F473551
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 663 | 257 | 663 | 192 |
Family's Representative Sequence
| Representative Sequence | 3300006914|Ga0075436_100413795|Ga0075436_1004137952 |
| Length | 201 |
| Sequence | MLSDISLKQSQNTPSTGGDRGKRIHPHKFTLWVAIGSIIMMFAGLTSAYIVKSNQAGWQSIEMPNIFWYSTGTIVLSSIMMQMALRSFKQREMNHYRLLIAGTFILGVTFVILQWIGFRQLWNSGIQFKGSSGGGQFLYVIAGLHALHVFGGVIALMVMFIKAFFGRVKLYSSVPVELMATYWHFVDFLWIYLLVFFMLIG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 146 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 147 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 148 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 153 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 155 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 156 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 157 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 158 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 159 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 160 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 161 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 164 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 166 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 168 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 169 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 170 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 171 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 172 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 173 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 174 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 175 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 176 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 177 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 178 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 179 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 180 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 181 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 212 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 213 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 214 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 215 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 233 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 234 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 235 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 236 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 237 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 238 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 242 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 245 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 246 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 247 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 251 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 252 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 253 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 254 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 255 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.66 |
| Nodule | 0 |
| Rhizoplane | 0.75 |
| Rhizosphere | 95.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1000706 | 3300000545 | Bacteria | 2171 |
| 2 | JGI24744J21845_10024993 | 3300002077 | Bacteria | 1165 |
| 3 | rootH2_10027245 | 3300003320 | Bacteria | 5760 |
| 4 | rootL2_10072075 | 3300003322 | Bacteria | 1882 |
| 5 | rootL2_10326007 | 3300003322 | Bacteria | 1696 |
| 6 | rootH1_10243153 | 3300003323 | Bacteria | 1076 |
| 7 | Ga0065712_10181075 | 3300005290 | Bacteria | 1192 |
| 8 | Ga0065712_10284438 | 3300005290 | Bacteria | 869 |
| 9 | Ga0070658_10012615 | 3300005327 | Bacteria | 6779 |
| 10 | Ga0070676_10014319 | 3300005328 | Bacteria | 4359 |
| 11 | Ga0070676_10018990 | 3300005328 | Bacteria | 3819 |
| 12 | Ga0070676_10020683 | 3300005328 | Bacteria | 3678 |
| 13 | Ga0070676_10355691 | 3300005328 | Bacteria | 1008 |
| 14 | Ga0070683_100191390 | 3300005329 | Bacteria | 1942 |
| 15 | Ga0070683_100418339 | 3300005329 | Bacteria | 1278 |
| 16 | Ga0070683_100936182 | 3300005329 | Bacteria | 831 |
| 17 | Ga0070690_100031252 | 3300005330 | Bacteria | 3316 |
| 18 | Ga0070690_100096016 | 3300005330 | Bacteria | 1958 |
| 19 | Ga0070690_100247796 | 3300005330 | Bacteria | 1259 |
| 20 | Ga0070690_100471088 | 3300005330 | Bacteria | 935 |
| 21 | Ga0070670_100791104 | 3300005331 | Bacteria | 856 |
| 22 | Ga0068869_100015272 | 3300005334 | Bacteria | 5147 |
| 23 | Ga0068869_100027016 | 3300005334 | Bacteria | 3999 |
| 24 | Ga0068869_100040117 | 3300005334 | Bacteria | 3346 |
| 25 | Ga0068869_100074258 | 3300005334 | Bacteria | 2523 |
| 26 | Ga0068869_100188094 | 3300005334 | Bacteria | 1622 |
| 27 | Ga0068869_100761899 | 3300005334 | Unclassified | 829 |
| 28 | Ga0070666_10002756 | 3300005335 | Bacteria | 10618 |
| 29 | Ga0070666_10041311 | 3300005335 | Bacteria | 3081 |
| 30 | Ga0070666_10053529 | 3300005335 | Bacteria | 2722 |
| 31 | Ga0070666_10058363 | 3300005335 | Bacteria | 2609 |
| 32 | Ga0068868_100003574 | 3300005338 | Bacteria | 10828 |
| 33 | Ga0068868_100007171 | 3300005338 | Bacteria | 7920 |
| 34 | Ga0068868_100008105 | 3300005338 | Bacteria | 7514 |
| 35 | Ga0068868_100013885 | 3300005338 | Bacteria | 5920 |
| 36 | Ga0068868_100176158 | 3300005338 | Bacteria | 1772 |
| 37 | Ga0068868_101510350 | 3300005338 | Unclassified | 629 |
| 38 | Ga0070660_100931232 | 3300005339 | Unclassified | 733 |
| 39 | Ga0070689_100138505 | 3300005340 | Bacteria | 1955 |
| 40 | Ga0070689_100578268 | 3300005340 | Unclassified | 971 |
| 41 | Ga0070689_101072005 | 3300005340 | Unclassified | 719 |
| 42 | Ga0070687_100006709 | 3300005343 | Bacteria | 4739 |
| 43 | Ga0070661_100010809 | 3300005344 | Bacteria | 6354 |
| 44 | Ga0070661_100019264 | 3300005344 | Bacteria | 4862 |
| 45 | Ga0070661_100058296 | 3300005344 | Bacteria | 2830 |
| 46 | Ga0070661_100304644 | 3300005344 | Bacteria | 1241 |
| 47 | Ga0070661_100319166 | 3300005344 | Bacteria | 1213 |
| 48 | Ga0070661_100467337 | 3300005344 | Bacteria | 1005 |
| 49 | Ga0070661_100676657 | 3300005344 | Bacteria | 839 |
| 50 | Ga0070692_10833372 | 3300005345 | Bacteria | 632 |
| 51 | Ga0070668_100001487 | 3300005347 | Bacteria | 16922 |
| 52 | Ga0070668_100009928 | 3300005347 | Bacteria | 7051 |
| 53 | Ga0070669_100037400 | 3300005353 | Bacteria | 3521 |
| 54 | Ga0070669_100378550 | 3300005353 | Bacteria | 1154 |
| 55 | Ga0070675_100022703 | 3300005354 | Bacteria | 5013 |
| 56 | Ga0070675_100046846 | 3300005354 | Bacteria | 3542 |
| 57 | Ga0070675_100076880 | 3300005354 | Unclassified | 2777 |
| 58 | Ga0070675_100791776 | 3300005354 | Bacteria | 866 |
| 59 | Ga0070671_100007908 | 3300005355 | Bacteria | 8501 |
| 60 | Ga0070671_100153841 | 3300005355 | Bacteria | 1942 |
| 61 | Ga0070671_100736279 | 3300005355 | Bacteria | 856 |
| 62 | Ga0070674_100049306 | 3300005356 | Bacteria | 2894 |
| 63 | Ga0070674_100066226 | 3300005356 | Bacteria | 2538 |
| 64 | Ga0070673_100025956 | 3300005364 | Bacteria | 4320 |
| 65 | Ga0070673_100060620 | 3300005364 | Bacteria | 2999 |
| 66 | Ga0070673_100306920 | 3300005364 | Bacteria | 1399 |
| 67 | Ga0070688_100012159 | 3300005365 | Bacteria | 4813 |
| 68 | Ga0070688_100029947 | 3300005365 | Bacteria | 3263 |
| 69 | Ga0070688_100215677 | 3300005365 | Bacteria | 1350 |
| 70 | Ga0070659_100075000 | 3300005366 | Bacteria | 2696 |
| 71 | Ga0070659_100531771 | 3300005366 | Bacteria | 1005 |
| 72 | Ga0070659_100617771 | 3300005366 | Bacteria | 933 |
| 73 | Ga0070667_100021240 | 3300005367 | Bacteria | 5393 |
| 74 | Ga0070667_100039008 | 3300005367 | Bacteria | 3982 |
| 75 | Ga0070667_100071668 | 3300005367 | Bacteria | 2951 |
| 76 | Ga0070667_100151519 | 3300005367 | Bacteria | 2037 |
| 77 | Ga0070667_100430442 | 3300005367 | Bacteria | 1204 |
| 78 | Ga0070667_100489979 | 3300005367 | Unclassified | 1126 |
| 79 | Ga0070667_100651887 | 3300005367 | Bacteria | 972 |
| 80 | Ga0070663_100091947 | 3300005455 | Bacteria | 2249 |
| 81 | Ga0070663_100119899 | 3300005455 | Bacteria | 1986 |
| 82 | Ga0070678_100043720 | 3300005456 | Bacteria | 3194 |
| 83 | Ga0070678_100046738 | 3300005456 | Bacteria | 3106 |
| 84 | Ga0070678_100190194 | 3300005456 | Bacteria | 1687 |
| 85 | Ga0070662_100001127 | 3300005457 | Bacteria | 16320 |
| 86 | Ga0070662_100011969 | 3300005457 | Bacteria | 5738 |
| 87 | Ga0070662_100013705 | 3300005457 | Bacteria | 5400 |
| 88 | Ga0070662_100070814 | 3300005457 | Bacteria | 2570 |
| 89 | Ga0070662_100328508 | 3300005457 | Bacteria | 1249 |
| 90 | Ga0070681_10045020 | 3300005458 | Bacteria | 4417 |
| 91 | Ga0070681_11435717 | 3300005458 | Bacteria | 614 |
| 92 | Ga0068867_100026025 | 3300005459 | Bacteria | 4197 |
| 93 | Ga0068867_100055002 | 3300005459 | Bacteria | 2941 |
| 94 | Ga0068867_100077338 | 3300005459 | Bacteria | 2500 |
| 95 | Ga0068867_100090140 | 3300005459 | Bacteria | 2326 |
| 96 | Ga0068867_100169885 | 3300005459 | Bacteria | 1726 |
| 97 | Ga0070685_10003854 | 3300005466 | Bacteria | 7589 |
| 98 | Ga0070685_10063093 | 3300005466 | Bacteria | 2175 |
| 99 | Ga0070685_10542127 | 3300005466 | Bacteria | 829 |
| 100 | Ga0070684_100002074 | 3300005535 | Bacteria | 14766 |
| 101 | Ga0070684_100021281 | 3300005535 | Bacteria | 5394 |
| 102 | Ga0070684_100190517 | 3300005535 | Bacteria | 1866 |
| 103 | Ga0068853_100026519 | 3300005539 | Bacteria | 4866 |
| 104 | Ga0068853_100057447 | 3300005539 | Unclassified | 3358 |
| 105 | Ga0068853_100067657 | 3300005539 | Bacteria | 3104 |
| 106 | Ga0068853_100091687 | 3300005539 | Bacteria | 2673 |
| 107 | Ga0068853_100289597 | 3300005539 | Bacteria | 1512 |
| 108 | Ga0068853_100296514 | 3300005539 | Bacteria | 1493 |
| 109 | Ga0068853_100313542 | 3300005539 | Bacteria | 1453 |
| 110 | Ga0068853_100647209 | 3300005539 | Bacteria | 1006 |
| 111 | Ga0070672_100005202 | 3300005543 | Bacteria | 8607 |
| 112 | Ga0070672_100008264 | 3300005543 | Bacteria | 7113 |
| 113 | Ga0070672_100085732 | 3300005543 | Bacteria | 2532 |
| 114 | Ga0070672_100195370 | 3300005543 | Bacteria | 1691 |
| 115 | Ga0070686_100041453 | 3300005544 | Bacteria | 2878 |
| 116 | Ga0070693_100255075 | 3300005547 | Bacteria | 1164 |
| 117 | Ga0070693_100714743 | 3300005547 | Unclassified | 735 |
| 118 | Ga0070665_100000014 | 3300005548 | Bacteria | 484881 |
| 119 | Ga0070665_100056759 | 3300005548 | Bacteria | 3926 |
| 120 | Ga0070665_100381189 | 3300005548 | Bacteria | 1417 |
| 121 | Ga0070665_100410328 | 3300005548 | Bacteria | 1363 |
| 122 | Ga0070665_100548896 | 3300005548 | Bacteria | 1168 |
| 123 | Ga0068855_100001990 | 3300005563 | Bacteria | 25375 |
| 124 | Ga0068855_100073045 | 3300005563 | Bacteria | 3986 |
| 125 | Ga0068855_100127618 | 3300005563 | Bacteria | 2907 |
| 126 | Ga0068855_100220498 | 3300005563 | Bacteria | 2127 |
| 127 | Ga0068855_100396567 | 3300005563 | Bacteria | 1513 |
| 128 | Ga0068855_101245394 | 3300005563 | Bacteria | 772 |
| 129 | Ga0070664_100002665 | 3300005564 | Bacteria | 14400 |
| 130 | Ga0070664_100341116 | 3300005564 | Bacteria | 1361 |
| 131 | Ga0070664_100840199 | 3300005564 | Bacteria | 860 |
| 132 | Ga0068857_100002147 | 3300005577 | Bacteria | 16027 |
| 133 | Ga0068857_100021713 | 3300005577 | Bacteria | 5648 |
| 134 | Ga0068857_100100927 | 3300005577 | Bacteria | 2589 |
| 135 | Ga0068857_100104372 | 3300005577 | Bacteria | 2544 |
| 136 | Ga0068857_100255575 | 3300005577 | Unclassified | 1607 |
| 137 | Ga0068857_100430041 | 3300005577 | Bacteria | 1232 |
| 138 | Ga0068854_100023210 | 3300005578 | Bacteria | 4235 |
| 139 | Ga0068854_100047100 | 3300005578 | Bacteria | 3072 |
| 140 | Ga0068854_100134265 | 3300005578 | Bacteria | 1893 |
| 141 | Ga0068854_100268281 | 3300005578 | Bacteria | 1369 |
| 142 | Ga0068854_100462433 | 3300005578 | Bacteria | 1062 |
| 143 | Ga0068856_100028452 | 3300005614 | Bacteria | 5458 |
| 144 | Ga0068856_100042327 | 3300005614 | Bacteria | 4480 |
| 145 | Ga0068856_100056543 | 3300005614 | Bacteria | 3871 |
| 146 | Ga0068852_100012296 | 3300005616 | Bacteria | 6492 |
| 147 | Ga0068852_100031270 | 3300005616 | Bacteria | 4391 |
| 148 | Ga0068852_100045007 | 3300005616 | Bacteria | 3752 |
| 149 | Ga0068852_100102778 | 3300005616 | Bacteria | 2583 |
| 150 | Ga0068852_100131504 | 3300005616 | Bacteria | 2305 |
| 151 | Ga0068852_100163276 | 3300005616 | Bacteria | 2081 |
| 152 | Ga0068852_100294580 | 3300005616 | Bacteria | 1569 |
| 153 | Ga0068859_100002273 | 3300005617 | Bacteria | 19500 |
| 154 | Ga0068859_100032409 | 3300005617 | Bacteria | 5250 |
| 155 | Ga0068859_100072081 | 3300005617 | Bacteria | 3490 |
| 156 | Ga0068859_100092631 | 3300005617 | Bacteria | 3073 |
| 157 | Ga0068859_100097017 | 3300005617 | Bacteria | 3000 |
| 158 | Ga0068864_100046417 | 3300005618 | Bacteria | 3727 |
| 159 | Ga0068864_100135996 | 3300005618 | Bacteria | 2213 |
| 160 | Ga0068864_100356178 | 3300005618 | Viruses | 1382 |
| 161 | Ga0068864_101117914 | 3300005618 | Bacteria | 785 |
| 162 | Ga0068861_100009713 | 3300005719 | Bacteria | 6652 |
| 163 | Ga0068861_100092367 | 3300005719 | Bacteria | 2391 |
| 164 | Ga0068861_100386590 | 3300005719 | Unclassified | 1238 |
| 165 | Ga0068861_100631836 | 3300005719 | Bacteria | 987 |
| 166 | Ga0068851_10004181 | 3300005834 | Bacteria | 6503 |
| 167 | Ga0068870_10156742 | 3300005840 | Bacteria | 1346 |
| 168 | Ga0068863_100005185 | 3300005841 | Bacteria | 12851 |
| 169 | Ga0068863_100129113 | 3300005841 | Bacteria | 2413 |
| 170 | Ga0068863_100302435 | 3300005841 | Bacteria | 1552 |
| 171 | Ga0068863_100316193 | 3300005841 | Unclassified | 1516 |
| 172 | Ga0068863_100714170 | 3300005841 | Bacteria | 997 |
| 173 | Ga0068863_101198808 | 3300005841 | Bacteria | 765 |
| 174 | Ga0068858_100002187 | 3300005842 | Bacteria | 19799 |
| 175 | Ga0068858_100309167 | 3300005842 | Bacteria | 1509 |
| 176 | Ga0068860_100000024 | 3300005843 | Bacteria | 271902 |
| 177 | Ga0068860_100000691 | 3300005843 | Bacteria | 38802 |
| 178 | Ga0068860_100010899 | 3300005843 | Bacteria | 8965 |
| 179 | Ga0068860_100104673 | 3300005843 | Bacteria | 2702 |
| 180 | Ga0068860_100429764 | 3300005843 | Bacteria | 1310 |
| 181 | Ga0068862_100452765 | 3300005844 | Bacteria | 1210 |
| 182 | Ga0081540_1013840 | 3300005983 | Bacteria | 5217 |
| 183 | Ga0081539_10047752 | 3300005985 | Bacteria | 2441 |
| 184 | Ga0070715_10094422 | 3300006163 | Bacteria | 1383 |
| 185 | Ga0075366_10008625 | 3300006195 | Bacteria | 5675 |
| 186 | Ga0075366_10012354 | 3300006195 | Bacteria | 4842 |
| 187 | Ga0097621_100005475 | 3300006237 | Bacteria | 8938 |
| 188 | Ga0097621_100018519 | 3300006237 | Bacteria | 5323 |
| 189 | Ga0097621_100056807 | 3300006237 | Bacteria | 3198 |
| 190 | Ga0097621_100210073 | 3300006237 | Bacteria | 1693 |
| 191 | Ga0097621_100219087 | 3300006237 | Bacteria | 1658 |
| 192 | Ga0097621_100259485 | 3300006237 | Bacteria | 1524 |
| 193 | Ga0097621_101159982 | 3300006237 | Bacteria | 727 |
| 194 | Ga0068871_100022329 | 3300006358 | Bacteria | 4878 |
| 195 | Ga0068871_100053443 | 3300006358 | Bacteria | 3274 |
| 196 | Ga0068871_100167943 | 3300006358 | Bacteria | 1879 |
| 197 | Ga0068871_100224705 | 3300006358 | Bacteria | 1628 |
| 198 | Ga0068871_100412353 | 3300006358 | Bacteria | 1205 |
| 199 | Ga0075434_100044282 | 3300006871 | Bacteria | 4415 |
| 200 | Ga0068865_100006196 | 3300006881 | Bacteria | 7291 |
| 201 | Ga0068865_100034522 | 3300006881 | Bacteria | 3394 |
| 202 | Ga0068865_100053771 | 3300006881 | Bacteria | 2795 |
| 203 | Ga0068865_100349662 | 3300006881 | Bacteria | 1197 |
| 204 | Ga0068865_100483463 | 3300006881 | Bacteria | 1029 |
| 205 | Ga0075436_100413795 | 3300006914 | Bacteria | 978 |
| 206 | Ga0097620_100002273 | 3300006931 | Bacteria | 19500 |
| 207 | Ga0097620_100032409 | 3300006931 | Bacteria | 5250 |
| 208 | Ga0097620_100072079 | 3300006931 | Bacteria | 3490 |
| 209 | Ga0097620_100092635 | 3300006931 | Bacteria | 3073 |
| 210 | Ga0097620_100097017 | 3300006931 | Bacteria | 3000 |
| 211 | Ga0097620_100534384 | 3300006931 | Bacteria | 1267 |
| 212 | Ga0105240_10000106 | 3300009093 | Bacteria | 171825 |
| 213 | Ga0105240_10002904 | 3300009093 | Bacteria | 27043 |
| 214 | Ga0105240_10006529 | 3300009093 | Bacteria | 17125 |
| 215 | Ga0105240_10022621 | 3300009093 | Bacteria | 8327 |
| 216 | Ga0105240_10042604 | 3300009093 | Bacteria | 5784 |
| 217 | Ga0105240_10133685 | 3300009093 | Bacteria | 2972 |
| 218 | Ga0105240_10396227 | 3300009093 | Bacteria | 1556 |
| 219 | Ga0111539_10071473 | 3300009094 | Bacteria | 4094 |
| 220 | Ga0105245_10063131 | 3300009098 | Bacteria | 3344 |
| 221 | Ga0105245_10233630 | 3300009098 | Bacteria | 1779 |
| 222 | Ga0105247_10002404 | 3300009101 | Bacteria | 12733 |
| 223 | Ga0105247_10121504 | 3300009101 | Bacteria | 1693 |
| 224 | Ga0105247_10538032 | 3300009101 | Bacteria | 857 |
| 225 | Ga0105241_10001117 | 3300009174 | Bacteria | 20448 |
| 226 | Ga0105241_10042451 | 3300009174 | Bacteria | 3441 |
| 227 | Ga0105241_10062358 | 3300009174 | Bacteria | 2874 |
| 228 | Ga0105241_10093641 | 3300009174 | Bacteria | 2374 |
| 229 | Ga0105242_10012927 | 3300009176 | Bacteria | 6435 |
| 230 | Ga0105242_10320433 | 3300009176 | Bacteria | 1421 |
| 231 | Ga0105242_10647460 | 3300009176 | Unclassified | 1027 |
| 232 | Ga0105248_10084854 | 3300009177 | Bacteria | 3563 |
| 233 | Ga0105248_10837533 | 3300009177 | Bacteria | 1038 |
| 234 | Ga0105237_10000561 | 3300009545 | Bacteria | 51951 |
| 235 | Ga0105237_10005940 | 3300009545 | Bacteria | 13687 |
| 236 | Ga0105237_10014958 | 3300009545 | Bacteria | 8089 |
| 237 | Ga0105237_10018678 | 3300009545 | Bacteria | 7168 |
| 238 | Ga0105238_10001211 | 3300009551 | Bacteria | 25984 |
| 239 | Ga0105238_10017549 | 3300009551 | Bacteria | 7278 |
| 240 | Ga0105238_10089770 | 3300009551 | Bacteria | 3060 |
| 241 | Ga0105238_10131358 | 3300009551 | Bacteria | 2482 |
| 242 | Ga0105249_10005427 | 3300009553 | Bacteria | 11006 |
| 243 | Ga0105249_10048728 | 3300009553 | Bacteria | 3862 |
| 244 | Ga0105249_10112821 | 3300009553 | Bacteria | 2571 |
| 245 | Ga0105249_10116464 | 3300009553 | Bacteria | 2533 |
| 246 | Ga0105249_10124897 | 3300009553 | Bacteria | 2449 |
| 247 | Ga0105249_10318984 | 3300009553 | Bacteria | 1565 |
| 248 | Ga0105249_10409303 | 3300009553 | Bacteria | 1388 |
| 249 | Ga0105239_10000580 | 3300010375 | Bacteria | 52245 |
| 250 | Ga0105239_10003763 | 3300010375 | Bacteria | 18449 |
| 251 | Ga0105239_10007405 | 3300010375 | Bacteria | 12592 |
| 252 | Ga0105239_10009676 | 3300010375 | Bacteria | 10839 |
| 253 | Ga0105239_10015390 | 3300010375 | Bacteria | 8475 |
| 254 | Ga0105239_10030051 | 3300010375 | Bacteria | 5975 |
| 255 | Ga0105239_10211340 | 3300010375 | Bacteria | 2175 |
| 256 | Ga0105239_10353094 | 3300010375 | Bacteria | 1660 |
| 257 | Ga0105239_10604079 | 3300010375 | Bacteria | 1251 |
| 258 | Ga0105239_10661080 | 3300010375 | Bacteria | 1194 |
| 259 | Ga0105239_10662127 | 3300010375 | Bacteria | 1193 |
| 260 | Ga0105239_11301017 | 3300010375 | Bacteria | 839 |
| 261 | Ga0105246_10001264 | 3300011119 | Bacteria | 14839 |
| 262 | Ga0105246_10143669 | 3300011119 | Bacteria | 1798 |
| 263 | Ga0105246_10969391 | 3300011119 | Bacteria | 768 |
| 264 | Ga0157373_10068009 | 3300013100 | Bacteria | 2519 |
| 265 | Ga0157373_10184227 | 3300013100 | Bacteria | 1471 |
| 266 | Ga0157373_10835971 | 3300013100 | Bacteria | 680 |
| 267 | Ga0157371_10421205 | 3300013102 | Unclassified | 979 |
| 268 | Ga0157370_10004229 | 3300013104 | Bacteria | 16610 |
| 269 | Ga0157370_10026848 | 3300013104 | Bacteria | 5680 |
| 270 | Ga0157369_10288022 | 3300013105 | Bacteria | 1710 |
| 271 | Ga0157369_10319984 | 3300013105 | Bacteria | 1613 |
| 272 | Ga0157369_11300717 | 3300013105 | Bacteria | 741 |
| 273 | Ga0157374_10000011 | 3300013296 | Bacteria | 466749 |
| 274 | Ga0157374_10038728 | 3300013296 | Unclassified | 4383 |
| 275 | Ga0157374_10058869 | 3300013296 | Bacteria | 3590 |
| 276 | Ga0157374_10119566 | 3300013296 | Bacteria | 2541 |
| 277 | Ga0157374_10135901 | 3300013296 | Bacteria | 2383 |
| 278 | Ga0157378_10006519 | 3300013297 | Bacteria | 10203 |
| 279 | Ga0157378_10021695 | 3300013297 | Bacteria | 5646 |
| 280 | Ga0157378_10036639 | 3300013297 | Bacteria | 4341 |
| 281 | Ga0157378_10434717 | 3300013297 | Unclassified | 1299 |
| 282 | Ga0157378_10703313 | 3300013297 | Bacteria | 1030 |
| 283 | Ga0163162_10001367 | 3300013306 | Bacteria | 22697 |
| 284 | Ga0163162_10001786 | 3300013306 | Bacteria | 20177 |
| 285 | Ga0163162_10002933 | 3300013306 | Bacteria | 16276 |
| 286 | Ga0163162_10023782 | 3300013306 | Bacteria | 6047 |
| 287 | Ga0163162_10048969 | 3300013306 | Bacteria | 4235 |
| 288 | Ga0163162_10078768 | 3300013306 | Bacteria | 3361 |
| 289 | Ga0163162_10165389 | 3300013306 | Unclassified | 2335 |
| 290 | Ga0163162_10199989 | 3300013306 | Bacteria | 2127 |
| 291 | Ga0163162_10242383 | 3300013306 | Bacteria | 1934 |
| 292 | Ga0163162_10242469 | 3300013306 | Bacteria | 1933 |
| 293 | Ga0163162_10279101 | 3300013306 | Bacteria | 1803 |
| 294 | Ga0163162_10785843 | 3300013306 | Bacteria | 1070 |
| 295 | Ga0157372_10000171 | 3300013307 | Bacteria | 71956 |
| 296 | Ga0157372_10000463 | 3300013307 | Bacteria | 44664 |
| 297 | Ga0157372_10181378 | 3300013307 | Bacteria | 2437 |
| 298 | Ga0157372_10322297 | 3300013307 | Bacteria | 1799 |
| 299 | Ga0157372_10403572 | 3300013307 | Bacteria | 1593 |
| 300 | Ga0157372_10630786 | 3300013307 | Unclassified | 1249 |
| 301 | Ga0157375_10009867 | 3300013308 | Bacteria | 8397 |
| 302 | Ga0157375_10055142 | 3300013308 | Bacteria | 3918 |
| 303 | Ga0157375_10085503 | 3300013308 | Bacteria | 3204 |
| 304 | Ga0157375_10121739 | 3300013308 | Bacteria | 2719 |
| 305 | Ga0157375_10257203 | 3300013308 | Bacteria | 1907 |
| 306 | Ga0157375_10328462 | 3300013308 | Bacteria | 1694 |
| 307 | Ga0157375_10470675 | 3300013308 | Bacteria | 1422 |
| 308 | Ga0157375_10814121 | 3300013308 | Bacteria | 1082 |
| 309 | Ga0163163_10001998 | 3300014325 | Bacteria | 17228 |
| 310 | Ga0163163_10005703 | 3300014325 | Bacteria | 10797 |
| 311 | Ga0163163_10089414 | 3300014325 | Bacteria | 3091 |
| 312 | Ga0163163_10254464 | 3300014325 | Viruses | 1807 |
| 313 | Ga0163163_10553015 | 3300014325 | Bacteria | 1213 |
| 314 | Ga0163163_10645329 | 3300014325 | Bacteria | 1122 |
| 315 | Ga0157380_10122130 | 3300014326 | Bacteria | 2208 |
| 316 | Ga0157380_10350484 | 3300014326 | Bacteria | 1381 |
| 317 | Ga0157380_10667978 | 3300014326 | Bacteria | 1039 |
| 318 | Ga0157380_10780370 | 3300014326 | Unclassified | 970 |
| 319 | Ga0157380_11040956 | 3300014326 | Bacteria | 854 |
| 320 | Ga0157377_10010026 | 3300014745 | Bacteria | 4674 |
| 321 | Ga0157379_10010876 | 3300014968 | Bacteria | 7931 |
| 322 | Ga0157379_10018539 | 3300014968 | Bacteria | 6140 |
| 323 | Ga0157379_10304355 | 3300014968 | Bacteria | 1453 |
| 324 | Ga0157379_10430730 | 3300014968 | Bacteria | 1216 |
| 325 | Ga0157379_10643729 | 3300014968 | Bacteria | 992 |
| 326 | Ga0157379_10884674 | 3300014968 | Bacteria | 847 |
| 327 | Ga0157376_10013842 | 3300014969 | Bacteria | 6032 |
| 328 | Ga0157376_10023416 | 3300014969 | Bacteria | 4832 |
| 329 | Ga0157376_10026592 | 3300014969 | Bacteria | 4575 |
| 330 | Ga0157376_10150053 | 3300014969 | Bacteria | 2101 |
| 331 | Ga0157376_10240327 | 3300014969 | Bacteria | 1687 |
| 332 | Ga0157376_10265119 | 3300014969 | Bacteria | 1611 |
| 333 | Ga0157376_10494472 | 3300014969 | Bacteria | 1201 |
| 334 | Ga0157376_11315761 | 3300014969 | Unclassified | 753 |
| 335 | Ga0157376_11355907 | 3300014969 | Unclassified | 742 |
| 336 | Ga0163161_10008435 | 3300017792 | Bacteria | 7134 |
| 337 | Ga0163161_10024623 | 3300017792 | Bacteria | 4253 |
| 338 | Ga0163161_10070335 | 3300017792 | Bacteria | 2559 |
| 339 | Ga0163161_10142880 | 3300017792 | Bacteria | 1813 |
| 340 | Ga0207697_10226660 | 3300025315 | Bacteria | 825 |
| 341 | Ga0207656_10006384 | 3300025321 | Bacteria | 4232 |
| 342 | Ga0207642_10004323 | 3300025899 | Bacteria | 4579 |
| 343 | Ga0207642_10160687 | 3300025899 | Unclassified | 1206 |
| 344 | Ga0207710_10001781 | 3300025900 | Bacteria | 10400 |
| 345 | Ga0207688_10003300 | 3300025901 | Bacteria | 8816 |
| 346 | Ga0207688_10058259 | 3300025901 | Unclassified | 2173 |
| 347 | Ga0207680_10007538 | 3300025903 | Bacteria | 5315 |
| 348 | Ga0207680_10047349 | 3300025903 | Bacteria | 2547 |
| 349 | Ga0207680_10079798 | 3300025903 | Bacteria | 2053 |
| 350 | Ga0207680_10084183 | 3300025903 | Bacteria | 2006 |
| 351 | Ga0207680_10234927 | 3300025903 | Bacteria | 1261 |
| 352 | Ga0207647_10004599 | 3300025904 | Bacteria | 10219 |
| 353 | Ga0207647_10025873 | 3300025904 | Bacteria | 3847 |
| 354 | Ga0207647_10107014 | 3300025904 | Bacteria | 1655 |
| 355 | Ga0207685_10082641 | 3300025905 | Unclassified | 1333 |
| 356 | Ga0207645_10003291 | 3300025907 | Bacteria | 12324 |
| 357 | Ga0207645_10005892 | 3300025907 | Bacteria | 8831 |
| 358 | Ga0207645_10223630 | 3300025907 | Bacteria | 1241 |
| 359 | Ga0207643_10129266 | 3300025908 | Bacteria | 1502 |
| 360 | Ga0207705_10045085 | 3300025909 | Bacteria | 3169 |
| 361 | Ga0207654_10000620 | 3300025911 | Bacteria | 20025 |
| 362 | Ga0207654_10024091 | 3300025911 | Bacteria | 3268 |
| 363 | Ga0207654_10026063 | 3300025911 | Bacteria | 3162 |
| 364 | Ga0207707_10214341 | 3300025912 | Bacteria | 1677 |
| 365 | Ga0207695_10000087 | 3300025913 | Bacteria | 276412 |
| 366 | Ga0207695_10000582 | 3300025913 | Bacteria | 74405 |
| 367 | Ga0207695_10001064 | 3300025913 | Bacteria | 48020 |
| 368 | Ga0207695_10003167 | 3300025913 | Bacteria | 23458 |
| 369 | Ga0207695_10018118 | 3300025913 | Bacteria | 8149 |
| 370 | Ga0207695_10036339 | 3300025913 | Bacteria | 5327 |
| 371 | Ga0207695_10037729 | 3300025913 | Bacteria | 5212 |
| 372 | Ga0207695_10203184 | 3300025913 | Bacteria | 1895 |
| 373 | Ga0207671_10002275 | 3300025914 | Bacteria | 20777 |
| 374 | Ga0207671_10002324 | 3300025914 | Bacteria | 20513 |
| 375 | Ga0207671_10002511 | 3300025914 | Bacteria | 19577 |
| 376 | Ga0207671_10008910 | 3300025914 | Bacteria | 8449 |
| 377 | Ga0207662_10023616 | 3300025918 | Bacteria | 3534 |
| 378 | Ga0207649_10068425 | 3300025920 | Bacteria | 2257 |
| 379 | Ga0207649_10942154 | 3300025920 | Bacteria | 678 |
| 380 | Ga0207694_10005398 | 3300025924 | Bacteria | 9836 |
| 381 | Ga0207694_10040792 | 3300025924 | Bacteria | 3576 |
| 382 | Ga0207694_10177014 | 3300025924 | Bacteria | 1728 |
| 383 | Ga0207694_10187485 | 3300025924 | Bacteria | 1679 |
| 384 | Ga0207659_10015767 | 3300025926 | Bacteria | 4906 |
| 385 | Ga0207659_10060935 | 3300025926 | Unclassified | 2718 |
| 386 | Ga0207659_10980117 | 3300025926 | Bacteria | 727 |
| 387 | Ga0207687_10039213 | 3300025927 | Bacteria | 3242 |
| 388 | Ga0207690_10313283 | 3300025932 | Bacteria | 1231 |
| 389 | Ga0207706_10003305 | 3300025933 | Bacteria | 15441 |
| 390 | Ga0207706_10004710 | 3300025933 | Bacteria | 12777 |
| 391 | Ga0207706_10015998 | 3300025933 | Bacteria | 6778 |
| 392 | Ga0207706_10054002 | 3300025933 | Bacteria | 3546 |
| 393 | Ga0207706_10404618 | 3300025933 | Unclassified | 1183 |
| 394 | Ga0207686_10029678 | 3300025934 | Bacteria | 3229 |
| 395 | Ga0207686_10090156 | 3300025934 | Unclassified | 2022 |
| 396 | Ga0207670_10016254 | 3300025936 | Bacteria | 4467 |
| 397 | Ga0207670_10076046 | 3300025936 | Bacteria | 2336 |
| 398 | Ga0207669_10037332 | 3300025937 | Bacteria | 2786 |
| 399 | Ga0207669_10065043 | 3300025937 | Bacteria | 2260 |
| 400 | Ga0207669_10069562 | 3300025937 | Unclassified | 2203 |
| 401 | Ga0207704_10025253 | 3300025938 | Bacteria | 3238 |
| 402 | Ga0207704_10038307 | 3300025938 | Bacteria | 2779 |
| 403 | Ga0207704_10091562 | 3300025938 | Bacteria | 1999 |
| 404 | Ga0207691_10001280 | 3300025940 | Bacteria | 25134 |
| 405 | Ga0207691_10020036 | 3300025940 | Bacteria | 6327 |
| 406 | Ga0207691_10031370 | 3300025940 | Bacteria | 4960 |
| 407 | Ga0207691_10039933 | 3300025940 | Bacteria | 4340 |
| 408 | Ga0207691_10542377 | 3300025940 | Unclassified | 986 |
| 409 | Ga0207689_10001049 | 3300025942 | Bacteria | 26546 |
| 410 | Ga0207689_10010413 | 3300025942 | Bacteria | 8005 |
| 411 | Ga0207689_10012954 | 3300025942 | Bacteria | 7122 |
| 412 | Ga0207689_10022449 | 3300025942 | Bacteria | 5307 |
| 413 | Ga0207689_10023916 | 3300025942 | Bacteria | 5125 |
| 414 | Ga0207689_10067436 | 3300025942 | Bacteria | 2941 |
| 415 | Ga0207689_10077907 | 3300025942 | Bacteria | 2724 |
| 416 | Ga0207689_10179033 | 3300025942 | Unclassified | 1748 |
| 417 | Ga0207689_10285414 | 3300025942 | Bacteria | 1367 |
| 418 | Ga0207689_10475385 | 3300025942 | Bacteria | 1046 |
| 419 | Ga0207689_10497951 | 3300025942 | Unclassified | 1021 |
| 420 | Ga0207661_10015192 | 3300025944 | Bacteria | 5661 |
| 421 | Ga0207661_10053129 | 3300025944 | Bacteria | 3240 |
| 422 | Ga0207661_10072945 | 3300025944 | Bacteria | 2810 |
| 423 | Ga0207661_10466835 | 3300025944 | Bacteria | 1151 |
| 424 | Ga0207661_10649239 | 3300025944 | Unclassified | 970 |
| 425 | Ga0207679_10001622 | 3300025945 | Bacteria | 14023 |
| 426 | Ga0207679_10043404 | 3300025945 | Bacteria | 3237 |
| 427 | Ga0207679_10070163 | 3300025945 | Bacteria | 2640 |
| 428 | Ga0207679_10432389 | 3300025945 | Bacteria | 1164 |
| 429 | Ga0207667_10000584 | 3300025949 | Bacteria | 47412 |
| 430 | Ga0207667_10001242 | 3300025949 | Bacteria | 31953 |
| 431 | Ga0207667_10016385 | 3300025949 | Bacteria | 8378 |
| 432 | Ga0207667_10020034 | 3300025949 | Bacteria | 7449 |
| 433 | Ga0207667_10178887 | 3300025949 | Bacteria | 2179 |
| 434 | Ga0207667_10232600 | 3300025949 | Bacteria | 1887 |
| 435 | Ga0207667_10834000 | 3300025949 | Unclassified | 917 |
| 436 | Ga0207651_10003648 | 3300025960 | Bacteria | 7594 |
| 437 | Ga0207651_10023738 | 3300025960 | Bacteria | 3780 |
| 438 | Ga0207651_10047510 | 3300025960 | Bacteria | 2895 |
| 439 | Ga0207651_10107640 | 3300025960 | Bacteria | 2084 |
| 440 | Ga0207712_10002942 | 3300025961 | Bacteria | 10882 |
| 441 | Ga0207712_10047061 | 3300025961 | Bacteria | 2993 |
| 442 | Ga0207712_10329655 | 3300025961 | Unclassified | 1262 |
| 443 | Ga0207668_10000514 | 3300025972 | Bacteria | 24251 |
| 444 | Ga0207668_10048032 | 3300025972 | Bacteria | 2926 |
| 445 | Ga0207668_10173375 | 3300025972 | Bacteria | 1694 |
| 446 | Ga0207668_10240264 | 3300025972 | Bacteria | 1465 |
| 447 | Ga0207640_10022459 | 3300025981 | Bacteria | 3776 |
| 448 | Ga0207640_10108873 | 3300025981 | Bacteria | 1959 |
| 449 | Ga0207640_10220798 | 3300025981 | Bacteria | 1451 |
| 450 | Ga0207640_10317530 | 3300025981 | Bacteria | 1239 |
| 451 | Ga0207658_10004126 | 3300025986 | Bacteria | 10133 |
| 452 | Ga0207658_10068969 | 3300025986 | Bacteria | 2670 |
| 453 | Ga0207658_10121304 | 3300025986 | Bacteria | 2085 |
| 454 | Ga0207658_10529642 | 3300025986 | Unclassified | 1052 |
| 455 | Ga0207658_10583704 | 3300025986 | Bacteria | 1003 |
| 456 | Ga0207658_10591604 | 3300025986 | Bacteria | 996 |
| 457 | Ga0207677_10002620 | 3300026023 | Bacteria | 9469 |
| 458 | Ga0207677_10014804 | 3300026023 | Bacteria | 4568 |
| 459 | Ga0207677_10044906 | 3300026023 | Bacteria | 2947 |
| 460 | Ga0207703_10006377 | 3300026035 | Bacteria | 9427 |
| 461 | Ga0207703_10547498 | 3300026035 | Unclassified | 1091 |
| 462 | Ga0207703_11347763 | 3300026035 | Unclassified | 686 |
| 463 | Ga0207639_10025183 | 3300026041 | Bacteria | 4314 |
| 464 | Ga0207639_10034764 | 3300026041 | Bacteria | 3727 |
| 465 | Ga0207639_10132463 | 3300026041 | Bacteria | 2066 |
| 466 | Ga0207639_10158522 | 3300026041 | Bacteria | 1904 |
| 467 | Ga0207639_10237680 | 3300026041 | Bacteria | 1582 |
| 468 | Ga0207639_10270654 | 3300026041 | Bacteria | 1490 |
| 469 | Ga0207678_10048119 | 3300026067 | Bacteria | 3686 |
| 470 | Ga0207708_10516618 | 3300026075 | Unclassified | 1003 |
| 471 | Ga0207702_10038731 | 3300026078 | Bacteria | 3993 |
| 472 | Ga0207702_10050648 | 3300026078 | Bacteria | 3506 |
| 473 | Ga0207702_10084238 | 3300026078 | Bacteria | 2768 |
| 474 | Ga0207702_10100657 | 3300026078 | Bacteria | 2550 |
| 475 | Ga0207641_10006788 | 3300026088 | Bacteria | 9591 |
| 476 | Ga0207641_10100939 | 3300026088 | Unclassified | 2542 |
| 477 | Ga0207641_10115135 | 3300026088 | Bacteria | 2390 |
| 478 | Ga0207641_10292124 | 3300026088 | Bacteria | 1537 |
| 479 | Ga0207648_10001955 | 3300026089 | Bacteria | 22528 |
| 480 | Ga0207648_10005292 | 3300026089 | Bacteria | 13021 |
| 481 | Ga0207648_10006356 | 3300026089 | Bacteria | 11747 |
| 482 | Ga0207648_10024957 | 3300026089 | Bacteria | 5328 |
| 483 | Ga0207648_10092461 | 3300026089 | Unclassified | 2645 |
| 484 | Ga0207648_10206548 | 3300026089 | Bacteria | 1743 |
| 485 | Ga0207676_10006594 | 3300026095 | Bacteria | 8212 |
| 486 | Ga0207676_10909651 | 3300026095 | Bacteria | 863 |
| 487 | Ga0207674_10000453 | 3300026116 | Bacteria | 53589 |
| 488 | Ga0207674_10037607 | 3300026116 | Bacteria | 5032 |
| 489 | Ga0207674_10385921 | 3300026116 | Bacteria | 1354 |
| 490 | Ga0207674_10432229 | 3300026116 | Bacteria | 1272 |
| 491 | Ga0207674_10530736 | 3300026116 | Bacteria | 1137 |
| 492 | Ga0207674_11030910 | 3300026116 | Bacteria | 792 |
| 493 | Ga0207675_100009475 | 3300026118 | Bacteria | 9115 |
| 494 | Ga0207675_100019228 | 3300026118 | Bacteria | 6373 |
| 495 | Ga0207675_100426292 | 3300026118 | Bacteria | 1311 |
| 496 | Ga0207675_100447412 | 3300026118 | Bacteria | 1280 |
| 497 | Ga0207675_100954772 | 3300026118 | Bacteria | 875 |
| 498 | Ga0207683_10000957 | 3300026121 | Bacteria | 26469 |
| 499 | Ga0207683_10003845 | 3300026121 | Bacteria | 13020 |
| 500 | Ga0207698_10018924 | 3300026142 | Bacteria | 4703 |
| 501 | Ga0207698_10022200 | 3300026142 | Bacteria | 4405 |
| 502 | Ga0207698_10094545 | 3300026142 | Unclassified | 2458 |
| 503 | Ga0207698_10101490 | 3300026142 | Bacteria | 2386 |
| 504 | Ga0207698_10442344 | 3300026142 | Bacteria | 1253 |
| 505 | Ga0207698_10583537 | 3300026142 | Bacteria | 1100 |
| 506 | Ga0207698_10687034 | 3300026142 | Bacteria | 1017 |
| 507 | Ga0268266_10000048 | 3300028379 | Bacteria | 310336 |
| 508 | Ga0268266_10006796 | 3300028379 | Bacteria | 10422 |
| 509 | Ga0268266_10022104 | 3300028379 | Bacteria | 5422 |
| 510 | Ga0268266_10146482 | 3300028379 | Bacteria | 2124 |
| 511 | Ga0268265_10432795 | 3300028380 | Bacteria | 1224 |
| 512 | Ga0268265_10583094 | 3300028380 | Bacteria | 1066 |
| 513 | Ga0268264_10000028 | 3300028381 | Bacteria | 426662 |
| 514 | Ga0268264_10010248 | 3300028381 | Bacteria | 7759 |
| 515 | Ga0268264_10014008 | 3300028381 | Bacteria | 6593 |
| 516 | Ga0268264_10291970 | 3300028381 | Unclassified | 1532 |
| 517 | Ga0268264_11199342 | 3300028381 | Bacteria | 768 |
| 518 | Ga0268264_11493738 | 3300028381 | Unclassified | 686 |
| 519 | Ga0307517_10000268 | 3300028786 | Bacteria | 89531 |
| 520 | Ga0307511_10000076 | 3300030521 | Bacteria | 82520 |
| 521 | Ga0265340_10036934 | 3300031247 | Bacteria | 2420 |
| 522 | Ga0265327_10018351 | 3300031251 | Bacteria | 4342 |
| 523 | Ga0307509_10404052 | 3300031507 | Bacteria | 1072 |
| 524 | Ga0307408_100448363 | 3300031548 | Bacteria | 1119 |
| 525 | Ga0265313_10066817 | 3300031595 | Bacteria | 1665 |
| 526 | Ga0307516_10000159 | 3300031730 | Bacteria | 84553 |
| 527 | Ga0307516_10273191 | 3300031730 | Bacteria | 1375 |
| 528 | Ga0307405_10628317 | 3300031731 | Bacteria | 880 |
| 529 | Ga0307405_11073395 | 3300031731 | Bacteria | 691 |
| 530 | Ga0307410_10568053 | 3300031852 | Bacteria | 942 |
| 531 | Ga0307406_10264003 | 3300031901 | Bacteria | 1304 |
| 532 | Ga0307416_100281525 | 3300032002 | Bacteria | 1640 |
| 533 | Ga0307416_100698974 | 3300032002 | Bacteria | 1103 |
| 534 | Ga0307414_10126860 | 3300032004 | Bacteria | 1973 |
| 535 | Ga0307414_10226041 | 3300032004 | Bacteria | 1540 |
| 536 | Ga0307415_100385683 | 3300032126 | Bacteria | 1191 |
| 537 | Ga0307510_10005955 | 3300033180 | Bacteria | 14550 |
| 538 | Ga0373939_0508008 | 3300035114 | Bacteria | 515 |
| 539 | Ga0373954_0447123 | 3300035118 | Bacteria | 640 |
| 540 | Ga0373946_0048655 | 3300035171 | Bacteria | 1766 |
| 541 | Ga0373924_0317785 | 3300035410 | Bacteria | 692 |
| 542 | Ga0373935_0294447 | 3300035692 | Bacteria | 1146 |
| 543 | Ga0373935_0639946 | 3300035692 | Bacteria | 779 |
| 544 | Ga0373947_0346643 | 3300035725 | Bacteria | 996 |
| 545 | Ga0373937_0019641 | 3300036401 | Bacteria | 6049 |
| 546 | Ga0373937_0021464 | 3300036401 | Bacteria | 5796 |
| 547 | Ga0373937_0096634 | 3300036401 | Bacteria | 2740 |
| 548 | Ga0439439_0045514 | 3300041406 | Bacteria | 1144 |
| 549 | Ga0451835_0055831 | 3300041492 | Bacteria | 628 |
| 550 | Ga0451847_0839165 | 3300041503 | Unclassified | 604 |
| 551 | Ga0451849_0123964 | 3300041505 | Bacteria | 824 |
| 552 | Ga0439433_0025381 | 3300041999 | Bacteria | 1338 |
| 553 | Ga0439457_008871 | 3300042014 | Bacteria | 2358 |
| 554 | Ga0451577_0186842 | 3300042876 | Bacteria | 1869 |
| 555 | Ga0466972_0000640 | 3300044658 | Bacteria | 16947 |
| 556 | Ga0466972_0111016 | 3300044658 | Bacteria | 1296 |
| 557 | Ga0453683_0121321 | 3300044673 | Bacteria | 1646 |
| 558 | Ga0466961_0167063 | 3300044693 | Bacteria | 1369 |
| 559 | Ga0466968_0006651 | 3300044735 | Bacteria | 4366 |
| 560 | Ga0466957_0229833 | 3300044842 | Bacteria | 1228 |
| 561 | Ga0466960_0127587 | 3300044901 | Bacteria | 1339 |
| 562 | Ga0466959_0001773 | 3300045049 | Bacteria | 13455 |
| 563 | Ga0495592_0140843 | 3300046454 | Unclassified | 1678 |
| 564 | Ga0495603_0228239 | 3300046455 | Bacteria | 1074 |
| 565 | Ga0495638_0031164 | 3300046460 | Bacteria | 3428 |
| 566 | Ga0495638_0075489 | 3300046460 | Bacteria | 2054 |
| 567 | Ga0495638_0226480 | 3300046460 | Bacteria | 1042 |
| 568 | Ga0495582_0039653 | 3300046473 | Bacteria | 2593 |
| 569 | Ga0495664_0326103 | 3300046477 | Bacteria | 926 |
| 570 | Ga0495606_0007339 | 3300046507 | Bacteria | 9904 |
| 571 | Ga0495608_0795222 | 3300046511 | Unclassified | 558 |
| 572 | Ga0495628_0115970 | 3300046516 | Bacteria | 2057 |
| 573 | Ga0495630_0053840 | 3300046517 | Bacteria | 3014 |
| 574 | Ga0495630_0103456 | 3300046517 | Bacteria | 2155 |
| 575 | Ga0495648_0001979 | 3300046524 | Bacteria | 19467 |
| 576 | Ga0495665_0207860 | 3300046531 | Bacteria | 1014 |
| 577 | Ga0495586_0056497 | 3300046535 | Bacteria | 2129 |
| 578 | Ga0495586_0302383 | 3300046535 | Bacteria | 917 |
| 579 | Ga0495645_0305333 | 3300046543 | Bacteria | 1038 |
| 580 | Ga0495633_0052789 | 3300046558 | Bacteria | 1914 |
| 581 | Ga0495667_0492329 | 3300046559 | Bacteria | 768 |
| 582 | Ga0495634_0038674 | 3300046642 | Bacteria | 3252 |
| 583 | Ga0495611_0001743 | 3300046648 | Bacteria | 10530 |
| 584 | Ga0495635_0670860 | 3300046663 | Bacteria | 674 |
| 585 | Ga0495657_0460042 | 3300046675 | Bacteria | 744 |
| 586 | Ga0495599_0137916 | 3300046678 | Unclassified | 1514 |
| 587 | Ga0495658_0056145 | 3300046683 | Bacteria | 2245 |
| 588 | Ga0495670_0008617 | 3300046691 | Bacteria | 5021 |
| 589 | Ga0495600_0179947 | 3300046809 | Unclassified | 1363 |
| 590 | Ga0495674_0058855 | 3300047319 | Bacteria | 3358 |
| 591 | Ga0495672_0086171 | 3300047320 | Bacteria | 1738 |
| 592 | Ga0495676_0080168 | 3300047321 | Bacteria | 2480 |
| 593 | Ga0495687_002362 | 3300047443 | Bacteria | 15287 |
| 594 | Ga0495684_0100619 | 3300047471 | Unclassified | 2186 |
| 595 | Ga0495684_0310765 | 3300047471 | Bacteria | 1130 |
| 596 | Ga0495684_0363307 | 3300047471 | Bacteria | 1025 |
| 597 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 598 | Ga0496100_0908163 | 3300048903 | Bacteria | 692 |
| 599 | Ga0496104_0590565 | 3300048907 | Bacteria | 1021 |
| 600 | Ga0496110_1260090 | 3300048913 | Unclassified | 648 |
| 601 | Ga0496113_0389219 | 3300048916 | Bacteria | 1119 |
| 602 | Ga0496114_0273822 | 3300048917 | Bacteria | 1488 |
| 603 | Ga0501032_0004878 | 3300049569 | Bacteria | 10041 |
| 604 | Ga0501034_0070687 | 3300049571 | Bacteria | 3501 |
| 605 | Ga0501034_0355495 | 3300049571 | Bacteria | 1392 |
| 606 | Ga0501036_0030098 | 3300049572 | Bacteria | 4586 |
| 607 | Ga0501036_0039650 | 3300049572 | Bacteria | 3985 |
| 608 | Ga0501037_0004952 | 3300049573 | Bacteria | 9685 |
| 609 | Ga0501037_0059666 | 3300049573 | Bacteria | 2782 |
| 610 | Ga0501038_0002256 | 3300049574 | Bacteria | 17927 |
| 611 | Ga0501038_0003120 | 3300049574 | Bacteria | 15461 |
| 612 | Ga0501039_0081163 | 3300049575 | Bacteria | 2524 |
| 613 | Ga0501039_0776968 | 3300049575 | Bacteria | 747 |
| 614 | Ga0501043_0002067 | 3300049579 | Bacteria | 17117 |
| 615 | Ga0501043_0012846 | 3300049579 | Bacteria | 6545 |
| 616 | Ga0501046_0043360 | 3300049580 | Bacteria | 3582 |
| 617 | Ga0501046_0058214 | 3300049580 | Bacteria | 3029 |
| 618 | Ga0501047_0321689 | 3300049581 | Bacteria | 1386 |
| 619 | Ga0501048_0002001 | 3300049582 | Bacteria | 15480 |
| 620 | Ga0501067_0009389 | 3300049583 | Bacteria | 5418 |
| 621 | Ga0501068_0132718 | 3300049584 | Bacteria | 1558 |
| 622 | Ga0501070_0008938 | 3300049586 | Bacteria | 8470 |
| 623 | Ga0501072_0079427 | 3300049588 | Unclassified | 2598 |
| 624 | Ga0501072_0084708 | 3300049588 | Bacteria | 2514 |
| 625 | Ga0501072_0175959 | 3300049588 | Bacteria | 1707 |
| 626 | Ga0501073_0009042 | 3300049589 | Bacteria | 7355 |
| 627 | Ga0501073_0268093 | 3300049589 | Bacteria | 1178 |
| 628 | Ga0501074_0001847 | 3300049590 | Bacteria | 14526 |
| 629 | Ga0501077_0051664 | 3300049593 | Bacteria | 2612 |
| 630 | Ga0501202_011460 | 3300049652 | Bacteria | 1661 |
| 631 | Ga0501217_038096 | 3300049661 | Bacteria | 1213 |
| 632 | Ga0501223_007789 | 3300049663 | Bacteria | 2187 |
| 633 | Ga0501228_010737 | 3300049666 | Bacteria | 916 |
| 634 | Ga0501235_028613 | 3300049669 | Bacteria | 1252 |
| 635 | Ga0501245_022625 | 3300049708 | Bacteria | 993 |
| 636 | Ga0501079_0031838 | 3300049741 | Bacteria | 4053 |
| 637 | Ga0501080_0019814 | 3300049742 | Bacteria | 6227 |
| 638 | Ga0501080_0065777 | 3300049742 | Bacteria | 3372 |
| 639 | Ga0501083_0015996 | 3300049744 | Bacteria | 5253 |
| 640 | Ga0501266_020311 | 3300049763 | Bacteria | 903 |
| 641 | Ga0501035_0001762 | 3300049822 | Bacteria | 21856 |
| 642 | Ga0501035_0016465 | 3300049822 | Bacteria | 6818 |
| 643 | Ga0501044_0003029 | 3300049823 | Bacteria | 19020 |
| 644 | Ga0501044_0026464 | 3300049823 | Bacteria | 6139 |
| 645 | Ga0501044_0674680 | 3300049823 | Bacteria | 921 |
| 646 | Ga0501212_058958 | 3300049851 | Bacteria | 662 |
| 647 | nmdc:mga0k408_10187_c1 | 3300050493 | Bacteria | 5081 |
| 648 | nmdc:mga0k408_36936_c1 | 3300050493 | Bacteria | 2804 |
| 649 | nmdc:mga07m45_491829_c1 | 3300050496 | Unclassified | 710 |
| 650 | nmdc:mga08y16_224931_c1 | 3300050511 | Bacteria | 1942 |
| 651 | nmdc:mga08x19_226271_c1 | 3300050514 | Bacteria | 1286 |
| 652 | Ga0495619_0060746 | 3300053085 | Bacteria | 2513 |
| 653 | Ga0500583_0000568 | 3300053092 | Bacteria | 11176 |
| 654 | Ga0500583_0158573 | 3300053092 | Bacteria | 1127 |
| 655 | Ga0500568_0025320 | 3300053139 | Bacteria | 2505 |
| 656 | Ga0500588_0115282 | 3300053146 | Bacteria | 942 |
| 657 | Ga0500637_0290982 | 3300053178 | Bacteria | 895 |
| 658 | Ga0500611_000003 | 3300053727 | Bacteria | 333431 |
| 659 | Ga0501084_0039762 | 3300054114 | Bacteria | 3934 |
| 660 | Ga0501082_0287656 | 3300060353 | Bacteria | 1431 |
| 661 | Ga0501082_0628135 | 3300060353 | Bacteria | 940 |
| 662 | Ga0466962_0015449 | 3300061719 | Bacteria | 3680 |
| 663 | Ga0466962_0078930 | 3300061719 | Bacteria | 1573 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005334 | Ga0068869_100188094 | Ga0068869_1001880942 | 161 |
| 2 | 3300035114 | Ga0373939_0508008 | Ga0373939_0508008_11_499 | 161 |
| 3 | 3300035118 | Ga0373954_0447123 | Ga0373954_0447123_89_577 | 161 |
| 4 | 3300041492 | Ga0451835_0055831 | Ga0451835_0055831_57_545 | 161 |
| 5 | 3300041503 | Ga0451847_0839165 | Ga0451847_0839165_95_583 | 161 |
| 6 | 3300046511 | Ga0495608_0795222 | Ga0495608_0795222_56_544 | 161 |
| 7 | 3300046517 | Ga0495630_0053840 | Ga0495630_0053840_2495_2983 | 161 |
| 8 | 3300050496 | nmdc:mga07m45_491829_c1 | nmdc:mga07m45_491829_c1_13_501 | 161 |
| 9 | 3300005345 | Ga0070692_10833372 | Ga0070692_108333721 | 170 |
| 10 | 3300031730 | Ga0307516_10000159 | Ga0307516_1000015922 | 170 |
| 11 | 3300054114 | Ga0501084_0039762 | Ga0501084_0039762_3367_3882 | 170 |
| 12 | 3300005458 | Ga0070681_10045020 | Ga0070681_100450203 | 173 |
| 13 | 3300005841 | Ga0068863_101198808 | Ga0068863_1011988082 | 173 |
| 14 | 3300025912 | Ga0207707_10214341 | Ga0207707_102143412 | 173 |
| 15 | 3300035692 | Ga0373935_0639946 | Ga0373935_0639946_135_749 | 176 |
| 16 | 3300009553 | Ga0105249_10112821 | Ga0105249_101128213 | 178 |
| 17 | 3300026041 | Ga0207639_10270654 | Ga0207639_102706542 | 178 |
| 18 | 3300028786 | Ga0307517_10000268 | Ga0307517_1000026850 | 178 |
| 19 | 3300046460 | Ga0495638_0031164 | Ga0495638_0031164_1555_2130 | 178 |
| 20 | 3300046524 | Ga0495648_0001979 | Ga0495648_0001979_4087_4662 | 178 |
| 21 | 3300053092 | Ga0500583_0000568 | Ga0500583_0000568_2566_3141 | 178 |
| 22 | 3300005548 | Ga0070665_100000014 | Ga0070665_10000001487 | 179 |
| 23 | 3300013297 | Ga0157378_10703313 | Ga0157378_107033132 | 179 |
| 24 | 3300028379 | Ga0268266_10000048 | Ga0268266_10000048166 | 179 |
| 25 | 3300005344 | Ga0070661_100467337 | Ga0070661_1004673371 | 184 |
| 26 | 3300005366 | Ga0070659_100075000 | Ga0070659_1000750003 | 184 |
| 27 | 3300005458 | Ga0070681_11435717 | Ga0070681_114357171 | 184 |
| 28 | 3300005563 | Ga0068855_100127618 | Ga0068855_1001276183 | 184 |
| 29 | 3300005577 | Ga0068857_100002147 | Ga0068857_1000021478 | 184 |
| 30 | 3300005614 | Ga0068856_100056543 | Ga0068856_1000565434 | 184 |
| 31 | 3300005616 | Ga0068852_100012296 | Ga0068852_1000122963 | 184 |
| 32 | 3300025904 | Ga0207647_10004599 | Ga0207647_100045996 | 184 |
| 33 | 3300025911 | Ga0207654_10026063 | Ga0207654_100260633 | 184 |
| 34 | 3300025913 | Ga0207695_10036339 | Ga0207695_100363396 | 184 |
| 35 | 3300025924 | Ga0207694_10005398 | Ga0207694_100053988 | 184 |
| 36 | 3300025949 | Ga0207667_10001242 | Ga0207667_1000124216 | 184 |
| 37 | 3300025981 | Ga0207640_10022459 | Ga0207640_100224591 | 184 |
| 38 | 3300026078 | Ga0207702_10050648 | Ga0207702_100506483 | 184 |
| 39 | 3300026116 | Ga0207674_10000453 | Ga0207674_1000045317 | 184 |
| 40 | 3300005614 | Ga0068856_100042327 | Ga0068856_1000423272 | 185 |
| 41 | 3300026078 | Ga0207702_10038731 | Ga0207702_100387312 | 185 |
| 42 | 3300005327 | Ga0070658_10012615 | Ga0070658_100126155 | 186 |
| 43 | 3300005328 | Ga0070676_10018990 | Ga0070676_100189903 | 186 |
| 44 | 3300005335 | Ga0070666_10041311 | Ga0070666_100413112 | 186 |
| 45 | 3300005338 | Ga0068868_100003574 | Ga0068868_1000035744 | 186 |
| 46 | 3300005339 | Ga0070660_100931232 | Ga0070660_1009312321 | 186 |
| 47 | 3300005340 | Ga0070689_101072005 | Ga0070689_1010720051 | 186 |
| 48 | 3300005364 | Ga0070673_100060620 | Ga0070673_1000606204 | 186 |
| 49 | 3300005367 | Ga0070667_100021240 | Ga0070667_1000212403 | 186 |
| 50 | 3300005455 | Ga0070663_100091947 | Ga0070663_1000919472 | 186 |
| 51 | 3300005459 | Ga0068867_100026025 | Ga0068867_1000260252 | 186 |
| 52 | 3300005539 | Ga0068853_100091687 | Ga0068853_1000916874 | 186 |
| 53 | 3300005841 | Ga0068863_100316193 | Ga0068863_1003161932 | 186 |
| 54 | 3300006931 | Ga0097620_100534384 | Ga0097620_1005343842 | 186 |
| 55 | 3300026088 | Ga0207641_10115135 | Ga0207641_101151352 | 186 |
| 56 | 3300002077 | JGI24744J21845_10024993 | JGI24744J21845_100249932 | 187 |
| 57 | 3300005330 | Ga0070690_100247796 | Ga0070690_1002477961 | 187 |
| 58 | 3300005334 | Ga0068869_100040117 | Ga0068869_1000401173 | 187 |
| 59 | 3300005338 | Ga0068868_100176158 | Ga0068868_1001761583 | 187 |
| 60 | 3300005343 | Ga0070687_100006709 | Ga0070687_1000067093 | 187 |
| 61 | 3300005344 | Ga0070661_100319166 | Ga0070661_1003191662 | 187 |
| 62 | 3300005353 | Ga0070669_100378550 | Ga0070669_1003785502 | 187 |
| 63 | 3300005354 | Ga0070675_100076880 | Ga0070675_1000768804 | 187 |
| 64 | 3300005355 | Ga0070671_100007908 | Ga0070671_1000079088 | 187 |
| 65 | 3300005356 | Ga0070674_100066226 | Ga0070674_1000662264 | 187 |
| 66 | 3300005367 | Ga0070667_100651887 | Ga0070667_1006518871 | 187 |
| 67 | 3300005456 | Ga0070678_100190194 | Ga0070678_1001901942 | 187 |
| 68 | 3300005459 | Ga0068867_100090140 | Ga0068867_1000901403 | 187 |
| 69 | 3300005535 | Ga0070684_100002074 | Ga0070684_1000020747 | 187 |
| 70 | 3300005544 | Ga0070686_100041453 | Ga0070686_1000414532 | 187 |
| 71 | 3300005547 | Ga0070693_100255075 | Ga0070693_1002550751 | 187 |
| 72 | 3300005563 | Ga0068855_100073045 | Ga0068855_1000730452 | 187 |
| 73 | 3300005577 | Ga0068857_100255575 | Ga0068857_1002555753 | 187 |
| 74 | 3300005578 | Ga0068854_100268281 | Ga0068854_1002682812 | 187 |
| 75 | 3300005616 | Ga0068852_100102778 | Ga0068852_1001027782 | 187 |
| 76 | 3300005983 | Ga0081540_1013840 | Ga0081540_10138403 | 187 |
| 77 | 3300006881 | Ga0068865_100483463 | Ga0068865_1004834631 | 187 |
| 78 | 3300009093 | Ga0105240_10006529 | Ga0105240_100065297 | 187 |
| 79 | 3300009094 | Ga0111539_10071473 | Ga0111539_100714735 | 187 |
| 80 | 3300009177 | Ga0105248_10837533 | Ga0105248_108375332 | 187 |
| 81 | 3300009553 | Ga0105249_10116464 | Ga0105249_101164643 | 187 |
| 82 | 3300010375 | Ga0105239_10000580 | Ga0105239_1000058030 | 187 |
| 83 | 3300010375 | Ga0105239_10030051 | Ga0105239_100300518 | 187 |
| 84 | 3300010375 | Ga0105239_10604079 | Ga0105239_106040792 | 187 |
| 85 | 3300013100 | Ga0157373_10068009 | Ga0157373_100680092 | 187 |
| 86 | 3300013105 | Ga0157369_10319984 | Ga0157369_103199842 | 187 |
| 87 | 3300013297 | Ga0157378_10006519 | Ga0157378_100065196 | 187 |
| 88 | 3300013306 | Ga0163162_10078768 | Ga0163162_100787683 | 187 |
| 89 | 3300013307 | Ga0157372_10403572 | Ga0157372_104035722 | 187 |
| 90 | 3300013308 | Ga0157375_10814121 | Ga0157375_108141212 | 187 |
| 91 | 3300014326 | Ga0157380_10667978 | Ga0157380_106679782 | 187 |
| 92 | 3300014968 | Ga0157379_10430730 | Ga0157379_104307302 | 187 |
| 93 | 3300014969 | Ga0157376_11315761 | Ga0157376_113157611 | 187 |
| 94 | 3300017792 | Ga0163161_10142880 | Ga0163161_101428801 | 187 |
| 95 | 3300025901 | Ga0207688_10058259 | Ga0207688_100582592 | 187 |
| 96 | 3300025904 | Ga0207647_10025873 | Ga0207647_100258732 | 187 |
| 97 | 3300025913 | Ga0207695_10000087 | Ga0207695_10000087153 | 187 |
| 98 | 3300025913 | Ga0207695_10203184 | Ga0207695_102031842 | 187 |
| 99 | 3300025918 | Ga0207662_10023616 | Ga0207662_100236164 | 187 |
| 100 | 3300025924 | Ga0207694_10040792 | Ga0207694_100407925 | 187 |
| 101 | 3300025926 | Ga0207659_10060935 | Ga0207659_100609353 | 187 |
| 102 | 3300025933 | Ga0207706_10404618 | Ga0207706_104046182 | 187 |
| 103 | 3300025937 | Ga0207669_10065043 | Ga0207669_100650433 | 187 |
| 104 | 3300025937 | Ga0207669_10069562 | Ga0207669_100695623 | 187 |
| 105 | 3300025940 | Ga0207691_10020036 | Ga0207691_100200363 | 187 |
| 106 | 3300025942 | Ga0207689_10179033 | Ga0207689_101790332 | 187 |
| 107 | 3300025949 | Ga0207667_10000584 | Ga0207667_1000058421 | 187 |
| 108 | 3300025949 | Ga0207667_10016385 | Ga0207667_100163856 | 187 |
| 109 | 3300025981 | Ga0207640_10220798 | Ga0207640_102207982 | 187 |
| 110 | 3300026089 | Ga0207648_10092461 | Ga0207648_100924613 | 187 |
| 111 | 3300026116 | Ga0207674_10530736 | Ga0207674_105307361 | 187 |
| 112 | 3300026118 | Ga0207675_100426292 | Ga0207675_1004262922 | 187 |
| 113 | 3300026142 | Ga0207698_10094545 | Ga0207698_100945453 | 187 |
| 114 | 3300026142 | Ga0207698_10442344 | Ga0207698_104423442 | 187 |
| 115 | 3300045049 | Ga0466959_0001773 | Ga0466959_0001773_4787_5350 | 187 |
| 116 | 3300046477 | Ga0495664_0326103 | Ga0495664_0326103_86_649 | 187 |
| 117 | 3300046559 | Ga0495667_0492329 | Ga0495667_0492329_100_663 | 187 |
| 118 | 3300047471 | Ga0495684_0363307 | Ga0495684_0363307_352_915 | 187 |
| 119 | 3300050511 | nmdc:mga08y16_224931_c1 | nmdc:mga08y16_224931_c1_703_1266 | 187 |
| 120 | 3300061719 | Ga0466962_0015449 | Ga0466962_0015449_1744_2307 | 187 |
| 121 | 3300003322 | rootL2_10072075 | rootL2_100720752 | 188 |
| 122 | 3300003322 | rootL2_10326007 | rootL2_103260071 | 188 |
| 123 | 3300003323 | rootH1_10243153 | rootH1_102431532 | 188 |
| 124 | 3300005290 | Ga0065712_10181075 | Ga0065712_101810752 | 188 |
| 125 | 3300005290 | Ga0065712_10284438 | Ga0065712_102844381 | 188 |
| 126 | 3300005328 | Ga0070676_10014319 | Ga0070676_100143192 | 188 |
| 127 | 3300005329 | Ga0070683_100191390 | Ga0070683_1001913903 | 188 |
| 128 | 3300005329 | Ga0070683_100418339 | Ga0070683_1004183392 | 188 |
| 129 | 3300005329 | Ga0070683_100936182 | Ga0070683_1009361821 | 188 |
| 130 | 3300005330 | Ga0070690_100471088 | Ga0070690_1004710882 | 188 |
| 131 | 3300005331 | Ga0070670_100791104 | Ga0070670_1007911041 | 188 |
| 132 | 3300005334 | Ga0068869_100074258 | Ga0068869_1000742582 | 188 |
| 133 | 3300005334 | Ga0068869_100761899 | Ga0068869_1007618991 | 188 |
| 134 | 3300005335 | Ga0070666_10002756 | Ga0070666_100027567 | 188 |
| 135 | 3300005338 | Ga0068868_100013885 | Ga0068868_1000138854 | 188 |
| 136 | 3300005340 | Ga0070689_100578268 | Ga0070689_1005782682 | 188 |
| 137 | 3300005344 | Ga0070661_100019264 | Ga0070661_1000192645 | 188 |
| 138 | 3300005344 | Ga0070661_100676657 | Ga0070661_1006766571 | 188 |
| 139 | 3300005347 | Ga0070668_100009928 | Ga0070668_1000099282 | 188 |
| 140 | 3300005353 | Ga0070669_100037400 | Ga0070669_1000374003 | 188 |
| 141 | 3300005354 | Ga0070675_100791776 | Ga0070675_1007917761 | 188 |
| 142 | 3300005355 | Ga0070671_100153841 | Ga0070671_1001538412 | 188 |
| 143 | 3300005356 | Ga0070674_100049306 | Ga0070674_1000493062 | 188 |
| 144 | 3300005364 | Ga0070673_100025956 | Ga0070673_1000259562 | 188 |
| 145 | 3300005365 | Ga0070688_100029947 | Ga0070688_1000299472 | 188 |
| 146 | 3300005366 | Ga0070659_100531771 | Ga0070659_1005317712 | 188 |
| 147 | 3300005367 | Ga0070667_100071668 | Ga0070667_1000716682 | 188 |
| 148 | 3300005455 | Ga0070663_100119899 | Ga0070663_1001198992 | 188 |
| 149 | 3300005456 | Ga0070678_100046738 | Ga0070678_1000467383 | 188 |
| 150 | 3300005457 | Ga0070662_100328508 | Ga0070662_1003285082 | 188 |
| 151 | 3300005459 | Ga0068867_100055002 | Ga0068867_1000550023 | 188 |
| 152 | 3300005466 | Ga0070685_10003854 | Ga0070685_100038545 | 188 |
| 153 | 3300005535 | Ga0070684_100021281 | Ga0070684_1000212813 | 188 |
| 154 | 3300005535 | Ga0070684_100190517 | Ga0070684_1001905171 | 188 |
| 155 | 3300005539 | Ga0068853_100026519 | Ga0068853_1000265193 | 188 |
| 156 | 3300005543 | Ga0070672_100005202 | Ga0070672_1000052028 | 188 |
| 157 | 3300005548 | Ga0070665_100381189 | Ga0070665_1003811892 | 188 |
| 158 | 3300005548 | Ga0070665_100410328 | Ga0070665_1004103282 | 188 |
| 159 | 3300005548 | Ga0070665_100548896 | Ga0070665_1005488962 | 188 |
| 160 | 3300005563 | Ga0068855_100001990 | Ga0068855_10000199020 | 188 |
| 161 | 3300005564 | Ga0070664_100002665 | Ga0070664_10000266511 | 188 |
| 162 | 3300005577 | Ga0068857_100021713 | Ga0068857_1000217133 | 188 |
| 163 | 3300005577 | Ga0068857_100100927 | Ga0068857_1001009274 | 188 |
| 164 | 3300005577 | Ga0068857_100430041 | Ga0068857_1004300412 | 188 |
| 165 | 3300005578 | Ga0068854_100023210 | Ga0068854_1000232102 | 188 |
| 166 | 3300005578 | Ga0068854_100134265 | Ga0068854_1001342652 | 188 |
| 167 | 3300005614 | Ga0068856_100028452 | Ga0068856_1000284524 | 188 |
| 168 | 3300005616 | Ga0068852_100031270 | Ga0068852_1000312702 | 188 |
| 169 | 3300005616 | Ga0068852_100294580 | Ga0068852_1002945802 | 188 |
| 170 | 3300005617 | Ga0068859_100002273 | Ga0068859_1000022739 | 188 |
| 171 | 3300005617 | Ga0068859_100072081 | Ga0068859_1000720815 | 188 |
| 172 | 3300005618 | Ga0068864_101117914 | Ga0068864_1011179141 | 188 |
| 173 | 3300005719 | Ga0068861_100631836 | Ga0068861_1006318361 | 188 |
| 174 | 3300005840 | Ga0068870_10156742 | Ga0068870_101567422 | 188 |
| 175 | 3300005841 | Ga0068863_100129113 | Ga0068863_1001291132 | 188 |
| 176 | 3300005843 | Ga0068860_100104673 | Ga0068860_1001046734 | 188 |
| 177 | 3300005985 | Ga0081539_10047752 | Ga0081539_100477523 | 188 |
| 178 | 3300006195 | Ga0075366_10008625 | Ga0075366_100086254 | 188 |
| 179 | 3300006195 | Ga0075366_10012354 | Ga0075366_100123542 | 188 |
| 180 | 3300006237 | Ga0097621_100018519 | Ga0097621_1000185195 | 188 |
| 181 | 3300006237 | Ga0097621_101159982 | Ga0097621_1011599821 | 188 |
| 182 | 3300006358 | Ga0068871_100053443 | Ga0068871_1000534432 | 188 |
| 183 | 3300006358 | Ga0068871_100224705 | Ga0068871_1002247052 | 188 |
| 184 | 3300006871 | Ga0075434_100044282 | Ga0075434_1000442823 | 188 |
| 185 | 3300006881 | Ga0068865_100006196 | Ga0068865_1000061964 | 188 |
| 186 | 3300006931 | Ga0097620_100002273 | Ga0097620_1000022739 | 188 |
| 187 | 3300006931 | Ga0097620_100072079 | Ga0097620_1000720792 | 188 |
| 188 | 3300009098 | Ga0105245_10233630 | Ga0105245_102336302 | 188 |
| 189 | 3300009174 | Ga0105241_10042451 | Ga0105241_100424513 | 188 |
| 190 | 3300009174 | Ga0105241_10093641 | Ga0105241_100936412 | 188 |
| 191 | 3300009176 | Ga0105242_10012927 | Ga0105242_100129274 | 188 |
| 192 | 3300009553 | Ga0105249_10124897 | Ga0105249_101248973 | 188 |
| 193 | 3300009553 | Ga0105249_10409303 | Ga0105249_104093032 | 188 |
| 194 | 3300010375 | Ga0105239_10007405 | Ga0105239_100074053 | 188 |
| 195 | 3300010375 | Ga0105239_11301017 | Ga0105239_113010171 | 188 |
| 196 | 3300011119 | Ga0105246_10001264 | Ga0105246_1000126411 | 188 |
| 197 | 3300013100 | Ga0157373_10184227 | Ga0157373_101842272 | 188 |
| 198 | 3300013104 | Ga0157370_10004229 | Ga0157370_100042292 | 188 |
| 199 | 3300013105 | Ga0157369_11300717 | Ga0157369_113007172 | 188 |
| 200 | 3300013296 | Ga0157374_10135901 | Ga0157374_101359011 | 188 |
| 201 | 3300013297 | Ga0157378_10434717 | Ga0157378_104347172 | 188 |
| 202 | 3300013306 | Ga0163162_10242469 | Ga0163162_102424693 | 188 |
| 203 | 3300013306 | Ga0163162_10279101 | Ga0163162_102791012 | 188 |
| 204 | 3300013307 | Ga0157372_10322297 | Ga0157372_103222972 | 188 |
| 205 | 3300013308 | Ga0157375_10055142 | Ga0157375_100551421 | 188 |
| 206 | 3300013308 | Ga0157375_10257203 | Ga0157375_102572032 | 188 |
| 207 | 3300013308 | Ga0157375_10470675 | Ga0157375_104706752 | 188 |
| 208 | 3300014325 | Ga0163163_10553015 | Ga0163163_105530152 | 188 |
| 209 | 3300014325 | Ga0163163_10645329 | Ga0163163_106453292 | 188 |
| 210 | 3300014326 | Ga0157380_10122130 | Ga0157380_101221302 | 188 |
| 211 | 3300014326 | Ga0157380_11040956 | Ga0157380_110409562 | 188 |
| 212 | 3300014969 | Ga0157376_10026592 | Ga0157376_100265924 | 188 |
| 213 | 3300014969 | Ga0157376_10150053 | Ga0157376_101500533 | 188 |
| 214 | 3300025901 | Ga0207688_10003300 | Ga0207688_100033005 | 188 |
| 215 | 3300025903 | Ga0207680_10047349 | Ga0207680_100473493 | 188 |
| 216 | 3300025903 | Ga0207680_10234927 | Ga0207680_102349272 | 188 |
| 217 | 3300025907 | Ga0207645_10003291 | Ga0207645_1000329110 | 188 |
| 218 | 3300025908 | Ga0207643_10129266 | Ga0207643_101292662 | 188 |
| 219 | 3300025911 | Ga0207654_10024091 | Ga0207654_100240913 | 188 |
| 220 | 3300025920 | Ga0207649_10068425 | Ga0207649_100684251 | 188 |
| 221 | 3300025920 | Ga0207649_10942154 | Ga0207649_109421541 | 188 |
| 222 | 3300025933 | Ga0207706_10054002 | Ga0207706_100540024 | 188 |
| 223 | 3300025934 | Ga0207686_10029678 | Ga0207686_100296782 | 188 |
| 224 | 3300025936 | Ga0207670_10016254 | Ga0207670_100162543 | 188 |
| 225 | 3300025937 | Ga0207669_10037332 | Ga0207669_100373322 | 188 |
| 226 | 3300025938 | Ga0207704_10038307 | Ga0207704_100383073 | 188 |
| 227 | 3300025940 | Ga0207691_10031370 | Ga0207691_100313704 | 188 |
| 228 | 3300025942 | Ga0207689_10001049 | Ga0207689_100010499 | 188 |
| 229 | 3300025942 | Ga0207689_10475385 | Ga0207689_104753852 | 188 |
| 230 | 3300025942 | Ga0207689_10497951 | Ga0207689_104979511 | 188 |
| 231 | 3300025944 | Ga0207661_10053129 | Ga0207661_100531293 | 188 |
| 232 | 3300025944 | Ga0207661_10072945 | Ga0207661_100729453 | 188 |
| 233 | 3300025945 | Ga0207679_10043404 | Ga0207679_100434042 | 188 |
| 234 | 3300025945 | Ga0207679_10070163 | Ga0207679_100701632 | 188 |
| 235 | 3300025949 | Ga0207667_10020034 | Ga0207667_100200343 | 188 |
| 236 | 3300025960 | Ga0207651_10107640 | Ga0207651_101076401 | 188 |
| 237 | 3300025961 | Ga0207712_10047061 | Ga0207712_100470612 | 188 |
| 238 | 3300025961 | Ga0207712_10329655 | Ga0207712_103296552 | 188 |
| 239 | 3300025972 | Ga0207668_10048032 | Ga0207668_100480323 | 188 |
| 240 | 3300025972 | Ga0207668_10173375 | Ga0207668_101733752 | 188 |
| 241 | 3300025981 | Ga0207640_10108873 | Ga0207640_101088732 | 188 |
| 242 | 3300025986 | Ga0207658_10068969 | Ga0207658_100689692 | 188 |
| 243 | 3300025986 | Ga0207658_10591604 | Ga0207658_105916042 | 188 |
| 244 | 3300026023 | Ga0207677_10044906 | Ga0207677_100449063 | 188 |
| 245 | 3300026041 | Ga0207639_10034764 | Ga0207639_100347645 | 188 |
| 246 | 3300026041 | Ga0207639_10237680 | Ga0207639_102376802 | 188 |
| 247 | 3300026075 | Ga0207708_10516618 | Ga0207708_105166181 | 188 |
| 248 | 3300026078 | Ga0207702_10100657 | Ga0207702_101006572 | 188 |
| 249 | 3300026088 | Ga0207641_10100939 | Ga0207641_101009393 | 188 |
| 250 | 3300026089 | Ga0207648_10005292 | Ga0207648_100052929 | 188 |
| 251 | 3300026095 | Ga0207676_10909651 | Ga0207676_109096511 | 188 |
| 252 | 3300026116 | Ga0207674_10037607 | Ga0207674_100376073 | 188 |
| 253 | 3300026116 | Ga0207674_10432229 | Ga0207674_104322292 | 188 |
| 254 | 3300026116 | Ga0207674_11030910 | Ga0207674_110309101 | 188 |
| 255 | 3300026118 | Ga0207675_100447412 | Ga0207675_1004474122 | 188 |
| 256 | 3300026121 | Ga0207683_10000957 | Ga0207683_1000095721 | 188 |
| 257 | 3300026142 | Ga0207698_10018924 | Ga0207698_100189244 | 188 |
| 258 | 3300028379 | Ga0268266_10022104 | Ga0268266_100221044 | 188 |
| 259 | 3300028379 | Ga0268266_10146482 | Ga0268266_101464822 | 188 |
| 260 | 3300028380 | Ga0268265_10583094 | Ga0268265_105830941 | 188 |
| 261 | 3300028381 | Ga0268264_11493738 | Ga0268264_114937381 | 188 |
| 262 | 3300031548 | Ga0307408_100448363 | Ga0307408_1004483631 | 188 |
| 263 | 3300031731 | Ga0307405_10628317 | Ga0307405_106283171 | 188 |
| 264 | 3300031852 | Ga0307410_10568053 | Ga0307410_105680531 | 188 |
| 265 | 3300031901 | Ga0307406_10264003 | Ga0307406_102640032 | 188 |
| 266 | 3300032002 | Ga0307416_100281525 | Ga0307416_1002815252 | 188 |
| 267 | 3300032004 | Ga0307414_10226041 | Ga0307414_102260412 | 188 |
| 268 | 3300032126 | Ga0307415_100385683 | Ga0307415_1003856831 | 188 |
| 269 | 3300035171 | Ga0373946_0048655 | Ga0373946_0048655_1055_1630 | 188 |
| 270 | 3300035725 | Ga0373947_0346643 | Ga0373947_0346643_228_803 | 188 |
| 271 | 3300041406 | Ga0439439_0045514 | Ga0439439_0045514_111_677 | 188 |
| 272 | 3300041505 | Ga0451849_0123964 | Ga0451849_0123964_16_591 | 188 |
| 273 | 3300041999 | Ga0439433_0025381 | Ga0439433_0025381_468_1034 | 188 |
| 274 | 3300042014 | Ga0439457_008871 | Ga0439457_008871_1234_1800 | 188 |
| 275 | 3300042876 | Ga0451577_0186842 | Ga0451577_0186842_351_926 | 188 |
| 276 | 3300044658 | Ga0466972_0111016 | Ga0466972_0111016_499_1065 | 188 |
| 277 | 3300044673 | Ga0453683_0121321 | Ga0453683_0121321_488_1057 | 188 |
| 278 | 3300044693 | Ga0466961_0167063 | Ga0466961_0167063_758_1324 | 188 |
| 279 | 3300047321 | Ga0495676_0080168 | Ga0495676_0080168_264_839 | 188 |
| 280 | 3300048913 | Ga0496110_1260090 | Ga0496110_1260090_29_604 | 188 |
| 281 | 3300048916 | Ga0496113_0389219 | Ga0496113_0389219_63_638 | 188 |
| 282 | 3300049569 | Ga0501032_0004878 | Ga0501032_0004878_3368_3937 | 188 |
| 283 | 3300049571 | Ga0501034_0070687 | Ga0501034_0070687_789_1358 | 188 |
| 284 | 3300049572 | Ga0501036_0030098 | Ga0501036_0030098_171_740 | 188 |
| 285 | 3300049572 | Ga0501036_0039650 | Ga0501036_0039650_1565_2131 | 188 |
| 286 | 3300049573 | Ga0501037_0004952 | Ga0501037_0004952_3215_3784 | 188 |
| 287 | 3300049573 | Ga0501037_0059666 | Ga0501037_0059666_470_1036 | 188 |
| 288 | 3300049574 | Ga0501038_0003120 | Ga0501038_0003120_1190_1759 | 188 |
| 289 | 3300049575 | Ga0501039_0776968 | Ga0501039_0776968_32_601 | 188 |
| 290 | 3300049579 | Ga0501043_0002067 | Ga0501043_0002067_12076_12645 | 188 |
| 291 | 3300049579 | Ga0501043_0012846 | Ga0501043_0012846_2252_2818 | 188 |
| 292 | 3300049580 | Ga0501046_0043360 | Ga0501046_0043360_2678_3244 | 188 |
| 293 | 3300049580 | Ga0501046_0058214 | Ga0501046_0058214_661_1230 | 188 |
| 294 | 3300049581 | Ga0501047_0321689 | Ga0501047_0321689_120_689 | 188 |
| 295 | 3300049582 | Ga0501048_0002001 | Ga0501048_0002001_3226_3795 | 188 |
| 296 | 3300049583 | Ga0501067_0009389 | Ga0501067_0009389_2383_2952 | 188 |
| 297 | 3300049586 | Ga0501070_0008938 | Ga0501070_0008938_4513_5082 | 188 |
| 298 | 3300049588 | Ga0501072_0079427 | Ga0501072_0079427_630_1205 | 188 |
| 299 | 3300049588 | Ga0501072_0084708 | Ga0501072_0084708_1618_2184 | 188 |
| 300 | 3300049588 | Ga0501072_0175959 | Ga0501072_0175959_39_608 | 188 |
| 301 | 3300049589 | Ga0501073_0009042 | Ga0501073_0009042_3720_4289 | 188 |
| 302 | 3300049589 | Ga0501073_0268093 | Ga0501073_0268093_39_605 | 188 |
| 303 | 3300049590 | Ga0501074_0001847 | Ga0501074_0001847_895_1464 | 188 |
| 304 | 3300049593 | Ga0501077_0051664 | Ga0501077_0051664_804_1373 | 188 |
| 305 | 3300049652 | Ga0501202_011460 | Ga0501202_011460_85_651 | 188 |
| 306 | 3300049661 | Ga0501217_038096 | Ga0501217_038096_323_889 | 188 |
| 307 | 3300049663 | Ga0501223_007789 | Ga0501223_007789_134_700 | 188 |
| 308 | 3300049666 | Ga0501228_010737 | Ga0501228_010737_134_700 | 188 |
| 309 | 3300049669 | Ga0501235_028613 | Ga0501235_028613_230_796 | 188 |
| 310 | 3300049708 | Ga0501245_022625 | Ga0501245_022625_42_608 | 188 |
| 311 | 3300049741 | Ga0501079_0031838 | Ga0501079_0031838_2428_2997 | 188 |
| 312 | 3300049742 | Ga0501080_0019814 | Ga0501080_0019814_2468_3037 | 188 |
| 313 | 3300049742 | Ga0501080_0065777 | Ga0501080_0065777_2438_3013 | 188 |
| 314 | 3300049744 | Ga0501083_0015996 | Ga0501083_0015996_696_1265 | 188 |
| 315 | 3300049822 | Ga0501035_0001762 | Ga0501035_0001762_7934_8503 | 188 |
| 316 | 3300049822 | Ga0501035_0016465 | Ga0501035_0016465_1022_1588 | 188 |
| 317 | 3300049823 | Ga0501044_0003029 | Ga0501044_0003029_4846_5415 | 188 |
| 318 | 3300049851 | Ga0501212_058958 | Ga0501212_058958_37_603 | 188 |
| 319 | 3300050493 | nmdc:mga0k408_10187_c1 | nmdc:mga0k408_10187_c1_2416_2985 | 188 |
| 320 | 3300050493 | nmdc:mga0k408_36936_c1 | nmdc:mga0k408_36936_c1_886_1455 | 188 |
| 321 | 3300060353 | Ga0501082_0287656 | Ga0501082_0287656_28_597 | 188 |
| 322 | 3300061719 | Ga0466962_0078930 | Ga0466962_0078930_401_967 | 188 |
| 323 | 3300003320 | rootH2_10027245 | rootH2_100272453 | 189 |
| 324 | 3300005335 | Ga0070666_10053529 | Ga0070666_100535292 | 189 |
| 325 | 3300005338 | Ga0068868_101510350 | Ga0068868_1015103501 | 189 |
| 326 | 3300005367 | Ga0070667_100151519 | Ga0070667_1001515192 | 189 |
| 327 | 3300005539 | Ga0068853_100057447 | Ga0068853_1000574472 | 189 |
| 328 | 3300005539 | Ga0068853_100296514 | Ga0068853_1002965142 | 189 |
| 329 | 3300005539 | Ga0068853_100313542 | Ga0068853_1003135422 | 189 |
| 330 | 3300005563 | Ga0068855_101245394 | Ga0068855_1012453941 | 189 |
| 331 | 3300005578 | Ga0068854_100462433 | Ga0068854_1004624332 | 189 |
| 332 | 3300005843 | Ga0068860_100000024 | Ga0068860_100000024141 | 189 |
| 333 | 3300009093 | Ga0105240_10000106 | Ga0105240_1000010660 | 189 |
| 334 | 3300009093 | Ga0105240_10396227 | Ga0105240_103962271 | 189 |
| 335 | 3300009174 | Ga0105241_10001117 | Ga0105241_100011178 | 189 |
| 336 | 3300009174 | Ga0105241_10062358 | Ga0105241_100623583 | 189 |
| 337 | 3300009545 | Ga0105237_10005940 | Ga0105237_1000594013 | 189 |
| 338 | 3300009545 | Ga0105237_10014958 | Ga0105237_100149588 | 189 |
| 339 | 3300009545 | Ga0105237_10018678 | Ga0105237_100186788 | 189 |
| 340 | 3300009551 | Ga0105238_10001211 | Ga0105238_1000121126 | 189 |
| 341 | 3300009551 | Ga0105238_10017549 | Ga0105238_100175493 | 189 |
| 342 | 3300009551 | Ga0105238_10089770 | Ga0105238_100897703 | 189 |
| 343 | 3300009553 | Ga0105249_10318984 | Ga0105249_103189842 | 189 |
| 344 | 3300010375 | Ga0105239_10009676 | Ga0105239_100096763 | 189 |
| 345 | 3300010375 | Ga0105239_10015390 | Ga0105239_100153908 | 189 |
| 346 | 3300013104 | Ga0157370_10026848 | Ga0157370_100268482 | 189 |
| 347 | 3300013105 | Ga0157369_10288022 | Ga0157369_102880222 | 189 |
| 348 | 3300013296 | Ga0157374_10000011 | Ga0157374_10000011429 | 189 |
| 349 | 3300013306 | Ga0163162_10001786 | Ga0163162_100017868 | 189 |
| 350 | 3300013306 | Ga0163162_10785843 | Ga0163162_107858432 | 189 |
| 351 | 3300013307 | Ga0157372_10000171 | Ga0157372_1000017140 | 189 |
| 352 | 3300013307 | Ga0157372_10000463 | Ga0157372_1000046332 | 189 |
| 353 | 3300013307 | Ga0157372_10181378 | Ga0157372_101813783 | 189 |
| 354 | 3300014969 | Ga0157376_10013842 | Ga0157376_100138423 | 189 |
| 355 | 3300025903 | Ga0207680_10007538 | Ga0207680_100075384 | 189 |
| 356 | 3300025911 | Ga0207654_10000620 | Ga0207654_1000062012 | 189 |
| 357 | 3300025913 | Ga0207695_10003167 | Ga0207695_1000316713 | 189 |
| 358 | 3300025913 | Ga0207695_10018118 | Ga0207695_100181184 | 189 |
| 359 | 3300025914 | Ga0207671_10002324 | Ga0207671_1000232414 | 189 |
| 360 | 3300025914 | Ga0207671_10002511 | Ga0207671_100025115 | 189 |
| 361 | 3300025914 | Ga0207671_10008910 | Ga0207671_100089108 | 189 |
| 362 | 3300025924 | Ga0207694_10177014 | Ga0207694_101770142 | 189 |
| 363 | 3300025942 | Ga0207689_10285414 | Ga0207689_102854142 | 189 |
| 364 | 3300025949 | Ga0207667_10834000 | Ga0207667_108340001 | 189 |
| 365 | 3300026041 | Ga0207639_10158522 | Ga0207639_101585223 | 189 |
| 366 | 3300026078 | Ga0207702_10084238 | Ga0207702_100842382 | 189 |
| 367 | 3300026142 | Ga0207698_10583537 | Ga0207698_105835372 | 189 |
| 368 | 3300028381 | Ga0268264_10000028 | Ga0268264_10000028322 | 189 |
| 369 | 3300044658 | Ga0466972_0000640 | Ga0466972_0000640_3507_4082 | 189 |
| 370 | 3300044735 | Ga0466968_0006651 | Ga0466968_0006651_2481_3056 | 189 |
| 371 | 3300044842 | Ga0466957_0229833 | Ga0466957_0229833_556_1131 | 189 |
| 372 | 3300044901 | Ga0466960_0127587 | Ga0466960_0127587_751_1326 | 189 |
| 373 | 3300047443 | Ga0495687_002362 | Ga0495687_002362_13845_14420 | 189 |
| 374 | 3300049763 | Ga0501266_020311 | Ga0501266_020311_40_633 | 189 |
| 375 | 3300049823 | Ga0501044_0674680 | Ga0501044_0674680_125_700 | 189 |
| 376 | 3300053139 | Ga0500568_0025320 | Ga0500568_0025320_256_831 | 189 |
| 377 | 3300005328 | Ga0070676_10020683 | Ga0070676_100206833 | 190 |
| 378 | 3300005328 | Ga0070676_10355691 | Ga0070676_103556911 | 190 |
| 379 | 3300005330 | Ga0070690_100031252 | Ga0070690_1000312523 | 190 |
| 380 | 3300005330 | Ga0070690_100096016 | Ga0070690_1000960161 | 190 |
| 381 | 3300005334 | Ga0068869_100015272 | Ga0068869_1000152725 | 190 |
| 382 | 3300005334 | Ga0068869_100027016 | Ga0068869_1000270163 | 190 |
| 383 | 3300005335 | Ga0070666_10058363 | Ga0070666_100583634 | 190 |
| 384 | 3300005338 | Ga0068868_100007171 | Ga0068868_1000071713 | 190 |
| 385 | 3300005338 | Ga0068868_100008105 | Ga0068868_1000081056 | 190 |
| 386 | 3300005340 | Ga0070689_100138505 | Ga0070689_1001385053 | 190 |
| 387 | 3300005344 | Ga0070661_100010809 | Ga0070661_1000108092 | 190 |
| 388 | 3300005344 | Ga0070661_100058296 | Ga0070661_1000582964 | 190 |
| 389 | 3300005344 | Ga0070661_100304644 | Ga0070661_1003046442 | 190 |
| 390 | 3300005347 | Ga0070668_100001487 | Ga0070668_1000014875 | 190 |
| 391 | 3300005354 | Ga0070675_100022703 | Ga0070675_1000227034 | 190 |
| 392 | 3300005354 | Ga0070675_100046846 | Ga0070675_1000468463 | 190 |
| 393 | 3300005355 | Ga0070671_100736279 | Ga0070671_1007362791 | 190 |
| 394 | 3300005364 | Ga0070673_100306920 | Ga0070673_1003069202 | 190 |
| 395 | 3300005365 | Ga0070688_100012159 | Ga0070688_1000121593 | 190 |
| 396 | 3300005365 | Ga0070688_100215677 | Ga0070688_1002156771 | 190 |
| 397 | 3300005366 | Ga0070659_100617771 | Ga0070659_1006177711 | 190 |
| 398 | 3300005367 | Ga0070667_100039008 | Ga0070667_1000390084 | 190 |
| 399 | 3300005367 | Ga0070667_100430442 | Ga0070667_1004304422 | 190 |
| 400 | 3300005367 | Ga0070667_100489979 | Ga0070667_1004899791 | 190 |
| 401 | 3300005456 | Ga0070678_100043720 | Ga0070678_1000437202 | 190 |
| 402 | 3300005457 | Ga0070662_100001127 | Ga0070662_10000112711 | 190 |
| 403 | 3300005457 | Ga0070662_100011969 | Ga0070662_1000119695 | 190 |
| 404 | 3300005457 | Ga0070662_100013705 | Ga0070662_1000137053 | 190 |
| 405 | 3300005457 | Ga0070662_100070814 | Ga0070662_1000708143 | 190 |
| 406 | 3300005459 | Ga0068867_100077338 | Ga0068867_1000773382 | 190 |
| 407 | 3300005459 | Ga0068867_100169885 | Ga0068867_1001698852 | 190 |
| 408 | 3300005466 | Ga0070685_10063093 | Ga0070685_100630933 | 190 |
| 409 | 3300005466 | Ga0070685_10542127 | Ga0070685_105421271 | 190 |
| 410 | 3300005539 | Ga0068853_100067657 | Ga0068853_1000676572 | 190 |
| 411 | 3300005539 | Ga0068853_100289597 | Ga0068853_1002895971 | 190 |
| 412 | 3300005539 | Ga0068853_100647209 | Ga0068853_1006472092 | 190 |
| 413 | 3300005543 | Ga0070672_100008264 | Ga0070672_1000082644 | 190 |
| 414 | 3300005543 | Ga0070672_100085732 | Ga0070672_1000857323 | 190 |
| 415 | 3300005543 | Ga0070672_100195370 | Ga0070672_1001953702 | 190 |
| 416 | 3300005547 | Ga0070693_100714743 | Ga0070693_1007147431 | 190 |
| 417 | 3300005548 | Ga0070665_100056759 | Ga0070665_1000567594 | 190 |
| 418 | 3300005563 | Ga0068855_100220498 | Ga0068855_1002204983 | 190 |
| 419 | 3300005563 | Ga0068855_100396567 | Ga0068855_1003965672 | 190 |
| 420 | 3300005564 | Ga0070664_100341116 | Ga0070664_1003411162 | 190 |
| 421 | 3300005564 | Ga0070664_100840199 | Ga0070664_1008401991 | 190 |
| 422 | 3300005577 | Ga0068857_100104372 | Ga0068857_1001043722 | 190 |
| 423 | 3300005578 | Ga0068854_100047100 | Ga0068854_1000471002 | 190 |
| 424 | 3300005616 | Ga0068852_100045007 | Ga0068852_1000450074 | 190 |
| 425 | 3300005616 | Ga0068852_100131504 | Ga0068852_1001315043 | 190 |
| 426 | 3300005616 | Ga0068852_100163276 | Ga0068852_1001632763 | 190 |
| 427 | 3300005617 | Ga0068859_100032409 | Ga0068859_1000324095 | 190 |
| 428 | 3300005617 | Ga0068859_100092631 | Ga0068859_1000926314 | 190 |
| 429 | 3300005617 | Ga0068859_100097017 | Ga0068859_1000970174 | 190 |
| 430 | 3300005618 | Ga0068864_100046417 | Ga0068864_1000464174 | 190 |
| 431 | 3300005618 | Ga0068864_100135996 | Ga0068864_1001359963 | 190 |
| 432 | 3300005618 | Ga0068864_100356178 | Ga0068864_1003561782 | 190 |
| 433 | 3300005719 | Ga0068861_100009713 | Ga0068861_1000097137 | 190 |
| 434 | 3300005719 | Ga0068861_100092367 | Ga0068861_1000923672 | 190 |
| 435 | 3300005719 | Ga0068861_100386590 | Ga0068861_1003865902 | 190 |
| 436 | 3300005834 | Ga0068851_10004181 | Ga0068851_100041817 | 190 |
| 437 | 3300005841 | Ga0068863_100005185 | Ga0068863_1000051854 | 190 |
| 438 | 3300005841 | Ga0068863_100302435 | Ga0068863_1003024352 | 190 |
| 439 | 3300005841 | Ga0068863_100714170 | Ga0068863_1007141701 | 190 |
| 440 | 3300005842 | Ga0068858_100002187 | Ga0068858_10000218711 | 190 |
| 441 | 3300005842 | Ga0068858_100309167 | Ga0068858_1003091672 | 190 |
| 442 | 3300005843 | Ga0068860_100000691 | Ga0068860_10000069118 | 190 |
| 443 | 3300005843 | Ga0068860_100010899 | Ga0068860_1000108995 | 190 |
| 444 | 3300005843 | Ga0068860_100429764 | Ga0068860_1004297642 | 190 |
| 445 | 3300005844 | Ga0068862_100452765 | Ga0068862_1004527652 | 190 |
| 446 | 3300006163 | Ga0070715_10094422 | Ga0070715_100944222 | 190 |
| 447 | 3300006237 | Ga0097621_100005475 | Ga0097621_1000054757 | 190 |
| 448 | 3300006237 | Ga0097621_100056807 | Ga0097621_1000568074 | 190 |
| 449 | 3300006237 | Ga0097621_100210073 | Ga0097621_1002100732 | 190 |
| 450 | 3300006237 | Ga0097621_100219087 | Ga0097621_1002190872 | 190 |
| 451 | 3300006237 | Ga0097621_100259485 | Ga0097621_1002594852 | 190 |
| 452 | 3300006358 | Ga0068871_100022329 | Ga0068871_1000223297 | 190 |
| 453 | 3300006358 | Ga0068871_100167943 | Ga0068871_1001679432 | 190 |
| 454 | 3300006358 | Ga0068871_100412353 | Ga0068871_1004123532 | 190 |
| 455 | 3300006881 | Ga0068865_100034522 | Ga0068865_1000345224 | 190 |
| 456 | 3300006881 | Ga0068865_100053771 | Ga0068865_1000537714 | 190 |
| 457 | 3300006881 | Ga0068865_100349662 | Ga0068865_1003496622 | 190 |
| 458 | 3300006914 | Ga0075436_100413795 | Ga0075436_1004137952 | 190 |
| 459 | 3300006931 | Ga0097620_100032409 | Ga0097620_1000324095 | 190 |
| 460 | 3300006931 | Ga0097620_100092635 | Ga0097620_1000926352 | 190 |
| 461 | 3300006931 | Ga0097620_100097017 | Ga0097620_1000970172 | 190 |
| 462 | 3300009093 | Ga0105240_10002904 | Ga0105240_1000290421 | 190 |
| 463 | 3300009093 | Ga0105240_10022621 | Ga0105240_1002262110 | 190 |
| 464 | 3300009093 | Ga0105240_10042604 | Ga0105240_100426043 | 190 |
| 465 | 3300009093 | Ga0105240_10133685 | Ga0105240_101336852 | 190 |
| 466 | 3300009098 | Ga0105245_10063131 | Ga0105245_100631313 | 190 |
| 467 | 3300009101 | Ga0105247_10002404 | Ga0105247_1000240413 | 190 |
| 468 | 3300009101 | Ga0105247_10121504 | Ga0105247_101215042 | 190 |
| 469 | 3300009101 | Ga0105247_10538032 | Ga0105247_105380321 | 190 |
| 470 | 3300009176 | Ga0105242_10320433 | Ga0105242_103204332 | 190 |
| 471 | 3300009176 | Ga0105242_10647460 | Ga0105242_106474602 | 190 |
| 472 | 3300009177 | Ga0105248_10084854 | Ga0105248_100848545 | 190 |
| 473 | 3300009545 | Ga0105237_10000561 | Ga0105237_1000056128 | 190 |
| 474 | 3300009551 | Ga0105238_10131358 | Ga0105238_101313582 | 190 |
| 475 | 3300009553 | Ga0105249_10005427 | Ga0105249_100054278 | 190 |
| 476 | 3300009553 | Ga0105249_10048728 | Ga0105249_100487284 | 190 |
| 477 | 3300010375 | Ga0105239_10003763 | Ga0105239_100037633 | 190 |
| 478 | 3300010375 | Ga0105239_10211340 | Ga0105239_102113402 | 190 |
| 479 | 3300010375 | Ga0105239_10353094 | Ga0105239_103530941 | 190 |
| 480 | 3300010375 | Ga0105239_10661080 | Ga0105239_106610802 | 190 |
| 481 | 3300010375 | Ga0105239_10662127 | Ga0105239_106621272 | 190 |
| 482 | 3300011119 | Ga0105246_10143669 | Ga0105246_101436693 | 190 |
| 483 | 3300011119 | Ga0105246_10969391 | Ga0105246_109693911 | 190 |
| 484 | 3300013100 | Ga0157373_10835971 | Ga0157373_108359711 | 190 |
| 485 | 3300013102 | Ga0157371_10421205 | Ga0157371_104212052 | 190 |
| 486 | 3300013296 | Ga0157374_10038728 | Ga0157374_100387283 | 190 |
| 487 | 3300013296 | Ga0157374_10058869 | Ga0157374_100588692 | 190 |
| 488 | 3300013296 | Ga0157374_10119566 | Ga0157374_101195664 | 190 |
| 489 | 3300013297 | Ga0157378_10021695 | Ga0157378_100216953 | 190 |
| 490 | 3300013297 | Ga0157378_10036639 | Ga0157378_100366392 | 190 |
| 491 | 3300013306 | Ga0163162_10001367 | Ga0163162_100013676 | 190 |
| 492 | 3300013306 | Ga0163162_10002933 | Ga0163162_100029334 | 190 |
| 493 | 3300013306 | Ga0163162_10023782 | Ga0163162_100237824 | 190 |
| 494 | 3300013306 | Ga0163162_10048969 | Ga0163162_100489694 | 190 |
| 495 | 3300013306 | Ga0163162_10165389 | Ga0163162_101653893 | 190 |
| 496 | 3300013306 | Ga0163162_10199989 | Ga0163162_101999892 | 190 |
| 497 | 3300013306 | Ga0163162_10242383 | Ga0163162_102423832 | 190 |
| 498 | 3300013307 | Ga0157372_10630786 | Ga0157372_106307862 | 190 |
| 499 | 3300013308 | Ga0157375_10009867 | Ga0157375_100098675 | 190 |
| 500 | 3300013308 | Ga0157375_10085503 | Ga0157375_100855033 | 190 |
| 501 | 3300013308 | Ga0157375_10121739 | Ga0157375_101217393 | 190 |
| 502 | 3300013308 | Ga0157375_10328462 | Ga0157375_103284622 | 190 |
| 503 | 3300014325 | Ga0163163_10001998 | Ga0163163_100019982 | 190 |
| 504 | 3300014325 | Ga0163163_10005703 | Ga0163163_100057037 | 190 |
| 505 | 3300014325 | Ga0163163_10089414 | Ga0163163_100894144 | 190 |
| 506 | 3300014325 | Ga0163163_10254464 | Ga0163163_102544642 | 190 |
| 507 | 3300014326 | Ga0157380_10350484 | Ga0157380_103504842 | 190 |
| 508 | 3300014326 | Ga0157380_10780370 | Ga0157380_107803701 | 190 |
| 509 | 3300014745 | Ga0157377_10010026 | Ga0157377_100100265 | 190 |
| 510 | 3300014968 | Ga0157379_10010876 | Ga0157379_100108762 | 190 |
| 511 | 3300014968 | Ga0157379_10018539 | Ga0157379_100185396 | 190 |
| 512 | 3300014968 | Ga0157379_10304355 | Ga0157379_103043552 | 190 |
| 513 | 3300014968 | Ga0157379_10643729 | Ga0157379_106437292 | 190 |
| 514 | 3300014968 | Ga0157379_10884674 | Ga0157379_108846742 | 190 |
| 515 | 3300014969 | Ga0157376_10023416 | Ga0157376_100234162 | 190 |
| 516 | 3300014969 | Ga0157376_10240327 | Ga0157376_102403273 | 190 |
| 517 | 3300014969 | Ga0157376_10265119 | Ga0157376_102651192 | 190 |
| 518 | 3300014969 | Ga0157376_10494472 | Ga0157376_104944722 | 190 |
| 519 | 3300014969 | Ga0157376_11355907 | Ga0157376_113559071 | 190 |
| 520 | 3300017792 | Ga0163161_10008435 | Ga0163161_100084355 | 190 |
| 521 | 3300017792 | Ga0163161_10024623 | Ga0163161_100246233 | 190 |
| 522 | 3300017792 | Ga0163161_10070335 | Ga0163161_100703353 | 190 |
| 523 | 3300025315 | Ga0207697_10226660 | Ga0207697_102266602 | 190 |
| 524 | 3300025321 | Ga0207656_10006384 | Ga0207656_100063843 | 190 |
| 525 | 3300025899 | Ga0207642_10004323 | Ga0207642_100043233 | 190 |
| 526 | 3300025899 | Ga0207642_10160687 | Ga0207642_101606872 | 190 |
| 527 | 3300025900 | Ga0207710_10001781 | Ga0207710_1000178110 | 190 |
| 528 | 3300025903 | Ga0207680_10079798 | Ga0207680_100797982 | 190 |
| 529 | 3300025903 | Ga0207680_10084183 | Ga0207680_100841832 | 190 |
| 530 | 3300025904 | Ga0207647_10107014 | Ga0207647_101070142 | 190 |
| 531 | 3300025905 | Ga0207685_10082641 | Ga0207685_100826411 | 190 |
| 532 | 3300025907 | Ga0207645_10005892 | Ga0207645_100058923 | 190 |
| 533 | 3300025907 | Ga0207645_10223630 | Ga0207645_102236302 | 190 |
| 534 | 3300025909 | Ga0207705_10045085 | Ga0207705_100450852 | 190 |
| 535 | 3300025913 | Ga0207695_10000582 | Ga0207695_1000058269 | 190 |
| 536 | 3300025913 | Ga0207695_10001064 | Ga0207695_1000106410 | 190 |
| 537 | 3300025913 | Ga0207695_10037729 | Ga0207695_100377296 | 190 |
| 538 | 3300025914 | Ga0207671_10002275 | Ga0207671_100022759 | 190 |
| 539 | 3300025924 | Ga0207694_10187485 | Ga0207694_101874851 | 190 |
| 540 | 3300025926 | Ga0207659_10015767 | Ga0207659_100157673 | 190 |
| 541 | 3300025926 | Ga0207659_10980117 | Ga0207659_109801171 | 190 |
| 542 | 3300025927 | Ga0207687_10039213 | Ga0207687_100392133 | 190 |
| 543 | 3300025932 | Ga0207690_10313283 | Ga0207690_103132831 | 190 |
| 544 | 3300025933 | Ga0207706_10003305 | Ga0207706_1000330513 | 190 |
| 545 | 3300025933 | Ga0207706_10004710 | Ga0207706_1000471010 | 190 |
| 546 | 3300025933 | Ga0207706_10015998 | Ga0207706_100159987 | 190 |
| 547 | 3300025934 | Ga0207686_10090156 | Ga0207686_100901561 | 190 |
| 548 | 3300025936 | Ga0207670_10076046 | Ga0207670_100760462 | 190 |
| 549 | 3300025938 | Ga0207704_10025253 | Ga0207704_100252532 | 190 |
| 550 | 3300025938 | Ga0207704_10091562 | Ga0207704_100915622 | 190 |
| 551 | 3300025940 | Ga0207691_10001280 | Ga0207691_1000128016 | 190 |
| 552 | 3300025940 | Ga0207691_10039933 | Ga0207691_100399335 | 190 |
| 553 | 3300025940 | Ga0207691_10542377 | Ga0207691_105423772 | 190 |
| 554 | 3300025942 | Ga0207689_10010413 | Ga0207689_100104134 | 190 |
| 555 | 3300025942 | Ga0207689_10012954 | Ga0207689_100129544 | 190 |
| 556 | 3300025942 | Ga0207689_10022449 | Ga0207689_100224494 | 190 |
| 557 | 3300025942 | Ga0207689_10023916 | Ga0207689_100239164 | 190 |
| 558 | 3300025942 | Ga0207689_10067436 | Ga0207689_100674361 | 190 |
| 559 | 3300025942 | Ga0207689_10077907 | Ga0207689_100779072 | 190 |
| 560 | 3300025944 | Ga0207661_10015192 | Ga0207661_100151922 | 190 |
| 561 | 3300025944 | Ga0207661_10466835 | Ga0207661_104668352 | 190 |
| 562 | 3300025944 | Ga0207661_10649239 | Ga0207661_106492391 | 190 |
| 563 | 3300025945 | Ga0207679_10001622 | Ga0207679_100016229 | 190 |
| 564 | 3300025945 | Ga0207679_10432389 | Ga0207679_104323891 | 190 |
| 565 | 3300025949 | Ga0207667_10178887 | Ga0207667_101788872 | 190 |
| 566 | 3300025949 | Ga0207667_10232600 | Ga0207667_102326002 | 190 |
| 567 | 3300025960 | Ga0207651_10003648 | Ga0207651_100036486 | 190 |
| 568 | 3300025960 | Ga0207651_10023738 | Ga0207651_100237385 | 190 |
| 569 | 3300025960 | Ga0207651_10047510 | Ga0207651_100475103 | 190 |
| 570 | 3300025961 | Ga0207712_10002942 | Ga0207712_100029428 | 190 |
| 571 | 3300025972 | Ga0207668_10000514 | Ga0207668_100005148 | 190 |
| 572 | 3300025972 | Ga0207668_10240264 | Ga0207668_102402642 | 190 |
| 573 | 3300025981 | Ga0207640_10317530 | Ga0207640_103175301 | 190 |
| 574 | 3300025986 | Ga0207658_10004126 | Ga0207658_100041266 | 190 |
| 575 | 3300025986 | Ga0207658_10121304 | Ga0207658_101213042 | 190 |
| 576 | 3300025986 | Ga0207658_10529642 | Ga0207658_105296422 | 190 |
| 577 | 3300025986 | Ga0207658_10583704 | Ga0207658_105837042 | 190 |
| 578 | 3300026023 | Ga0207677_10002620 | Ga0207677_100026204 | 190 |
| 579 | 3300026023 | Ga0207677_10014804 | Ga0207677_100148042 | 190 |
| 580 | 3300026035 | Ga0207703_10006377 | Ga0207703_100063775 | 190 |
| 581 | 3300026035 | Ga0207703_10547498 | Ga0207703_105474981 | 190 |
| 582 | 3300026035 | Ga0207703_11347763 | Ga0207703_113477631 | 190 |
| 583 | 3300026041 | Ga0207639_10025183 | Ga0207639_100251835 | 190 |
| 584 | 3300026041 | Ga0207639_10132463 | Ga0207639_101324633 | 190 |
| 585 | 3300026067 | Ga0207678_10048119 | Ga0207678_100481195 | 190 |
| 586 | 3300026088 | Ga0207641_10006788 | Ga0207641_100067884 | 190 |
| 587 | 3300026088 | Ga0207641_10292124 | Ga0207641_102921241 | 190 |
| 588 | 3300026089 | Ga0207648_10001955 | Ga0207648_1000195514 | 190 |
| 589 | 3300026089 | Ga0207648_10006356 | Ga0207648_100063565 | 190 |
| 590 | 3300026089 | Ga0207648_10024957 | Ga0207648_100249575 | 190 |
| 591 | 3300026089 | Ga0207648_10206548 | Ga0207648_102065483 | 190 |
| 592 | 3300026095 | Ga0207676_10006594 | Ga0207676_100065946 | 190 |
| 593 | 3300026116 | Ga0207674_10385921 | Ga0207674_103859212 | 190 |
| 594 | 3300026118 | Ga0207675_100009475 | Ga0207675_1000094757 | 190 |
| 595 | 3300026118 | Ga0207675_100019228 | Ga0207675_1000192285 | 190 |
| 596 | 3300026118 | Ga0207675_100954772 | Ga0207675_1009547722 | 190 |
| 597 | 3300026121 | Ga0207683_10003845 | Ga0207683_100038455 | 190 |
| 598 | 3300026142 | Ga0207698_10022200 | Ga0207698_100222003 | 190 |
| 599 | 3300026142 | Ga0207698_10101490 | Ga0207698_101014902 | 190 |
| 600 | 3300026142 | Ga0207698_10687034 | Ga0207698_106870342 | 190 |
| 601 | 3300028379 | Ga0268266_10006796 | Ga0268266_100067967 | 190 |
| 602 | 3300028380 | Ga0268265_10432795 | Ga0268265_104327952 | 190 |
| 603 | 3300028381 | Ga0268264_10010248 | Ga0268264_100102484 | 190 |
| 604 | 3300028381 | Ga0268264_10014008 | Ga0268264_100140085 | 190 |
| 605 | 3300028381 | Ga0268264_10291970 | Ga0268264_102919702 | 190 |
| 606 | 3300028381 | Ga0268264_11199342 | Ga0268264_111993422 | 190 |
| 607 | 3300030521 | Ga0307511_10000076 | Ga0307511_100000765 | 190 |
| 608 | 3300031247 | Ga0265340_10036934 | Ga0265340_100369342 | 190 |
| 609 | 3300031251 | Ga0265327_10018351 | Ga0265327_100183512 | 190 |
| 610 | 3300031507 | Ga0307509_10404052 | Ga0307509_104040522 | 190 |
| 611 | 3300031595 | Ga0265313_10066817 | Ga0265313_100668172 | 190 |
| 612 | 3300031730 | Ga0307516_10273191 | Ga0307516_102731912 | 190 |
| 613 | 3300031731 | Ga0307405_11073395 | Ga0307405_110733951 | 190 |
| 614 | 3300032002 | Ga0307416_100698974 | Ga0307416_1006989741 | 190 |
| 615 | 3300032004 | Ga0307414_10126860 | Ga0307414_101268601 | 190 |
| 616 | 3300033180 | Ga0307510_10005955 | Ga0307510_100059557 | 190 |
| 617 | 3300035410 | Ga0373924_0317785 | Ga0373924_0317785_24_623 | 190 |
| 618 | 3300035692 | Ga0373935_0294447 | Ga0373935_0294447_209_790 | 190 |
| 619 | 3300036401 | Ga0373937_0019641 | Ga0373937_0019641_221_820 | 190 |
| 620 | 3300036401 | Ga0373937_0021464 | Ga0373937_0021464_1474_2055 | 190 |
| 621 | 3300036401 | Ga0373937_0096634 | Ga0373937_0096634_1217_1798 | 190 |
| 622 | 3300046454 | Ga0495592_0140843 | Ga0495592_0140843_281_880 | 190 |
| 623 | 3300046455 | Ga0495603_0228239 | Ga0495603_0228239_249_848 | 190 |
| 624 | 3300046460 | Ga0495638_0075489 | Ga0495638_0075489_864_1439 | 190 |
| 625 | 3300046460 | Ga0495638_0226480 | Ga0495638_0226480_53_637 | 190 |
| 626 | 3300046473 | Ga0495582_0039653 | Ga0495582_0039653_58_639 | 190 |
| 627 | 3300046507 | Ga0495606_0007339 | Ga0495606_0007339_5922_6506 | 190 |
| 628 | 3300046516 | Ga0495628_0115970 | Ga0495628_0115970_1331_1930 | 190 |
| 629 | 3300046517 | Ga0495630_0103456 | Ga0495630_0103456_1303_1884 | 190 |
| 630 | 3300046531 | Ga0495665_0207860 | Ga0495665_0207860_183_764 | 190 |
| 631 | 3300046535 | Ga0495586_0056497 | Ga0495586_0056497_192_773 | 190 |
| 632 | 3300046535 | Ga0495586_0302383 | Ga0495586_0302383_244_843 | 190 |
| 633 | 3300046543 | Ga0495645_0305333 | Ga0495645_0305333_190_789 | 190 |
| 634 | 3300046558 | Ga0495633_0052789 | Ga0495633_0052789_635_1216 | 190 |
| 635 | 3300046642 | Ga0495634_0038674 | Ga0495634_0038674_995_1594 | 190 |
| 636 | 3300046648 | Ga0495611_0001743 | Ga0495611_0001743_3522_4106 | 190 |
| 637 | 3300046663 | Ga0495635_0670860 | Ga0495635_0670860_62_661 | 190 |
| 638 | 3300046675 | Ga0495657_0460042 | Ga0495657_0460042_60_659 | 190 |
| 639 | 3300046678 | Ga0495599_0137916 | Ga0495599_0137916_425_1024 | 190 |
| 640 | 3300046683 | Ga0495658_0056145 | Ga0495658_0056145_431_1012 | 190 |
| 641 | 3300046691 | Ga0495670_0008617 | Ga0495670_0008617_2028_2609 | 190 |
| 642 | 3300046809 | Ga0495600_0179947 | Ga0495600_0179947_159_758 | 190 |
| 643 | 3300047319 | Ga0495674_0058855 | Ga0495674_0058855_663_1244 | 190 |
| 644 | 3300047320 | Ga0495672_0086171 | Ga0495672_0086171_188_772 | 190 |
| 645 | 3300047471 | Ga0495684_0100619 | Ga0495684_0100619_817_1416 | 190 |
| 646 | 3300047471 | Ga0495684_0310765 | Ga0495684_0310765_193_774 | 190 |
| 647 | 3300047472 | Ga0495686_0000005 | Ga0495686_0000005_617570_618154 | 190 |
| 648 | 3300048903 | Ga0496100_0908163 | Ga0496100_0908163_10_609 | 190 |
| 649 | 3300048907 | Ga0496104_0590565 | Ga0496104_0590565_306_887 | 190 |
| 650 | 3300048917 | Ga0496114_0273822 | Ga0496114_0273822_182_763 | 190 |
| 651 | 3300049571 | Ga0501034_0355495 | Ga0501034_0355495_81_779 | 190 |
| 652 | 3300049574 | Ga0501038_0002256 | Ga0501038_0002256_1434_2132 | 190 |
| 653 | 3300049575 | Ga0501039_0081163 | Ga0501039_0081163_522_1220 | 190 |
| 654 | 3300049584 | Ga0501068_0132718 | Ga0501068_0132718_772_1470 | 190 |
| 655 | 3300049823 | Ga0501044_0026464 | Ga0501044_0026464_690_1388 | 190 |
| 656 | 3300050514 | nmdc:mga08x19_226271_c1 | nmdc:mga08x19_226271_c1_197_802 | 190 |
| 657 | 3300053085 | Ga0495619_0060746 | Ga0495619_0060746_223_822 | 190 |
| 658 | 3300053092 | Ga0500583_0158573 | Ga0500583_0158573_418_1002 | 190 |
| 659 | 3300053146 | Ga0500588_0115282 | Ga0500588_0115282_28_612 | 190 |
| 660 | 3300053178 | Ga0500637_0290982 | Ga0500637_0290982_41_625 | 190 |
| 661 | 3300053727 | Ga0500611_000003 | Ga0500611_000003_229021_229596 | 190 |
| 662 | 3300060353 | Ga0501082_0628135 | Ga0501082_0628135_40_738 | 190 |
| 663 | 3300000545 | CNXas_1000706 | CNXas_10007063 | 192 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6uxt-assembly1.cif.gz_A | crystal structure of unknown function protein yfdx from shigella flexneri | 0.9572 | 61 | 97 |
| 7cub-assembly1.cif.gz_C | 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane | 0.8872 | 19 | 192 |
| 8hcr-assembly1.cif.gz_S | cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci | 0.8708 | 13 | 183 |
| 6adq-assembly1.cif.gz_S | respiratory complex ciii2civ2sod2 from mycobacterium smegmatis | 0.8692 | 21 | 182 |
| 8dh6-assembly1.cif.gz_c | cryo-em structure of saccharomyces cerevisiae cytochrome c oxidase (complex iv) extracted in lipid nanodiscs | 0.866 | 19 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q69QX2_16_155_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9801 | 60 | 96 | 1.25.40.10 |
| af_K7L171_45_128_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9719 | 60 | 100 | 1.25.40.10 |
| af_Q94K88_63_147_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.968 | 60 | 100 | 1.25.40.10 |
| af_A0A1D6NW80_40_127_1.20.58.80 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit | 0.8895 | 54 | 99 | 1.20.58.80 |
| af_P9WP67_20_203_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.8818 | 12 | 183 | 1.20.120.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M9CY49-F1-model_v4 | Cytochrome c oxidase subunit 3 | 0.9701 | 10 | 189 |
GO:0004129
GO:0005886 GO:0019646 |
| AF-A0A1J5SN52-F1-model_v4 | Cytochrome c oxidase subunit 3 (EC 1.9.3.1) | 0.9657 | 12 | 187 |
GO:0004129
GO:0016020 GO:0019646 |
| AF-A0A4V3GLI3-F1-model_v4 | Cytochrome c oxidase subunit 3 | 0.9614 | 12 | 189 |
GO:0004129
GO:0005886 GO:0019646 |
| AF-A0A4Q3RBB8-F1-model_v4 | Heme-copper oxidase subunit III | 0.9612 | 31 | 188 |
GO:0004129
GO:0005886 GO:0019646 |
| AF-A0A3M1NEG7-F1-model_v4 | Heme-copper oxidase subunit III | 0.953 | 12 | 192 |
GO:0004129
GO:0005886 GO:0019646 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar