3300048907 Bacteria 76556
365 Ga0496104_0008831 3300048907 Bacteria 8958
366 Ga0496104_0093443 3300048907 Bacteria 2877
367 Ga0496104_0298376 3300048907 Bacteria 1523
368 Ga0496105_0001883 3300048908 Bacteria 15056
369 Ga0496105_0029223 3300048908 Bacteria 4511
370 Ga0496105_0049648 3300048908 Bacteria 3465
371 Ga0496105_0556510 3300048908 Bacteria 894
372 Ga0496110_0375081 3300048913 Bacteria 1296
373 Ga0496113_0326300 3300048916 Bacteria 1231
374 Ga0496113_0497204 3300048916 Bacteria 979
375 Ga0496116_0000058 3300048919 Bacteria 279767
376 Ga0496116_0000129 3300048919 Bacteria 158284
377 Ga0496116_0000278 3300048919 Bacteria 88946
378 Ga0496116_0000623 3300048919 Bacteria 46579
379 Ga0496116_0000734 3300048919 Bacteria 41881
380 Ga0496116_0001110 3300048919 Bacteria 32241
381 Ga0496116_0029668 3300048919 Bacteria 3938
382 Ga0496116_0048405 3300048919 Bacteria 2853
383 Ga0496116_0093029 3300048919 Bacteria 1826
384 Ga0496116_0094215 3300048919 Bacteria 1811
385 Ga0496116_0332719 3300048919 Bacteria 704
386 Ga0496117_0000092 3300048920 Bacteria 202608
387 Ga0496117_0000224 3300048920 Bacteria 106727
388 Ga0496117_0000400 3300048920 Bacteria 73656
389 Ga0496117_0000450 3300048920 Bacteria 68428
390 Ga0496117_0001370 3300048920 Bacteria 35509
391 Ga0496117_0005148 3300048920 Bacteria 13951
392 Ga0496117_0005212 3300048920 Bacteria 13823
393 Ga0496117_0037326 3300048920 Bacteria 3621
394 Ga0496117_0055270 3300048920 Bacteria 2775
395 Ga0496117_0059726 3300048920 Bacteria 2631
396 Ga0496117_0061587 3300048920 Bacteria 2578
397 Ga0496117_0075129 3300048920 Bacteria 2246
398 Ga0496117_0136605 3300048920 Bacteria 1476
399 Ga0496117_0137176 3300048920 Bacteria 1471
400 Ga0496118_0000053 3300048921 Bacteria 235810
401 Ga0496118_0000540 3300048921 Bacteria 62183
402 Ga0496118_0001319 3300048921 Bacteria 37658
403 Ga0496118_0002440 3300048921 Bacteria 25026
404 Ga0496118_0004790 3300048921 Bacteria 15801
405 Ga0496118_0007029 3300048921 Bacteria 12115
406 Ga0496118_0039447 3300048921 Bacteria 3767
407 Ga0496118_0052115 3300048921 Bacteria 3124
408 Ga0496118_0055398 3300048921 Bacteria 2993
409 Ga0496118_0292151 3300048921 Bacteria 900
410 Ga0496119_0000023 3300048922 Bacteria 259882
411 Ga0496119_0000075 3300048922 Bacteria 146247
412 Ga0496119_0000581 3300048922 Bacteria 49342
413 Ga0496119_0001629 3300048922 Bacteria 26500
414 Ga0496119_0003974 3300048922 Bacteria 14962
415 Ga0496119_0004011 3300048922 Bacteria 14887
416 Ga0496119_0004743 3300048922 Bacteria 13359
417 Ga0496119_0008528 3300048922 Bacteria 8987
418 Ga0496119_0009118 3300048922 Bacteria 8589
419 Ga0496119_0013032 3300048922 Bacteria 6673
420 Ga0496119_0013721 3300048922 Bacteria 6421
421 Ga0496119_0189325 3300048922 Bacteria 1073
422 Ga0496119_0409731 3300048922 Bacteria 645
423 Ga0496120_0000008 3300048923 Bacteria 404544
424 Ga0496120_0000024 3300048923 Bacteria 236853
425 Ga0496120_0000178 3300048923 Bacteria 107847
426 Ga0496120_0000548 3300048923 Bacteria 57387
427 Ga0496120_0001708 3300048923 Bacteria 25110
428 Ga0496120_0003004 3300048923 Bacteria 15994
429 Ga0496120_0007549 3300048923 Bacteria 8073
430 Ga0496120_0010426 3300048923 Bacteria 6487
431 Ga0496120_0020062 3300048923 Bacteria 4259
432 Ga0496120_0020509 3300048923 Bacteria 4198
433 Ga0496120_0036756 3300048923 Bacteria 2911
434 Ga0496120_0093171 3300048923 Bacteria 1605
435 Ga0496121_0000304 3300048924 Bacteria 102259
436 Ga0496121_0001155 3300048924 Bacteria 46296
437 Ga0496121_0002320 3300048924 Bacteria 29478
438 Ga0496121_0011905 3300048924 Bacteria 9575
439 Ga0496121_0024123 3300048924 Bacteria 5827
440 Ga0496121_0178632 3300048924 Bacteria 1534
441 Ga0496122_0000108 3300048925 Bacteria 191029
442 Ga0496122_0000607 3300048925 Bacteria 73586
443 Ga0496122_0001295 3300048925 Bacteria 41340
444 Ga0496122_0001307 3300048925 Bacteria 40980
445 Ga0496122_0011177 3300048925 Bacteria 9143
446 Ga0496122_0014457 3300048925 Bacteria 7629
447 Ga0496122_0023020 3300048925 Bacteria 5512
448 Ga0496122_0032665 3300048925 Bacteria 4298
449 Ga0496122_0037931 3300048925 Bacteria 3869
450 Ga0496122_0044010 3300048925 Bacteria 3490
451 Ga0496122_0060955 3300048925 Bacteria 2773
452 Ga0496122_0157695 3300048925 Bacteria 1389
453 Ga0496122_0209010 3300048925 Bacteria 1132
454 Ga0496122_0400765 3300048925 Bacteria 696
455 Ga0496123_0000065 3300048926 Bacteria 211758
456 Ga0496123_0000451 3300048926 Bacteria 73603
457 Ga0496123_0000504 3300048926 Bacteria 67871
458 Ga0496123_0001876 3300048926 Bacteria 27523
459 Ga0496123_0003659 3300048926 Bacteria 16976
460 Ga0496123_0011179 3300048926 Bacteria 7814
461 Ga0496123_0054694 3300048926 Bacteria 2625
462 Ga0496123_0127199 3300048926 Bacteria 1419
463 Ga0496123_0139087 3300048926 Bacteria 1330
464 Ga0496123_0248324 3300048926 Bacteria 879
465 Ga0496124_0000109 3300048927 Bacteria 166429
466 Ga0496124_0000147 3300048927 Bacteria 145724
467 Ga0496124_0000251 3300048927 Bacteria 103690
468 Ga0496124_0000304 3300048927 Bacteria 90806
469 Ga0496124_0000379 3300048927 Bacteria 81086
470 Ga0496124_0001035 3300048927 Bacteria 43988
471 Ga0496124_0010494 3300048927 Bacteria 9373
472 Ga0496124_0011533 3300048927 Bacteria 8820
473 Ga0496124_0012505 3300048927 Bacteria 8371
474 Ga0496124_0034687 3300048927 Bacteria 4423
475 Ga0496124_0066156 3300048927 Bacteria 3011
476 Ga0496124_0094861 3300048927 Bacteria 2426
477 Ga0496124_0097037 3300048927 Bacteria 2393
478 Ga0496124_0115797 3300048927 Bacteria 2150
479 Ga0496125_0000104 3300048928 Bacteria 201270
480 Ga0496125_0001589 3300048928 Bacteria 32202
481 Ga0496125_0002821 3300048928 Bacteria 21931
482 Ga0496125_0024227 3300048928 Bacteria 5584
483 Ga0496125_0032706 3300048928 Bacteria 4616
484 Ga0496125_0046034 3300048928 Bacteria 3664
485 Ga0496125_0087762 3300048928 Bacteria 2347
486 Ga0496125_0103659 3300048928 Bacteria 2086
487 Ga0496125_0202934 3300048928 Bacteria 1296
488 Ga0496125_0210858 3300048928 Bacteria 1262
489 Ga0496126_0006490 3300048929 Bacteria 13019
490 Ga0496126_0009007 3300048929 Bacteria 10675
491 Ga0496126_0019933 3300048929 Bacteria 6590
492 Ga0496126_0164566 3300048929 Bacteria 1893
493 Ga0496126_0191752 3300048929 Bacteria 1730
494 Ga0496126_0213140 3300048929 Bacteria 1625
495 Ga0495678_000269 3300049459 Bacteria 57582
496 Ga0495682_0000022 3300049460 Bacteria 183265
497 Ga0501033_0014186 3300049570 Bacteria 6057
498 Ga0501034_0016753 3300049571 Bacteria 7515
499 Ga0501037_0015663 3300049573 Bacteria 5581
500 Ga0501043_0291810 3300049579 Bacteria 1248
501 Ga0501035_0786424 3300049822 Bacteria 761
502 Ga0501044_0005064 3300049823 Bacteria 14707
503 nmdc:mga00v17_33011_c1 3300050491 Bacteria 3064
504 nmdc:mga00v17_391214_c1 3300050491 Bacteria 904
505 nmdc:mga00v17_398245_c1 3300050491 Bacteria 895
506 nmdc:mga00v17_40698_c1 3300050491 Bacteria 2788
507 nmdc:mga00v17_7298_c1 3300050491 Bacteria 5890
508 Ga0500635_0000416 3300053080 Bacteria 12620
509 Ga0500608_000486 3300053122 Bacteria 14881
510 Ga0500621_000009 3300053126 Bacteria 173209
511 Ga0466962_0000951 3300061719 Bacteria 13138

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0093443 Ga0496104_0093443_12_533 170
2 3300050491 nmdc:mga00v17_398245_c1 nmdc:mga00v17_398245_c1_362_880 172
3 iso_pu_bacteria 2739367756 2739792311 176
4 3300005577 Ga0068857_100919869 Ga0068857_1009198692 178
5 3300049570 Ga0501033_0014186 Ga0501033_0014186_157_726 178
6 3300049573 Ga0501037_0015663 Ga0501037_0015663_3621_4190 178
7 3300049579 Ga0501043_0291810 Ga0501043_0291810_519_1088 178
8 3300049823 Ga0501044_0005064 Ga0501044_0005064_1812_2381 178
9 3300003316 rootH1_10094035 rootH1_100940352 179
10 3300003320 rootH2_10016560 rootH2_100165603 179
11 3300003320 rootH2_10016561 rootH2_100165612 179
12 3300003322 rootL2_10039875 rootL2_100398752 179
13 3300003323 rootH1_10063555 rootH1_100635552 179
14 3300003323 rootH1_10209991 rootH1_102099912 179
15 3300013102 Ga0157371_10276407 Ga0157371_102764072 179
16 3300015684 Ga0183365_10001 Ga0183365_100011742 179
17 3300037471 Ga0395905_0000593 Ga0395905_0000593_28324_28899 179
18 3300037471 Ga0395905_0306852 Ga0395905_0306852_624_1199 179
19 3300044656 Ga0466969_0002265 Ga0466969_0002265_7307_7882 179
20 3300044684 Ga0466966_0053710 Ga0466966_0053710_405_980 179
21 3300044693 Ga0466961_0000182 Ga0466961_0000182_40261_40836 179
22 3300044693 Ga0466961_0341858 Ga0466961_0341858_254_829 179
23 3300044694 Ga0466963_0077950 Ga0466963_0077950_907_1482 179
24 3300044719 Ga0466971_0000562 Ga0466971_0000562_10478_11053 179
25 3300044765 Ga0466970_0217214 Ga0466970_0217214_408_983 179
26 3300044842 Ga0466957_0021225 Ga0466957_0021225_2982_3557 179
27 3300045049 Ga0466959_0000028 Ga0466959_0000028_12064_12639 179
28 3300045049 Ga0466959_0458006 Ga0466959_0458006_182_757 179
29 3300045051 Ga0451576_0303955 Ga0451576_0303955_942_1517 179
30 3300045836 Ga0466958_0000162 Ga0466958_0000162_6771_7346 179
31 3300049571 Ga0501034_0016753 Ga0501034_0016753_2920_3495 179
32 3300049822 Ga0501035_0786424 Ga0501035_0786424_64_639 179
33 3300053080 Ga0500635_0000416 Ga0500635_0000416_2284_2859 179
34 3300053122 Ga0500608_000486 Ga0500608_000486_3205_3780 179
35 3300061719 Ga0466962_0000951 Ga0466962_0000951_421_996 179
36 iso_pu_bacteria 2537561728 2538428479 187
37 iso_pu_bacteria 2537561728 2538428693 187
38 iso_pu_bacteria 2855195626 2855197756 187
39 iso_pu_bacteria 2858466076 2858470502 187
40 iso_pu_bacteria 2871272651 2871274095 187
41 iso_pu_bacteria 2871282230 2871283479 187
42 iso_pu_bacteria 2900051742 2900055009 187
43 iso_pu_bacteria 8054844752 8054847559 187
44 iso_pu_bacteria 8054849141 8054852795 187
45 iso_pu_bacteria 2846540461 2846544040 188
46 iso_pu_bacteria 2648501241 2649123033 190
47 iso_pu_bacteria 2651869818 2652976355 190
48 iso_pu_bacteria 2939568625 2939572183 190
49 iso_pu_bacteria 2939642701 2939646495 190
50 3300006051 Ga0075364_10048334 Ga0075364_100483342 191
51 3300009036 Ga0105244_10002123 Ga0105244_1000212315 191
52 3300009036 Ga0105244_10022455 Ga0105244_100224555 191
53 3300009036 Ga0105244_10067018 Ga0105244_100670181 191
54 3300009092 Ga0105250_10024017 Ga0105250_100240174 191
55 3300025711 Ga0207696_1000332 Ga0207696_100033216 191
56 3300025711 Ga0207696_1000337 Ga0207696_100033729 191
57 3300025728 Ga0207655_1034201 Ga0207655_10342014 191
58 3300046542 Ga0495597_0000546 Ga0495597_0000546_7366_7941 191
59 3300047320 Ga0495672_0000039 Ga0495672_0000039_60107_60682 191
60 3300047470 Ga0495681_0051696 Ga0495681_0051696_1145_1720 191
61 3300050491 nmdc:mga00v17_40698_c1 nmdc:mga00v17_40698_c1_361_936 191
62 iso_pu_bacteria 2547132416 2548650214 191
63 iso_pu_bacteria 2554235234 2555260878 191
64 iso_pu_bacteria 2599185169 2599411782 191
65 iso_pu_bacteria 2600255254 2601524545 191
66 iso_pu_bacteria 2600255255 2601529699 191
67 iso_pu_bacteria 2600255280 2601616533 191
68 iso_pu_bacteria 2600255281 2601621255 191
69 iso_pu_bacteria 2600255287 2601645108 191
70 iso_pu_bacteria 2600255288 2601649652 191
71 iso_pu_bacteria 2600255289 2601654579 191
72 iso_pu_bacteria 2600255290 2601660147 191
73 iso_pu_bacteria 2600255291 2601664348 191
74 iso_pu_bacteria 2600255298 2601698119 191
75 iso_pu_bacteria 2600255299 2601702487 191
76 iso_pu_bacteria 2600255300 2601707323 191
77 iso_pu_bacteria 2600255301 2601712344 191
78 iso_pu_bacteria 2600255302 2601717840 191
79 iso_pu_bacteria 2600255303 2601722990 191
80 iso_pu_bacteria 2600255304 2601727768 191
81 iso_pu_bacteria 2600255305 2601732785 191
82 iso_pu_bacteria 2600255306 2601737446 191
83 iso_pu_bacteria 2600255307 2601741865 191
84 iso_pu_bacteria 2600255309 2601752763 191
85 iso_pu_bacteria 2600255392 2602019665 191
86 iso_pu_bacteria 2602042052 2603662512 191
87 iso_pu_bacteria 2602042053 2603667408 191
88 iso_pu_bacteria 2602042066 2603701806 191
89 iso_pu_bacteria 2602042067 2603706551 191
90 iso_pu_bacteria 2602042103 2603840194 191
91 iso_pu_bacteria 2602042104 2603845271 191
92 iso_pu_bacteria 2602042105 2603850344 191
93 iso_pu_bacteria 2602042106 2603855412 191
94 iso_pu_bacteria 2602042109 2603868323 191
95 iso_pu_bacteria 2602042110 2603873140 191
96 iso_pu_bacteria 2602042111 2603878219 191
97 iso_pu_bacteria 2603880178 2606050173 191
98 iso_pu_bacteria 2603880184 2606071837 191
99 iso_pu_bacteria 2603880202 2606147856 191
100 iso_pu_bacteria 2603880211 2606178209 191
101 iso_pu_bacteria 2636415599 2637222907 191
102 iso_pu_bacteria 2667528172 2671105309 191
103 iso_pu_bacteria 2671180115 2671585036 191
104 iso_pu_bacteria 2675903046 2676408810 191
105 iso_pu_bacteria 2681812866 2681994736 191
106 iso_pu_bacteria 2681812869 2682009686 191
107 iso_pu_bacteria 2711768156 2712472110 191
108 iso_pu_bacteria 2751185917 2753854164 191
109 iso_pu_bacteria 2765235842 2765591099 191
110 iso_pu_bacteria 2775506706 2775542905 191
111 iso_pu_bacteria 2775507074 2777021245 191
112 iso_pu_bacteria 2791354903 2791923754 191
113 iso_pu_bacteria 2791355275 2793403608 191
114 iso_pu_bacteria 2821118458 2821122833 191
115 iso_pu_bacteria 2823373977 2823378137 191
116 iso_pu_bacteria 2844425489 2844429474 191
117 iso_pu_bacteria 2884086401 2884086779 191
118 iso_pu_bacteria 2891670763 2891675194 191
119 iso_pu_bacteria 2904513164 2904518501 191
120 iso_pu_bacteria 2919108558 2919112222 191
121 iso_pu_bacteria 2923634449 2923637547 191
122 iso_pu_bacteria 2927833300 2927835999 191
123 iso_pu_bacteria 2937539931 2937540482 191
124 iso_pu_bacteria 2939573065 2939576791 191
125 iso_pu_bacteria 2939607340 2939611519 191
126 iso_pu_bacteria 2969079654 2969079931 191
127 iso_pu_bacteria 2971820967 2971821290 191
128 iso_pu_bacteria 2974310843 2974314668 191
129 iso_pu_bacteria 2984559226 2984562385 191
130 iso_pu_bacteria 2984595703 2984600443 191
131 iso_pu_bacteria 3000376612 3000377199 191
132 iso_pu_bacteria 8018221730 8018223239 191
133 iso_pu_bacteria 8018405270 8018408885 191
134 iso_pu_bacteria 8055087960 8055092369 191
135 iso_pu_bacteria 8055092621 8055093567 191
136 iso_pu_bacteria 8055097453 8055097704 191
137 iso_pu_bacteria 8057304971 8057307997 191
138 iso_pu_bacteria 8055693939 8055698100 192
139 iso_pu_bacteria 2609459761 2609911203 193
140 iso_pu_bacteria 2908669403 2908674763 193
141 iso_pu_bacteria 2945874760 2945875579 193
142 2162886007 SwRhRL2b_contig_416340 SwRhRL2b_0668.00006910 194
143 3300005289 Ga0065704_10073012 Ga0065704_100730124 194
144 3300005548 Ga0070665_100066359 Ga0070665_1000663594 194
145 3300006051 Ga0075364_10001376 Ga0075364_100013769 194
146 3300006946 Ga0079104_1002824 Ga0079104_10028246 194
147 3300009092 Ga0105250_10001603 Ga0105250_100016037 194
148 3300025711 Ga0207696_1000558 Ga0207696_10005586 194
149 3300025711 Ga0207696_1002963 Ga0207696_10029633 194
150 3300025728 Ga0207655_1000082 Ga0207655_1000082113 194
151 3300025735 Ga0207713_1005119 Ga0207713_10051195 194
152 3300027111 Ga0209281_1000112 Ga0209281_100011281 194
153 3300027111 Ga0209281_1002441 Ga0209281_10024418 194
154 3300028379 Ga0268266_10009123 Ga0268266_100091235 194
155 3300042137 Ga0450902_045876 Ga0450902_045876_148_732 194
156 3300046458 Ga0495591_000029 Ga0495591_000029_93655_94254 194
157 3300046522 Ga0495643_0082366 Ga0495643_0082366_616_1215 194
158 3300046530 Ga0495654_0007997 Ga0495654_0007997_4228_4827 194
159 3300047469 Ga0495673_0000079 Ga0495673_0000079_80213_80812 194
160 3300048919 Ga0496116_0029668 Ga0496116_0029668_3198_3797 194
161 3300048920 Ga0496117_0005148 Ga0496117_0005148_9062_9661 194
162 3300048920 Ga0496117_0075129 Ga0496117_0075129_1555_2154 194
163 3300048921 Ga0496118_0052115 Ga0496118_0052115_178_777 194
164 3300048923 Ga0496120_0020062 Ga0496120_0020062_2914_3513 194
165 3300048924 Ga0496121_0011905 Ga0496121_0011905_2717_3316 194
166 3300048924 Ga0496121_0024123 Ga0496121_0024123_3886_4485 194
167 3300048925 Ga0496122_0000108 Ga0496122_0000108_95831_96430 194
168 3300048926 Ga0496123_0000065 Ga0496123_0000065_94600_95199 194
169 3300048928 Ga0496125_0032706 Ga0496125_0032706_1342_1941 194
170 iso_pu_bacteria 2511231025 2511382587 194
171 iso_pu_bacteria 2585427591 2585829042 194
172 iso_pu_bacteria 2585427592 2585833814 194
173 iso_pu_bacteria 2667528173 2671110320 194
174 iso_pu_bacteria 2706794495 2707100777 194
175 iso_pu_bacteria 2847085930 2847090088 194
176 iso_pu_bacteria 2852103415 2852104294 194
177 iso_pu_bacteria 2854601825 2854604182 194
178 iso_pu_bacteria 2876601092 2876602572 194
179 iso_pu_bacteria 2904474040 2904478737 194
180 iso_pu_bacteria 2904504865 2904509497 194
181 iso_pu_bacteria 2919150387 2919154845 194
182 iso_pu_bacteria 2927143783 2927148429 194
183 iso_pu_bacteria 8016733728 8016737628 194
184 iso_pu_bacteria 8019499862 8019504208 194
185 2162886007 SwRhRL2b_contig_3577562 SwRhRL2b_0846.00008000 195
186 3300003856 Ga0058692_1012134 Ga0058692_10121344 195
187 3300005289 Ga0065704_10079243 Ga0065704_100792433 195
188 3300005548 Ga0070665_100000117 Ga0070665_10000011787 195
189 3300005834 Ga0068851_10002564 Ga0068851_100025647 195
190 3300006051 Ga0075364_10002215 Ga0075364_100022157 195
191 3300006946 Ga0079104_1000036 Ga0079104_1000036170 195
192 3300006946 Ga0079104_1000078 Ga0079104_100007852 195
193 3300006946 Ga0079104_1000398 Ga0079104_100039841 195
194 3300006946 Ga0079104_1000564 Ga0079104_10005642 195
195 3300006946 Ga0079104_1001111 Ga0079104_10011113 195
196 3300006946 Ga0079104_1001247 Ga0079104_10012471 195
197 3300009011 Ga0105251_10000791 Ga0105251_1000079125 195
198 3300009011 Ga0105251_10001188 Ga0105251_100011881 195
199 3300009011 Ga0105251_10003272 Ga0105251_100032725 195
200 3300009011 Ga0105251_10013833 Ga0105251_100138332 195
201 3300009011 Ga0105251_10026162 Ga0105251_100261622 195
202 3300009011 Ga0105251_10026178 Ga0105251_100261785 195
203 3300009011 Ga0105251_10036897 Ga0105251_100368972 195
204 3300009011 Ga0105251_10211345 Ga0105251_102113451 195
205 3300009036 Ga0105244_10000017 Ga0105244_10000017141 195
206 3300009036 Ga0105244_10000021 Ga0105244_10000021174 195
207 3300009036 Ga0105244_10001376 Ga0105244_1000137612 195
208 3300009036 Ga0105244_10009693 Ga0105244_100096937 195
209 3300009036 Ga0105244_10043993 Ga0105244_100439935 195
210 3300009036 Ga0105244_10072072 Ga0105244_100720723 195
211 3300009036 Ga0105244_10317309 Ga0105244_103173092 195
212 3300009092 Ga0105250_10000012 Ga0105250_1000001260 195
213 3300009092 Ga0105250_10000783 Ga0105250_1000078310 195
214 3300009092 Ga0105250_10036495 Ga0105250_100364951 195
215 3300009092 Ga0105250_10037502 Ga0105250_100375024 195
216 3300009092 Ga0105250_10239652 Ga0105250_102396521 195
217 3300009093 Ga0105240_10102275 Ga0105240_101022754 195
218 3300009148 Ga0105243_10000918 Ga0105243_100009182 195
219 3300010375 Ga0105239_10786294 Ga0105239_107862941 195
220 3300013100 Ga0157373_10073718 Ga0157373_100737184 195
221 3300013102 Ga0157371_10737277 Ga0157371_107372771 195
222 3300013102 Ga0157371_10751245 Ga0157371_107512451 195
223 3300013104 Ga0157370_10133362 Ga0157370_101333624 195
224 3300015261 Ga0182006_1000009 Ga0182006_1000009125 195
225 3300015679 Ga0183366_1006 Ga0183366_100634 195
226 3300015680 Ga0183370_1006 Ga0183370_100634 195
227 3300015685 Ga0183369_1017 Ga0183369_101734 195
228 3300015687 Ga0183368_1010 Ga0183368_101034 195
229 3300017792 Ga0163161_10162531 Ga0163161_101625313 195
230 3300025321 Ga0207656_10039749 Ga0207656_100397492 195
231 3300025711 Ga0207696_1000040 Ga0207696_1000040106 195
232 3300025711 Ga0207696_1000421 Ga0207696_100042142 195
233 3300025711 Ga0207696_1034830 Ga0207696_10348303 195
234 3300025728 Ga0207655_1000043 Ga0207655_1000043249 195
235 3300025728 Ga0207655_1000053 Ga0207655_1000053113 195
236 3300025728 Ga0207655_1000264 Ga0207655_100026444 195
237 3300025728 Ga0207655_1001832 Ga0207655_100183213 195
238 3300025728 Ga0207655_1046970 Ga0207655_10469704 195
239 3300025728 Ga0207655_1046973 Ga0207655_10469732 195
240 3300025735 Ga0207713_1000017 Ga0207713_1000017108 195
241 3300025735 Ga0207713_1000053 Ga0207713_1000053130 195
242 3300025735 Ga0207713_1000066 Ga0207713_100006665 195
243 3300025735 Ga0207713_1014842 Ga0207713_10148422 195
244 3300025735 Ga0207713_1015490 Ga0207713_10154905 195
245 3300025735 Ga0207713_1065381 Ga0207713_10653813 195
246 3300025913 Ga0207695_10155439 Ga0207695_101554392 195
247 3300025932 Ga0207690_10032868 Ga0207690_100328682 195
248 3300025935 Ga0207709_10000505 Ga0207709_100005058 195
249 3300026116 Ga0207674_10000179 Ga0207674_1000017932 195
250 3300027111 Ga0209281_1000031 Ga0209281_1000031299 195
251 3300027111 Ga0209281_1000080 Ga0209281_10000809 195
252 3300027111 Ga0209281_1000162 Ga0209281_100016270 195
253 3300027111 Ga0209281_1000233 Ga0209281_1000233102 195
254 3300027111 Ga0209281_1000316 Ga0209281_100031663 195
255 3300027111 Ga0209281_1001239 Ga0209281_100123915 195
256 3300027111 Ga0209281_1001932 Ga0209281_10019321 195
257 3300027312 Ga0209371_1000115 Ga0209371_100011535 195
258 3300027312 Ga0209371_1000478 Ga0209371_10004785 195
259 3300027312 Ga0209371_1000761 Ga0209371_10007614 195
260 3300027312 Ga0209371_1004469 Ga0209371_10044691 195
261 3300027312 Ga0209371_1006503 Ga0209371_10065035 195
262 3300027312 Ga0209371_1017778 Ga0209371_10177781 195
263 3300028379 Ga0268266_10000079 Ga0268266_10000079117 195
264 3300030500 Ga0268256_1000097 Ga0268256_100009798 195
265 3300030500 Ga0268256_1000223 Ga0268256_100022351 195
266 3300030500 Ga0268256_1000406 Ga0268256_100040633 195
267 3300030500 Ga0268256_1000901 Ga0268256_100090119 195
268 3300030500 Ga0268256_1006548 Ga0268256_10065482 195
269 3300030500 Ga0268256_1012164 Ga0268256_10121644 195
270 3300041405 Ga0439438_000899 Ga0439438_000899_11556_12158 195
271 3300041405 Ga0439438_026577 Ga0439438_026577_280_876 195
272 3300041512 Ga0451853_2847756 Ga0451853_2847756_1135_1737 195
273 3300042010 Ga0439452_000010 Ga0439452_000010_173148_173744 195
274 3300042010 Ga0439452_000039 Ga0439452_000039_93036_93638 195
275 3300042010 Ga0439452_000212 Ga0439452_000212_4005_4601 195
276 3300042010 Ga0439452_000227 Ga0439452_000227_7530_8132 195
277 3300042136 Ga0450900_004694 Ga0450900_004694_717_1319 195
278 3300042439 Ga0439464_0000487 Ga0439464_0000487_817_1419 195
279 3300044669 Ga0466981_0000025 Ga0466981_0000025_36828_37430 195
280 3300046453 Ga0495627_028763 Ga0495627_028763_358_954 195
281 3300046458 Ga0495591_006489 Ga0495591_006489_889_1485 195
282 3300046460 Ga0495638_0006407 Ga0495638_0006407_3958_4554 195
283 3300046471 Ga0495650_0000103 Ga0495650_0000103_90348_90950 195
284 3300046471 Ga0495650_0007866 Ga0495650_0007866_1120_1716 195
285 3300046515 Ga0495620_0003527 Ga0495620_0003527_4289_4885 195
286 3300046530 Ga0495654_0017719 Ga0495654_0017719_1034_1627 195
287 3300046660 Ga0495625_0013106 Ga0495625_0013106_2781_3374 195
288 3300046694 Ga0495649_0052832 Ga0495649_0052832_1531_2124 195
289 3300047446 Ga0495679_000016 Ga0495679_000016_112975_113568 195
290 3300047446 Ga0495679_001466 Ga0495679_001466_7400_7996 195
291 3300048907 Ga0496104_0000113 Ga0496104_0000113_38723_39325 195
292 3300048907 Ga0496104_0298376 Ga0496104_0298376_58_660 195
293 3300048908 Ga0496105_0029223 Ga0496105_0029223_3875_4477 195
294 3300048916 Ga0496113_0326300 Ga0496113_0326300_31_633 195
295 3300048919 Ga0496116_0000623 Ga0496116_0000623_3657_4259 195
296 3300048919 Ga0496116_0093029 Ga0496116_0093029_855_1457 195
297 3300048920 Ga0496117_0055270 Ga0496117_0055270_1323_1919 195
298 3300048920 Ga0496117_0059726 Ga0496117_0059726_132_734 195
299 3300048920 Ga0496117_0061587 Ga0496117_0061587_1054_1650 195
300 3300048921 Ga0496118_0001319 Ga0496118_0001319_33673_34275 195
301 3300048921 Ga0496118_0292151 Ga0496118_0292151_126_722 195
302 3300048922 Ga0496119_0001629 Ga0496119_0001629_7834_8436 195
303 3300048922 Ga0496119_0013721 Ga0496119_0013721_4644_5240 195
304 3300048922 Ga0496119_0189325 Ga0496119_0189325_444_1046 195
305 3300048923 Ga0496120_0007549 Ga0496120_0007549_1439_2035 195
306 3300048923 Ga0496120_0093171 Ga0496120_0093171_972_1574 195
307 3300048924 Ga0496121_0001155 Ga0496121_0001155_3618_4220 195
308 3300048924 Ga0496121_0002320 Ga0496121_0002320_26_628 195
309 3300048924 Ga0496121_0178632 Ga0496121_0178632_32_634 195
310 3300048925 Ga0496122_0001295 Ga0496122_0001295_15724_16326 195
311 3300048925 Ga0496122_0011177 Ga0496122_0011177_7846_8448 195
312 3300048925 Ga0496122_0023020 Ga0496122_0023020_4155_4757 195
313 3300048925 Ga0496122_0037931 Ga0496122_0037931_80_676 195
314 3300048925 Ga0496122_0044010 Ga0496122_0044010_1481_2083 195
315 3300048925 Ga0496122_0157695 Ga0496122_0157695_711_1313 195
316 3300048926 Ga0496123_0001876 Ga0496123_0001876_10461_11063 195
317 3300048926 Ga0496123_0054694 Ga0496123_0054694_1243_1839 195
318 3300048926 Ga0496123_0127199 Ga0496123_0127199_741_1343 195
319 3300048926 Ga0496123_0248324 Ga0496123_0248324_13_615 195
320 3300048927 Ga0496124_0000147 Ga0496124_0000147_61100_61696 195
321 3300048927 Ga0496124_0001035 Ga0496124_0001035_43306_43908 195
322 3300048927 Ga0496124_0010494 Ga0496124_0010494_1421_2023 195
323 3300048927 Ga0496124_0011533 Ga0496124_0011533_3655_4257 195
324 3300048927 Ga0496124_0012505 Ga0496124_0012505_2983_3579 195
325 3300048927 Ga0496124_0094861 Ga0496124_0094861_1034_1630 195
326 3300048928 Ga0496125_0000104 Ga0496125_0000104_121777_122373 195
327 3300048928 Ga0496125_0024227 Ga0496125_0024227_1050_1652 195
328 3300048928 Ga0496125_0046034 Ga0496125_0046034_1549_2151 195
329 3300048928 Ga0496125_0087762 Ga0496125_0087762_696_1298 195
330 3300048929 Ga0496126_0006490 Ga0496126_0006490_7292_7894 195
331 3300048929 Ga0496126_0019933 Ga0496126_0019933_4824_5420 195
332 3300048929 Ga0496126_0191752 Ga0496126_0191752_876_1472 195
333 3300050491 nmdc:mga00v17_33011_c1 nmdc:mga00v17_33011_c1_2302_2904 195
334 iso_pu_bacteria 2511231035 2511435965 195
335 iso_pu_bacteria 2599185299 2599929275 195
336 iso_pu_bacteria 2608642108 2608671659 195
337 iso_pu_bacteria 2648501693 2650899834 195
338 iso_pu_bacteria 2684622997 2686356533 195
339 iso_pu_bacteria 2808606414 2809126732 195
340 iso_pu_bacteria 2844528606 2844532314 195
341 iso_pu_bacteria 2847797336 2847797664 195
342 iso_pu_bacteria 2865014394 2865014909 195
343 iso_pu_bacteria 2881609920 2881612513 195
344 iso_pu_bacteria 2939602548 2939605637 195
345 iso_pu_bacteria 2945951305 2945955232 195
346 iso_pu_bacteria 2978975091 2978977710 195
347 iso_pu_bacteria 2984494565 2984499092 195
348 iso_pu_bacteria 2990261002 2990263797 195
349 3300003856 Ga0058692_1029964 Ga0058692_10299642 196
350 3300005272 Ga0065703_1018967 Ga0065703_10189672 196
351 3300006946 Ga0079104_1002858 Ga0079104_10028582 196
352 3300006946 Ga0079104_1003368 Ga0079104_100336811 196
353 3300009011 Ga0105251_10000386 Ga0105251_1000038642 196
354 3300009011 Ga0105251_10001812 Ga0105251_1000181216 196
355 3300009011 Ga0105251_10002251 Ga0105251_1000225116 196
356 3300009036 Ga0105244_10003991 Ga0105244_100039917 196
357 3300009036 Ga0105244_10004924 Ga0105244_100049242 196
358 3300009036 Ga0105244_10022443 Ga0105244_100224436 196
359 3300009036 Ga0105244_10108828 Ga0105244_101088282 196
360 3300009092 Ga0105250_10002575 Ga0105250_100025754 196
361 3300009101 Ga0105247_10000171 Ga0105247_1000017116 196
362 3300009174 Ga0105241_10000010 Ga0105241_10000010232 196
363 3300009176 Ga0105242_11598264 Ga0105242_115982641 196
364 3300013100 Ga0157373_10057353 Ga0157373_100573533 196
365 3300013100 Ga0157373_10342556 Ga0157373_103425562 196
366 3300013102 Ga0157371_10002090 Ga0157371_100020909 196
367 3300013102 Ga0157371_10272202 Ga0157371_102722023 196
368 3300013105 Ga0157369_10002935 Ga0157369_1000293513 196
369 3300013307 Ga0157372_10000177 Ga0157372_100001777 196
370 3300014497 Ga0182008_10018478 Ga0182008_100184785 196
371 3300017792 Ga0163161_10000006 Ga0163161_1000000648 196
372 3300021384 Ga0213876_10000039 Ga0213876_1000003941 196
373 3300025258 Ga0209129_1000021 Ga0209129_1000021315 196
374 3300025711 Ga0207696_1000046 Ga0207696_100004648 196
375 3300025728 Ga0207655_1000208 Ga0207655_100020847 196
376 3300025728 Ga0207655_1039852 Ga0207655_10398522 196
377 3300025735 Ga0207713_1000056 Ga0207713_100005648 196
378 3300025735 Ga0207713_1000075 Ga0207713_1000075147 196
379 3300025735 Ga0207713_1000613 Ga0207713_100061336 196
380 3300025900 Ga0207710_10000024 Ga0207710_10000024245 196
381 3300025911 Ga0207654_10000010 Ga0207654_10000010233 196
382 3300027111 Ga0209281_1000139 Ga0209281_1000139119 196
383 3300027111 Ga0209281_1002071 Ga0209281_10020715 196
384 3300027312 Ga0209371_1000027 Ga0209371_1000027102 196
385 3300027312 Ga0209371_1000029 Ga0209371_1000029290 196
386 3300027312 Ga0209371_1000733 Ga0209371_100073319 196
387 3300027312 Ga0209371_1004503 Ga0209371_10045034 196
388 3300030500 Ga0268256_1000032 Ga0268256_1000032104 196
389 3300030500 Ga0268256_1000045 Ga0268256_1000045187 196
390 3300039437 Ga0436365_0171687 Ga0436365_0171687_132528_133136 196
391 3300041405 Ga0439438_000049 Ga0439438_000049_35001_35600 196
392 3300041407 Ga0439447_001340 Ga0439447_001340_4988_5587 196
393 3300042006 Ga0439432_000551 Ga0439432_000551_11271_11891 196
394 3300042010 Ga0439452_000012 Ga0439452_000012_306650_307273 196
395 3300042137 Ga0450902_015574 Ga0450902_015574_239_859 196
396 3300042439 Ga0439464_0009301 Ga0439464_0009301_451_1074 196
397 3300046453 Ga0495627_000200 Ga0495627_000200_50801_51421 196
398 3300046530 Ga0495654_0000823 Ga0495654_0000823_908_1528 196
399 3300046794 Ga0495589_0000121 Ga0495589_0000121_49995_50615 196
400 3300048908 Ga0496105_0049648 Ga0496105_0049648_1051_1674 196
401 3300048919 Ga0496116_0000058 Ga0496116_0000058_228367_228987 196
402 3300048920 Ga0496117_0000450 Ga0496117_0000450_11781_12401 196
403 3300048920 Ga0496117_0001370 Ga0496117_0001370_2362_2985 196
404 3300048920 Ga0496117_0136605 Ga0496117_0136605_34_657 196
405 3300048920 Ga0496117_0137176 Ga0496117_0137176_731_1351 196
406 3300048921 Ga0496118_0007029 Ga0496118_0007029_9909_10529 196
407 3300048921 Ga0496118_0039447 Ga0496118_0039447_2001_2624 196
408 3300048922 Ga0496119_0000023 Ga0496119_0000023_104598_105221 196
409 3300048922 Ga0496119_0003974 Ga0496119_0003974_1129_1749 196
410 3300048922 Ga0496119_0004011 Ga0496119_0004011_13013_13633 196
411 3300048923 Ga0496120_0001708 Ga0496120_0001708_3484_4104 196
412 3300048923 Ga0496120_0003004 Ga0496120_0003004_12017_12637 196
413 3300048923 Ga0496120_0036756 Ga0496120_0036756_1191_1811 196
414 3300048925 Ga0496122_0001307 Ga0496122_0001307_10990_11598 196
415 3300048925 Ga0496122_0014457 Ga0496122_0014457_3341_3964 196
416 3300048925 Ga0496122_0060955 Ga0496122_0060955_2007_2630 196
417 3300048926 Ga0496123_0000504 Ga0496123_0000504_37853_38461 196
418 3300048926 Ga0496123_0011179 Ga0496123_0011179_3367_3990 196
419 3300048927 Ga0496124_0000109 Ga0496124_0000109_133921_134544 196
420 3300048927 Ga0496124_0000304 Ga0496124_0000304_50999_51619 196
421 3300048928 Ga0496125_0103659 Ga0496125_0103659_249_872 196
422 3300048928 Ga0496125_0202934 Ga0496125_0202934_505_1113 196
423 iso_pu_bacteria 2506520007 2506576186 196
424 iso_pu_bacteria 2506520008 2506581324 196
425 iso_pu_bacteria 2508501071 2508850162 196
426 iso_pu_bacteria 2547132181 2547698348 196
427 iso_pu_bacteria 2561511199 2562464865 196
428 iso_pu_bacteria 2600255256 2601534652 196
429 iso_pu_bacteria 2600255257 2601539237 196
430 iso_pu_bacteria 2600255310 2601757586 196
431 iso_pu_bacteria 2600255311 2601763945 196
432 iso_pu_bacteria 2602042046 2603640292 196
433 iso_pu_bacteria 2654587920 2656277195 196
434 iso_pu_bacteria 2687453601 2689442616 196
435 iso_pu_bacteria 2772190666 2772436761 196
436 iso_pu_bacteria 2791355010 2792311160 196
437 iso_pu_bacteria 2806310673 2807178989 196
438 iso_pu_bacteria 2811995292 2813726537 196
439 iso_pu_bacteria 2814123068 2814693911 196
440 iso_pu_bacteria 2869551831 2869552033 196
441 iso_pu_bacteria 2888366609 2888366808 196
442 iso_pu_bacteria 2935625433 2935628854 196
443 iso_pu_bacteria 2937967321 2937971449 196
444 iso_pu_bacteria 2939617950 2939620746 196
445 iso_pu_bacteria 2974435778 2974440533 196
446 iso_pu_bacteria 640753048 640935711 196
447 iso_pu_bacteria 8004592986 8004593545 196
448 iso_pu_bacteria 8015394850 8015397364 196
449 iso_pu_bacteria 8019504834 8019507298 196
450 3300027111 Ga0209281_1000065 Ga0209281_1000065141 197
451 3300027312 Ga0209371_1001831 Ga0209371_10018316 197
452 3300030500 Ga0268256_1002213 Ga0268256_10022135 197
453 3300048904 Ga0496101_0041825 Ga0496101_0041825_535_1146 197
454 iso_pu_bacteria 2888373701 2888375551 197
455 iso_pu_bacteria 2932406140 2932409077 197
456 iso_pu_bacteria 2939577877 2939581619 197
457 3300002737 JGI25162J39368_1000116 JGI25162J39368_100011658 198
458 3300002771 JGI25163J39215_1000099 JGI25163J39215_100009922 198
459 3300002772 JGI25164J39214_1000095 JGI25164J39214_100009522 198
460 3300003751 Ga0055538_1000077 Ga0055538_100007757 198
461 3300003752 Ga0055539_1000114 Ga0055539_100011460 198
462 3300003756 Ga0055533_1000122 Ga0055533_100012258 198
463 3300003759 Ga0055525_1000155 Ga0055525_100015560 198
464 3300003841 Ga0055541_1000078 Ga0055541_100007858 198
465 3300003856 Ga0058692_1016115 Ga0058692_10161153 198
466 3300005289 Ga0065704_10001437 Ga0065704_1000143719 198
467 3300006051 Ga0075364_10015691 Ga0075364_100156914 198
468 3300009011 Ga0105251_10076929 Ga0105251_100769293 198
469 3300009036 Ga0105244_10000119 Ga0105244_1000011947 198
470 3300009036 Ga0105244_10000588 Ga0105244_1000058812 198
471 3300009036 Ga0105244_10125124 Ga0105244_101251243 198
472 3300009092 Ga0105250_10000049 Ga0105250_1000004970 198
473 3300009092 Ga0105250_10002801 Ga0105250_100028014 198
474 3300009092 Ga0105250_10005633 Ga0105250_100056336 198
475 3300009177 Ga0105248_10045682 Ga0105248_100456825 198
476 3300011119 Ga0105246_10210460 Ga0105246_102104603 198
477 3300011119 Ga0105246_10215148 Ga0105246_102151483 198
478 3300013100 Ga0157373_10000369 Ga0157373_100003693 198
479 3300013102 Ga0157371_10000102 Ga0157371_1000010277 198
480 3300013102 Ga0157371_10001827 Ga0157371_1000182710 198
481 3300013104 Ga0157370_10001324 Ga0157370_100013245 198
482 3300013306 Ga0163162_10082996 Ga0163162_100829962 198
483 3300013307 Ga0157372_10003762 Ga0157372_1000376212 198
484 3300025207 Ga0209760_100066 Ga0209760_10006622 198
485 3300025224 Ga0209784_100064 Ga0209784_10006457 198
486 3300025225 Ga0209566_100079 Ga0209566_10007957 198
487 3300025226 Ga0209674_100159 Ga0209674_10015957 198
488 3300025230 Ga0209563_100135 Ga0209563_10013557 198
489 3300025231 Ga0207427_100136 Ga0207427_10013657 198
490 3300025233 Ga0209437_100149 Ga0209437_10014957 198
491 3300025253 Ga0209677_100110 Ga0209677_10011057 198
492 3300025261 Ga0209233_1006388 Ga0209233_10063882 198
493 3300025711 Ga0207696_1000146 Ga0207696_100014669 198
494 3300025711 Ga0207696_1000557 Ga0207696_100055730 198
495 3300025711 Ga0207696_1001099 Ga0207696_100109911 198
496 3300025728 Ga0207655_1000170 Ga0207655_100017047 198
497 3300025728 Ga0207655_1000284 Ga0207655_100028418 198
498 3300025735 Ga0207713_1000780 Ga0207713_100078023 198
499 3300027312 Ga0209371_1002918 Ga0209371_10029183 198
500 3300030500 Ga0268256_1013282 Ga0268256_10132822 198
501 3300041405 Ga0439438_000191 Ga0439438_000191_26499_27104 198
502 3300041405 Ga0439438_060036 Ga0439438_060036_316_939 198
503 3300041407 Ga0439447_000586 Ga0439447_000586_7283_7888 198
504 3300042006 Ga0439432_072314 Ga0439432_072314_77_682 198
505 3300042532 Ga0450893_0001177 Ga0450893_0001177_2029_2640 198
506 3300046458 Ga0495591_003864 Ga0495591_003864_1293_1898 198
507 3300046471 Ga0495650_0000034 Ga0495650_0000034_111159_111764 198
508 3300046471 Ga0495650_0000199 Ga0495650_0000199_71406_72017 198
509 3300046501 Ga0495607_0031577 Ga0495607_0031577_279_884 198
510 3300046507 Ga0495606_0000511 Ga0495606_0000511_42669_43274 198
511 3300046513 Ga0495616_0070905 Ga0495616_0070905_775_1380 198
512 3300046523 Ga0495644_0004874 Ga0495644_0004874_1368_1973 198
513 3300046524 Ga0495648_0002804 Ga0495648_0002804_3547_4152 198
514 3300046530 Ga0495654_0000598 Ga0495654_0000598_23612_24217 198
515 3300046530 Ga0495654_0112312 Ga0495654_0112312_147_752 198
516 3300046692 Ga0495671_0007051 Ga0495671_0007051_3548_4153 198
517 3300046694 Ga0495649_0004891 Ga0495649_0004891_4830_5435 198
518 3300046794 Ga0495589_0016884 Ga0495589_0016884_1358_1963 198
519 3300046810 Ga0495660_0000020 Ga0495660_0000020_215384_215989 198
520 3300046810 Ga0495660_0000045 Ga0495660_0000045_91298_91909 198
521 3300047320 Ga0495672_0000011 Ga0495672_0000011_134580_135185 198
522 3300047321 Ga0495676_0085062 Ga0495676_0085062_384_989 198
523 3300047323 Ga0495683_0110235 Ga0495683_0110235_48_653 198
524 3300047469 Ga0495673_0000020 Ga0495673_0000020_121674_122279 198
525 3300048903 Ga0496100_0031847 Ga0496100_0031847_1424_2020 198
526 3300048904 Ga0496101_0000053 Ga0496101_0000053_100157_100753 198
527 3300048907 Ga0496104_0008831 Ga0496104_0008831_1586_2197 198
528 3300048919 Ga0496116_0000129 Ga0496116_0000129_45977_46582 198
529 3300048919 Ga0496116_0001110 Ga0496116_0001110_4691_5302 198
530 3300048919 Ga0496116_0094215 Ga0496116_0094215_114_710 198
531 3300048920 Ga0496117_0005212 Ga0496117_0005212_4692_5303 198
532 3300048920 Ga0496117_0037326 Ga0496117_0037326_2917_3528 198
533 3300048921 Ga0496118_0002440 Ga0496118_0002440_23273_23884 198
534 3300048921 Ga0496118_0004790 Ga0496118_0004790_1159_1770 198
535 3300048921 Ga0496118_0055398 Ga0496118_0055398_993_1589 198
536 3300048922 Ga0496119_0000075 Ga0496119_0000075_80879_81484 198
537 3300048922 Ga0496119_0004743 Ga0496119_0004743_9502_10098 198
538 3300048922 Ga0496119_0008528 Ga0496119_0008528_3981_4592 198
539 3300048922 Ga0496119_0013032 Ga0496119_0013032_2197_2802 198
540 3300048923 Ga0496120_0000008 Ga0496120_0000008_105875_106480 198
541 3300048923 Ga0496120_0000024 Ga0496120_0000024_158206_158811 198
542 3300048923 Ga0496120_0010426 Ga0496120_0010426_380_991 198
543 3300048923 Ga0496120_0020509 Ga0496120_0020509_385_981 198
544 3300048925 Ga0496122_0000607 Ga0496122_0000607_68284_68895 198
545 3300048925 Ga0496122_0032665 Ga0496122_0032665_2515_3111 198
546 3300048926 Ga0496123_0000451 Ga0496123_0000451_68301_68912 198
547 3300048926 Ga0496123_0003659 Ga0496123_0003659_8415_9011 198
548 3300048927 Ga0496124_0000379 Ga0496124_0000379_22082_22693 198
549 3300048927 Ga0496124_0034687 Ga0496124_0034687_1674_2273 198
550 3300048928 Ga0496125_0001589 Ga0496125_0001589_4695_5306 198
551 3300048928 Ga0496125_0210858 Ga0496125_0210858_403_1008 198
552 3300048929 Ga0496126_0009007 Ga0496126_0009007_4568_5179 198
553 3300048929 Ga0496126_0213140 Ga0496126_0213140_290_886 198
554 3300049459 Ga0495678_000269 Ga0495678_000269_5552_6157 198
555 3300049460 Ga0495682_0000022 Ga0495682_0000022_123462_124067 198
556 3300050491 nmdc:mga00v17_7298_c1 nmdc:mga00v17_7298_c1_5284_5880 198
557 3300053126 Ga0500621_000009 Ga0500621_000009_49204_49809 198
558 2010549000 RicEn_FSXC78089_g1 RicEn_567000 199
559 3300002737 JGI25162J39368_1002893 JGI25162J39368_10028934 199
560 3300003856 Ga0058692_1000039 Ga0058692_100003931 199
561 3300003856 Ga0058692_1000177 Ga0058692_100017734 199
562 3300003856 Ga0058692_1001326 Ga0058692_10013264 199
563 3300003856 Ga0058692_1001347 Ga0058692_10013473 199
564 3300003856 Ga0058692_1005570 Ga0058692_10055702 199
565 3300003856 Ga0058692_1005679 Ga0058692_10056795 199
566 3300005347 Ga0070668_100035599 Ga0070668_1000355992 199
567 3300005367 Ga0070667_101078913 Ga0070667_1010789131 199
568 3300005457 Ga0070662_100001522 Ga0070662_10000152212 199
569 3300005548 Ga0070665_100046172 Ga0070665_1000461725 199
570 3300006051 Ga0075364_10063771 Ga0075364_100637711 199
571 3300009011 Ga0105251_10000475 Ga0105251_100004755 199
572 3300009036 Ga0105244_10000465 Ga0105244_100004654 199
573 3300009036 Ga0105244_10003857 Ga0105244_100038579 199
574 3300009036 Ga0105244_10340568 Ga0105244_103405681 199
575 3300009092 Ga0105250_10095346 Ga0105250_100953461 199
576 3300009545 Ga0105237_10069974 Ga0105237_100699743 199
577 3300010375 Ga0105239_10455858 Ga0105239_104558583 199
578 3300011119 Ga0105246_10054219 Ga0105246_100542193 199
579 3300013100 Ga0157373_10153151 Ga0157373_101531511 199
580 3300013102 Ga0157371_10001010 Ga0157371_100010109 199
581 3300013104 Ga0157370_10000701 Ga0157370_1000070124 199
582 3300013104 Ga0157370_10509118 Ga0157370_105091181 199
583 3300013105 Ga0157369_11492055 Ga0157369_114920551 199
584 3300013306 Ga0163162_10203968 Ga0163162_102039682 199
585 3300013307 Ga0157372_10011267 Ga0157372_100112673 199
586 3300013307 Ga0157372_10561298 Ga0157372_105612981 199
587 3300013307 Ga0157372_11878461 Ga0157372_118784611 199
588 3300013307 Ga0157372_11879566 Ga0157372_118795661 199
589 3300015261 Ga0182006_1042373 Ga0182006_10423732 199
590 3300015262 Ga0182007_10002516 Ga0182007_1000251611 199
591 3300016635 Ga0183361_14716 Ga0183361_147161 199
592 3300017792 Ga0163161_10004281 Ga0163161_100042815 199
593 3300025207 Ga0209760_101785 Ga0209760_1017852 199
594 3300025233 Ga0209437_100136 Ga0209437_10013656 199
595 3300025711 Ga0207696_1001036 Ga0207696_10010368 199
596 3300025728 Ga0207655_1000024 Ga0207655_1000024399 199
597 3300025728 Ga0207655_1023169 Ga0207655_10231692 199
598 3300025735 Ga0207713_1000043 Ga0207713_1000043121 199
599 3300025735 Ga0207713_1009635 Ga0207713_10096352 199
600 3300025914 Ga0207671_10102129 Ga0207671_101021293 199
601 3300025933 Ga0207706_10021654 Ga0207706_100216547 199
602 3300025972 Ga0207668_10076901 Ga0207668_100769012 199
603 3300027312 Ga0209371_1000061 Ga0209371_1000061114 199
604 3300027312 Ga0209371_1000082 Ga0209371_1000082103 199
605 3300027312 Ga0209371_1000119 Ga0209371_100011932 199
606 3300027312 Ga0209371_1000230 Ga0209371_100023059 199
607 3300027312 Ga0209371_1000491 Ga0209371_100049136 199
608 3300027312 Ga0209371_1002309 Ga0209371_10023098 199
609 3300030500 Ga0268256_1000059 Ga0268256_1000059101 199
610 3300030500 Ga0268256_1000072 Ga0268256_1000072102 199
611 3300030500 Ga0268256_1000096 Ga0268256_100009697 199
612 3300030500 Ga0268256_1000415 Ga0268256_10004151 199
613 3300030500 Ga0268256_1001531 Ga0268256_10015318 199
614 3300030500 Ga0268256_1002052 Ga0268256_10020528 199
615 3300030500 Ga0268256_1014182 Ga0268256_10141821 199
616 3300041405 Ga0439438_005930 Ga0439438_005930_130_729 199
617 3300041407 Ga0439447_004003 Ga0439447_004003_4089_4688 199
618 3300041411 Ga0439466_0000011 Ga0439466_0000011_72340_72939 199
619 3300042006 Ga0439432_001750 Ga0439432_001750_6224_6823 199
620 3300042010 Ga0439452_000026 Ga0439452_000026_118510_119109 199
621 3300042016 Ga0439463_045202 Ga0439463_045202_56_655 199
622 3300042146 Ga0450907_000007 Ga0450907_000007_43161_43769 199
623 3300042439 Ga0439464_0037514 Ga0439464_0037514_472_1071 199
624 3300046452 Ga0495617_059412 Ga0495617_059412_467_1075 199
625 3300046458 Ga0495591_000010 Ga0495591_000010_43398_43997 199
626 3300046492 Ga0495585_0009410 Ga0495585_0009410_787_1386 199
627 3300046500 Ga0495596_0002829 Ga0495596_0002829_7056_7655 199
628 3300046522 Ga0495643_0041106 Ga0495643_0041106_1757_2356 199
629 3300046524 Ga0495648_0005670 Ga0495648_0005670_8178_8786 199
630 3300046530 Ga0495654_0000151 Ga0495654_0000151_43430_44029 199
631 3300046616 Ga0495668_0022890 Ga0495668_0022890_475_1074 199
632 3300046810 Ga0495660_0026735 Ga0495660_0026735_469_1068 199
633 3300047320 Ga0495672_0000040 Ga0495672_0000040_147904_148512 199
634 3300047446 Ga0495679_001180 Ga0495679_001180_7184_7783 199
635 3300048903 Ga0496100_0004088 Ga0496100_0004088_6672_7271 199
636 3300048905 Ga0496102_0011675 Ga0496102_0011675_2677_3276 199
637 3300048906 Ga0496103_0168669 Ga0496103_0168669_152_751 199
638 3300048908 Ga0496105_0001883 Ga0496105_0001883_10556_11155 199
639 3300048908 Ga0496105_0556510 Ga0496105_0556510_72_671 199
640 3300048913 Ga0496110_0375081 Ga0496110_0375081_40_639 199
641 3300048916 Ga0496113_0497204 Ga0496113_0497204_144_743 199
642 3300048919 Ga0496116_0000278 Ga0496116_0000278_53050_53649 199
643 3300048919 Ga0496116_0000734 Ga0496116_0000734_19492_20100 199
644 3300048919 Ga0496116_0048405 Ga0496116_0048405_392_991 199
645 3300048919 Ga0496116_0332719 Ga0496116_0332719_57_656 199
646 3300048920 Ga0496117_0000092 Ga0496117_0000092_121889_122488 199
647 3300048920 Ga0496117_0000224 Ga0496117_0000224_9580_10179 199
648 3300048920 Ga0496117_0000400 Ga0496117_0000400_20542_21141 199
649 3300048921 Ga0496118_0000053 Ga0496118_0000053_113323_113922 199
650 3300048921 Ga0496118_0000540 Ga0496118_0000540_46246_46845 199
651 3300048922 Ga0496119_0000581 Ga0496119_0000581_10891_11490 199
652 3300048922 Ga0496119_0009118 Ga0496119_0009118_3468_4067 199
653 3300048922 Ga0496119_0409731 Ga0496119_0409731_28_627 199
654 3300048923 Ga0496120_0000178 Ga0496120_0000178_82938_83537 199
655 3300048923 Ga0496120_0000548 Ga0496120_0000548_18935_19534 199
656 3300048924 Ga0496121_0000304 Ga0496121_0000304_18236_18844 199
657 3300048925 Ga0496122_0209010 Ga0496122_0209010_496_1095 199
658 3300048925 Ga0496122_0400765 Ga0496122_0400765_41_640 199
659 3300048926 Ga0496123_0139087 Ga0496123_0139087_496_1095 199
660 3300048927 Ga0496124_0000251 Ga0496124_0000251_51428_52027 199
661 3300048927 Ga0496124_0066156 Ga0496124_0066156_2201_2809 199
662 3300048927 Ga0496124_0097037 Ga0496124_0097037_1354_1953 199
663 3300048927 Ga0496124_0115797 Ga0496124_0115797_1399_1998 199
664 3300048928 Ga0496125_0002821 Ga0496125_0002821_14434_15033 199
665 3300048929 Ga0496126_0164566 Ga0496126_0164566_304_903 199
666 3300050491 nmdc:mga00v17_391214_c1 nmdc:mga00v17_391214_c1_291_890 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

21

196

0.94

PF05175

MTS

Methyltransferase small domain

43

154

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fpo-assembly1.cif.gz_A putative methyltransferase yhhf from escherichia coli. 0.9903 12 194
2fpo-assembly1.cif.gz_A putative methyltransferase yhhf from escherichia coli. 0.9848 12 194
2fpo-assembly4.cif.gz_D putative methyltransferase yhhf from escherichia coli. 0.9845 12 192
2fpo-assembly5.cif.gz_E putative methyltransferase yhhf from escherichia coli. 0.9825 12 194
2fpo-assembly5.cif.gz_E putative methyltransferase yhhf from escherichia coli. 0.9771 12 194
ID Description Score Start End Superfamily
2fpoF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.969 12 192 3.40.50.150
af_P0ADX9_1_198_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9669 1 199 3.40.50.150
af_P0ADX9_1_198_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9573 1 199 3.40.50.150
2fpoF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9527 12 192 3.40.50.150
af_A0A5K1K930_343_529_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9183 16 190 3.40.50.150
ID Description Score Start End GO Terms
AF-M7DBA7-F1-model_v4 Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.171) 0.9863 12 195 GO:0003676
GO:0052913
AF-A0A090SA42-F1-model_v4 Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.171) 0.982 12 194 GO:0003676
GO:0052913
AF-A0A1L6K9C1-F1-model_v4 deleted 0.9799 11 193
AF-A0A2G1Y559-F1-model_v4 Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.171) 0.9789 12 191 GO:0003676
GO:0052913
AF-J3YSU8-F1-model_v4 Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.171) 0.9786 10 199 GO:0003676
GO:0052913

Feature Viewer

pLDDT pTM Quality
89.81 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map