F473551

General Info

Members Datasets Scaffolds Average Seq Length
663 257 663 192

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100413795|Ga0075436_1004137952
Length 201
Sequence MLSDISLKQSQNTPSTGGDRGKRIHPHKFTLWVAIGSIIMMFAGLTSAYIVKSNQAGWQSIEMPNIFWYSTGTIVLSSIMMQMALRSFKQREMNHYRLLIAGTFILGVTFVILQWIGFRQLWNSGIQFKGSSGGGQFLYVIAGLHALHVFGGVIALMVMFIKAFFGRVKLYSSVPVELMATYWHFVDFLWIYLLVFFMLIG

Samples

Sample ID Description Type Environment
1 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
146 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
168 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
169 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
170 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
171 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
172 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
195 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
233 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
234 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
235 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
236 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
237 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
251 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
252 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
253 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
254 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.66
Nodule 0
Rhizoplane 0.75
Rhizosphere 95.63
Stem 0
Stem Tuber 0
Unclassified 1.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000706 3300000545 Bacteria 2171
2 JGI24744J21845_10024993 3300002077 Bacteria 1165
3 rootH2_10027245 3300003320 Bacteria 5760
4 rootL2_10072075 3300003322 Bacteria 1882
5 rootL2_10326007 3300003322 Bacteria 1696
6 rootH1_10243153 3300003323 Bacteria 1076
7 Ga0065712_10181075 3300005290 Bacteria 1192
8 Ga0065712_10284438 3300005290 Bacteria 869
9 Ga0070658_10012615 3300005327 Bacteria 6779
10 Ga0070676_10014319 3300005328 Bacteria 4359
11 Ga0070676_10018990 3300005328 Bacteria 3819
12 Ga0070676_10020683 3300005328 Bacteria 3678
13 Ga0070676_10355691 3300005328 Bacteria 1008
14 Ga0070683_100191390 3300005329 Bacteria 1942
15 Ga0070683_100418339 3300005329 Bacteria 1278
16 Ga0070683_100936182 3300005329 Bacteria 831
17 Ga0070690_100031252 3300005330 Bacteria 3316
18 Ga0070690_100096016 3300005330 Bacteria 1958
19 Ga0070690_100247796 3300005330 Bacteria 1259
20 Ga0070690_100471088 3300005330 Bacteria 935
21 Ga0070670_100791104 3300005331 Bacteria 856
22 Ga0068869_100015272 3300005334 Bacteria 5147
23 Ga0068869_100027016 3300005334 Bacteria 3999
24 Ga0068869_100040117 3300005334 Bacteria 3346
25 Ga0068869_100074258 3300005334 Bacteria 2523
26 Ga0068869_100188094 3300005334 Bacteria 1622
27 Ga0068869_100761899 3300005334 Unclassified 829
28 Ga0070666_10002756 3300005335 Bacteria 10618
29 Ga0070666_10041311 3300005335 Bacteria 3081
30 Ga0070666_10053529 3300005335 Bacteria 2722
31 Ga0070666_10058363 3300005335 Bacteria 2609
32 Ga0068868_100003574 3300005338 Bacteria 10828
33 Ga0068868_100007171 3300005338 Bacteria 7920
34 Ga0068868_100008105 3300005338 Bacteria 7514
35 Ga0068868_100013885 3300005338 Bacteria 5920
36 Ga0068868_100176158 3300005338 Bacteria 1772
37 Ga0068868_101510350 3300005338 Unclassified 629
38 Ga0070660_100931232 3300005339 Unclassified 733
39 Ga0070689_100138505 3300005340 Bacteria 1955
40 Ga0070689_100578268 3300005340 Unclassified 971
41 Ga0070689_101072005 3300005340 Unclassified 719
42 Ga0070687_100006709 3300005343 Bacteria 4739
43 Ga0070661_100010809 3300005344 Bacteria 6354
44 Ga0070661_100019264 3300005344 Bacteria 4862
45 Ga0070661_100058296 3300005344 Bacteria 2830
46 Ga0070661_100304644 3300005344 Bacteria 1241
47 Ga0070661_100319166 3300005344 Bacteria 1213
48 Ga0070661_100467337 3300005344 Bacteria 1005
49 Ga0070661_100676657 3300005344 Bacteria 839
50 Ga0070692_10833372 3300005345 Bacteria 632
51 Ga0070668_100001487 3300005347 Bacteria 16922
52 Ga0070668_100009928 3300005347 Bacteria 7051
53 Ga0070669_100037400 3300005353 Bacteria 3521
54 Ga0070669_100378550 3300005353 Bacteria 1154
55 Ga0070675_100022703 3300005354 Bacteria 5013
56 Ga0070675_100046846 3300005354 Bacteria 3542
57 Ga0070675_100076880 3300005354 Unclassified 2777
58 Ga0070675_100791776 3300005354 Bacteria 866
59 Ga0070671_100007908 3300005355 Bacteria 8501
60 Ga0070671_100153841 3300005355 Bacteria 1942
61 Ga0070671_100736279 3300005355 Bacteria 856
62 Ga0070674_100049306 3300005356 Bacteria 2894
63 Ga0070674_100066226 3300005356 Bacteria 2538
64 Ga0070673_100025956 3300005364 Bacteria 4320
65 Ga0070673_100060620 3300005364 Bacteria 2999
66 Ga0070673_100306920 3300005364 Bacteria 1399
67 Ga0070688_100012159 3300005365 Bacteria 4813
68 Ga0070688_100029947 3300005365 Bacteria 3263
69 Ga0070688_100215677 3300005365 Bacteria 1350
70 Ga0070659_100075000 3300005366 Bacteria 2696
71 Ga0070659_100531771 3300005366 Bacteria 1005
72 Ga0070659_100617771 3300005366 Bacteria 933
73 Ga0070667_100021240 3300005367 Bacteria 5393
74 Ga0070667_100039008 3300005367 Bacteria 3982
75 Ga0070667_100071668 3300005367 Bacteria 2951
76 Ga0070667_100151519 3300005367 Bacteria 2037
77 Ga0070667_100430442 3300005367 Bacteria 1204
78 Ga0070667_100489979 3300005367 Unclassified 1126
79 Ga0070667_100651887 3300005367 Bacteria 972
80 Ga0070663_100091947 3300005455 Bacteria 2249
81 Ga0070663_100119899 3300005455 Bacteria 1986
82 Ga0070678_100043720 3300005456 Bacteria 3194
83 Ga0070678_100046738 3300005456 Bacteria 3106
84 Ga0070678_100190194 3300005456 Bacteria 1687
85 Ga0070662_100001127 3300005457 Bacteria 16320
86 Ga0070662_100011969 3300005457 Bacteria 5738
87 Ga0070662_100013705 3300005457 Bacteria 5400
88 Ga0070662_100070814 3300005457 Bacteria 2570
89 Ga0070662_100328508 3300005457 Bacteria 1249
90 Ga0070681_10045020 3300005458 Bacteria 4417
91 Ga0070681_11435717 3300005458 Bacteria 614
92 Ga0068867_100026025 3300005459 Bacteria 4197
93 Ga0068867_100055002 3300005459 Bacteria 2941
94 Ga0068867_100077338 3300005459 Bacteria 2500
95 Ga0068867_100090140 3300005459 Bacteria 2326
96 Ga0068867_100169885 3300005459 Bacteria 1726
97 Ga0070685_10003854 3300005466 Bacteria 7589
98 Ga0070685_10063093 3300005466 Bacteria 2175
99 Ga0070685_10542127 3300005466 Bacteria 829
100 Ga0070684_100002074 3300005535 Bacteria 14766
101 Ga0070684_100021281 3300005535 Bacteria 5394
102 Ga0070684_100190517 3300005535 Bacteria 1866
103 Ga0068853_100026519 3300005539 Bacteria 4866
104 Ga0068853_100057447 3300005539 Unclassified 3358
105 Ga0068853_100067657 3300005539 Bacteria 3104
106 Ga0068853_100091687 3300005539 Bacteria 2673
107 Ga0068853_100289597 3300005539 Bacteria 1512
108 Ga0068853_100296514 3300005539 Bacteria 1493
109 Ga0068853_100313542 3300005539 Bacteria 1453
110 Ga0068853_100647209 3300005539 Bacteria 1006
111 Ga0070672_100005202 3300005543 Bacteria 8607
112 Ga0070672_100008264 3300005543 Bacteria 7113
113 Ga0070672_100085732 3300005543 Bacteria 2532
114 Ga0070672_100195370 3300005543 Bacteria 1691
115 Ga0070686_100041453 3300005544 Bacteria 2878
116 Ga0070693_100255075 3300005547 Bacteria 1164
117 Ga0070693_100714743 3300005547 Unclassified 735
118 Ga0070665_100000014 3300005548 Bacteria 484881
119 Ga0070665_100056759 3300005548 Bacteria 3926
120 Ga0070665_100381189 3300005548 Bacteria 1417
121 Ga0070665_100410328 3300005548 Bacteria 1363
122 Ga0070665_100548896 3300005548 Bacteria 1168
123 Ga0068855_100001990 3300005563 Bacteria 25375
124 Ga0068855_100073045 3300005563 Bacteria 3986
125 Ga0068855_100127618 3300005563 Bacteria 2907
126 Ga0068855_100220498 3300005563 Bacteria 2127
127 Ga0068855_100396567 3300005563 Bacteria 1513
128 Ga0068855_101245394 3300005563 Bacteria 772
129 Ga0070664_100002665 3300005564 Bacteria 14400
130 Ga0070664_100341116 3300005564 Bacteria 1361
131 Ga0070664_100840199 3300005564 Bacteria 860
132 Ga0068857_100002147 3300005577 Bacteria 16027
133 Ga0068857_100021713 3300005577 Bacteria 5648
134 Ga0068857_100100927 3300005577 Bacteria 2589
135 Ga0068857_100104372 3300005577 Bacteria 2544
136 Ga0068857_100255575 3300005577 Unclassified 1607
137 Ga0068857_100430041 3300005577 Bacteria 1232
138 Ga0068854_100023210 3300005578 Bacteria 4235
139 Ga0068854_100047100 3300005578 Bacteria 3072
140 Ga0068854_100134265 3300005578 Bacteria 1893
141 Ga0068854_100268281 3300005578 Bacteria 1369
142 Ga0068854_100462433 3300005578 Bacteria 1062
143 Ga0068856_100028452 3300005614 Bacteria 5458
144 Ga0068856_100042327 3300005614 Bacteria 4480
145 Ga0068856_100056543 3300005614 Bacteria 3871
146 Ga0068852_100012296 3300005616 Bacteria 6492
147 Ga0068852_100031270 3300005616 Bacteria 4391
148 Ga0068852_100045007 3300005616 Bacteria 3752
149 Ga0068852_100102778 3300005616 Bacteria 2583
150 Ga0068852_100131504 3300005616 Bacteria 2305
151 Ga0068852_100163276 3300005616 Bacteria 2081
152 Ga0068852_100294580 3300005616 Bacteria 1569
153 Ga0068859_100002273 3300005617 Bacteria 19500
154 Ga0068859_100032409 3300005617 Bacteria 5250
155 Ga0068859_100072081 3300005617 Bacteria 3490
156 Ga0068859_100092631 3300005617 Bacteria 3073
157 Ga0068859_100097017 3300005617 Bacteria 3000
158 Ga0068864_100046417 3300005618 Bacteria 3727
159 Ga0068864_100135996 3300005618 Bacteria 2213
160 Ga0068864_100356178 3300005618 Viruses 1382
161 Ga0068864_101117914 3300005618 Bacteria 785
162 Ga0068861_100009713 3300005719 Bacteria 6652
163 Ga0068861_100092367 3300005719 Bacteria 2391
164 Ga0068861_100386590 3300005719 Unclassified 1238
165 Ga0068861_100631836 3300005719 Bacteria 987
166 Ga0068851_10004181 3300005834 Bacteria 6503
167 Ga0068870_10156742 3300005840 Bacteria 1346
168 Ga0068863_100005185 3300005841 Bacteria 12851
169 Ga0068863_100129113 3300005841 Bacteria 2413
170 Ga0068863_100302435 3300005841 Bacteria 1552
171 Ga0068863_100316193 3300005841 Unclassified 1516
172 Ga0068863_100714170 3300005841 Bacteria 997
173 Ga0068863_101198808 3300005841 Bacteria 765
174 Ga0068858_100002187 3300005842 Bacteria 19799
175 Ga0068858_100309167 3300005842 Bacteria 1509
176 Ga0068860_100000024 3300005843 Bacteria 271902
177 Ga0068860_100000691 3300005843 Bacteria 38802
178 Ga0068860_100010899 3300005843 Bacteria 8965
179 Ga0068860_100104673 3300005843 Bacteria 2702
180 Ga0068860_100429764 3300005843 Bacteria 1310
181 Ga0068862_100452765 3300005844 Bacteria 1210
182 Ga0081540_1013840 3300005983 Bacteria 5217
183 Ga0081539_10047752 3300005985 Bacteria 2441
184 Ga0070715_10094422 3300006163 Bacteria 1383
185 Ga0075366_10008625 3300006195 Bacteria 5675
186 Ga0075366_10012354 3300006195 Bacteria 4842
187 Ga0097621_100005475 3300006237 Bacteria 8938
188 Ga0097621_100018519 3300006237 Bacteria 5323
189 Ga0097621_100056807 3300006237 Bacteria 3198
190 Ga0097621_100210073 3300006237 Bacteria 1693
191 Ga0097621_100219087 3300006237 Bacteria 1658
192 Ga0097621_100259485 3300006237 Bacteria 1524
193 Ga0097621_101159982 3300006237 Bacteria 727
194 Ga0068871_100022329 3300006358 Bacteria 4878
195 Ga0068871_100053443 3300006358 Bacteria 3274
196 Ga0068871_100167943 3300006358 Bacteria 1879
197 Ga0068871_100224705 3300006358 Bacteria 1628
198 Ga0068871_100412353 3300006358 Bacteria 1205
199 Ga0075434_100044282 3300006871 Bacteria 4415
200 Ga0068865_100006196 3300006881 Bacteria 7291
201 Ga0068865_100034522 3300006881 Bacteria 3394
202 Ga0068865_100053771 3300006881 Bacteria 2795
203 Ga0068865_100349662 3300006881 Bacteria 1197
204 Ga0068865_100483463 3300006881 Bacteria 1029
205 Ga0075436_100413795 3300006914 Bacteria 978
206 Ga0097620_100002273 3300006931 Bacteria 19500
207 Ga0097620_100032409 3300006931 Bacteria 5250
208 Ga0097620_100072079 3300006931 Bacteria 3490
209 Ga0097620_100092635 3300006931 Bacteria 3073
210 Ga0097620_100097017 3300006931 Bacteria 3000
211 Ga0097620_100534384 3300006931 Bacteria 1267
212 Ga0105240_10000106 3300009093 Bacteria 171825
213 Ga0105240_10002904 3300009093 Bacteria 27043
214 Ga0105240_10006529 3300009093 Bacteria 17125
215 Ga0105240_10022621 3300009093 Bacteria 8327
216 Ga0105240_10042604 3300009093 Bacteria 5784
217 Ga0105240_10133685 3300009093 Bacteria 2972
218 Ga0105240_10396227 3300009093 Bacteria 1556
219 Ga0111539_10071473 3300009094 Bacteria 4094
220 Ga0105245_10063131 3300009098 Bacteria 3344
221 Ga0105245_10233630 3300009098 Bacteria 1779
222 Ga0105247_10002404 3300009101 Bacteria 12733
223 Ga0105247_10121504 3300009101 Bacteria 1693
224 Ga0105247_10538032 3300009101 Bacteria 857
225 Ga0105241_10001117 3300009174 Bacteria 20448
226 Ga0105241_10042451 3300009174 Bacteria 3441
227 Ga0105241_10062358 3300009174 Bacteria 2874
228 Ga0105241_10093641 3300009174 Bacteria 2374
229 Ga0105242_10012927 3300009176 Bacteria 6435
230 Ga0105242_10320433 3300009176 Bacteria 1421
231 Ga0105242_10647460 3300009176 Unclassified 1027
232 Ga0105248_10084854 3300009177 Bacteria 3563
233 Ga0105248_10837533 3300009177 Bacteria 1038
234 Ga0105237_10000561 3300009545 Bacteria 51951
235 Ga0105237_10005940 3300009545 Bacteria 13687
236 Ga0105237_10014958 3300009545 Bacteria 8089
237 Ga0105237_10018678 3300009545 Bacteria 7168
238 Ga0105238_10001211 3300009551 Bacteria 25984
239 Ga0105238_10017549 3300009551 Bacteria 7278
240 Ga0105238_10089770 3300009551 Bacteria 3060
241 Ga0105238_10131358 3300009551 Bacteria 2482
242 Ga0105249_10005427 3300009553 Bacteria 11006
243 Ga0105249_10048728 3300009553 Bacteria 3862
244 Ga0105249_10112821 3300009553 Bacteria 2571
245 Ga0105249_10116464 3300009553 Bacteria 2533
246 Ga0105249_10124897 3300009553 Bacteria 2449
247 Ga0105249_10318984 3300009553 Bacteria 1565
248 Ga0105249_10409303 3300009553 Bacteria 1388
249 Ga0105239_10000580 3300010375 Bacteria 52245
250 Ga0105239_10003763 3300010375 Bacteria 18449
251 Ga0105239_10007405 3300010375 Bacteria 12592
252 Ga0105239_10009676 3300010375 Bacteria 10839
253 Ga0105239_10015390 3300010375 Bacteria 8475
254 Ga0105239_10030051 3300010375 Bacteria 5975
255 Ga0105239_10211340 3300010375 Bacteria 2175
256 Ga0105239_10353094 3300010375 Bacteria 1660
257 Ga0105239_10604079 3300010375 Bacteria 1251
258 Ga0105239_10661080 3300010375 Bacteria 1194
259 Ga0105239_10662127 3300010375 Bacteria 1193
260 Ga0105239_11301017 3300010375 Bacteria 839
261 Ga0105246_10001264 3300011119 Bacteria 14839
262 Ga0105246_10143669 3300011119 Bacteria 1798
263 Ga0105246_10969391 3300011119 Bacteria 768
264 Ga0157373_10068009 3300013100 Bacteria 2519
265 Ga0157373_10184227 3300013100 Bacteria 1471
266 Ga0157373_10835971 3300013100 Bacteria 680
267 Ga0157371_10421205 3300013102 Unclassified 979
268 Ga0157370_10004229 3300013104 Bacteria 16610
269 Ga0157370_10026848 3300013104 Bacteria 5680
270 Ga0157369_10288022 3300013105 Bacteria 1710
271 Ga0157369_10319984 3300013105 Bacteria 1613
272 Ga0157369_11300717 3300013105 Bacteria 741
273 Ga0157374_10000011 3300013296 Bacteria 466749
274 Ga0157374_10038728 3300013296 Unclassified 4383
275 Ga0157374_10058869 3300013296 Bacteria 3590
276 Ga0157374_10119566 3300013296 Bacteria 2541
277 Ga0157374_10135901 3300013296 Bacteria 2383
278 Ga0157378_10006519 3300013297 Bacteria 10203
279 Ga0157378_10021695 3300013297 Bacteria 5646
280 Ga0157378_10036639 3300013297 Bacteria 4341
281 Ga0157378_10434717 3300013297 Unclassified 1299
282 Ga0157378_10703313 3300013297 Bacteria 1030
283 Ga0163162_10001367 3300013306 Bacteria 22697
284 Ga0163162_10001786 3300013306 Bacteria 20177
285 Ga0163162_10002933 3300013306 Bacteria 16276
286 Ga0163162_10023782 3300013306 Bacteria 6047
287 Ga0163162_10048969 3300013306 Bacteria 4235
288 Ga0163162_10078768 3300013306 Bacteria 3361
289 Ga0163162_10165389 3300013306 Unclassified 2335
290 Ga0163162_10199989 3300013306 Bacteria 2127
291 Ga0163162_10242383 3300013306 Bacteria 1934
292 Ga0163162_10242469 3300013306 Bacteria 1933
293 Ga0163162_10279101 3300013306 Bacteria 1803
294 Ga0163162_10785843 3300013306 Bacteria 1070
295 Ga0157372_10000171 3300013307 Bacteria 71956
296 Ga0157372_10000463 3300013307 Bacteria 44664
297 Ga0157372_10181378 3300013307 Bacteria 2437
298 Ga0157372_10322297 3300013307 Bacteria 1799
299 Ga0157372_10403572 3300013307 Bacteria 1593
300 Ga0157372_10630786 3300013307 Unclassified 1249
301 Ga0157375_10009867 3300013308 Bacteria 8397
302 Ga0157375_10055142 3300013308 Bacteria 3918
303 Ga0157375_10085503 3300013308 Bacteria 3204
304 Ga0157375_10121739 3300013308 Bacteria 2719
305 Ga0157375_10257203 3300013308 Bacteria 1907
306 Ga0157375_10328462 3300013308 Bacteria 1694
307 Ga0157375_10470675 3300013308 Bacteria 1422
308 Ga0157375_10814121 3300013308 Bacteria 1082
309 Ga0163163_10001998 3300014325 Bacteria 17228
310 Ga0163163_10005703 3300014325 Bacteria 10797
311 Ga0163163_10089414 3300014325 Bacteria 3091
312 Ga0163163_10254464 3300014325 Viruses 1807
313 Ga0163163_10553015 3300014325 Bacteria 1213
314 Ga0163163_10645329 3300014325 Bacteria 1122
315 Ga0157380_10122130 3300014326 Bacteria 2208
316 Ga0157380_10350484 3300014326 Bacteria 1381
317 Ga0157380_10667978 3300014326 Bacteria 1039
318 Ga0157380_10780370 3300014326 Unclassified 970
319 Ga0157380_11040956 3300014326 Bacteria 854
320 Ga0157377_10010026 3300014745 Bacteria 4674
321 Ga0157379_10010876 3300014968 Bacteria 7931
322 Ga0157379_10018539 3300014968 Bacteria 6140
323 Ga0157379_10304355 3300014968 Bacteria 1453
324 Ga0157379_10430730 3300014968 Bacteria 1216
325 Ga0157379_10643729 3300014968 Bacteria 992
326 Ga0157379_10884674 3300014968 Bacteria 847
327 Ga0157376_10013842 3300014969 Bacteria 6032
328 Ga0157376_10023416 3300014969 Bacteria 4832
329 Ga0157376_10026592 3300014969 Bacteria 4575
330 Ga0157376_10150053 3300014969 Bacteria 2101
331 Ga0157376_10240327 3300014969 Bacteria 1687
332 Ga0157376_10265119 3300014969 Bacteria 1611
333 Ga0157376_10494472 3300014969 Bacteria 1201
334 Ga0157376_11315761 3300014969 Unclassified 753
335 Ga0157376_11355907 3300014969 Unclassified 742
336 Ga0163161_10008435 3300017792 Bacteria 7134
337 Ga0163161_10024623 3300017792 Bacteria 4253
338 Ga0163161_10070335 3300017792 Bacteria 2559
339 Ga0163161_10142880 3300017792 Bacteria 1813
340 Ga0207697_10226660 3300025315 Bacteria 825
341 Ga0207656_10006384 3300025321 Bacteria 4232
342 Ga0207642_10004323 3300025899 Bacteria 4579
343 Ga0207642_10160687 3300025899 Unclassified 1206
344 Ga0207710_10001781 3300025900 Bacteria 10400
345 Ga0207688_10003300 3300025901 Bacteria 8816
346 Ga0207688_10058259 3300025901 Unclassified 2173
347 Ga0207680_10007538 3300025903 Bacteria 5315
348 Ga0207680_10047349 3300025903 Bacteria 2547
349 Ga0207680_10079798 3300025903 Bacteria 2053
350 Ga0207680_10084183 3300025903 Bacteria 2006
351 Ga0207680_10234927 3300025903 Bacteria 1261
352 Ga0207647_10004599 3300025904 Bacteria 10219
353 Ga0207647_10025873 3300025904 Bacteria 3847
354 Ga0207647_10107014 3300025904 Bacteria 1655
355 Ga0207685_10082641 3300025905 Unclassified 1333
356 Ga0207645_10003291 3300025907 Bacteria 12324
357 Ga0207645_10005892 3300025907 Bacteria 8831
358 Ga0207645_10223630 3300025907 Bacteria 1241
359 Ga0207643_10129266 3300025908 Bacteria 1502
360 Ga0207705_10045085 3300025909 Bacteria 3169
361 Ga0207654_10000620 3300025911 Bacteria 20025
362 Ga0207654_10024091 3300025911 Bacteria 3268
363 Ga0207654_10026063 3300025911 Bacteria 3162
364 Ga0207707_10214341 3300025912 Bacteria 1677
365 Ga0207695_10000087 3300025913 Bacteria 276412
366 Ga0207695_10000582 3300025913 Bacteria 74405
367 Ga0207695_10001064 3300025913 Bacteria 48020
368 Ga0207695_10003167 3300025913 Bacteria 23458
369 Ga0207695_10018118 3300025913 Bacteria 8149
370 Ga0207695_10036339 3300025913 Bacteria 5327
371 Ga0207695_10037729 3300025913 Bacteria 5212
372 Ga0207695_10203184 3300025913 Bacteria 1895
373 Ga0207671_10002275 3300025914 Bacteria 20777
374 Ga0207671_10002324 3300025914 Bacteria 20513
375 Ga0207671_10002511 3300025914 Bacteria 19577
376 Ga0207671_10008910 3300025914 Bacteria 8449
377 Ga0207662_10023616 3300025918 Bacteria 3534
378 Ga0207649_10068425 3300025920 Bacteria 2257
379 Ga0207649_10942154 3300025920 Bacteria 678
380 Ga0207694_10005398 3300025924 Bacteria 9836
381 Ga0207694_10040792 3300025924 Bacteria 3576
382 Ga0207694_10177014 3300025924 Bacteria 1728
383 Ga0207694_10187485 3300025924 Bacteria 1679
384 Ga0207659_10015767 3300025926 Bacteria 4906
385 Ga0207659_10060935 3300025926 Unclassified 2718
386 Ga0207659_10980117 3300025926 Bacteria 727
387 Ga0207687_10039213 3300025927 Bacteria 3242
388 Ga0207690_10313283 3300025932 Bacteria 1231
389 Ga0207706_10003305 3300025933 Bacteria 15441
390 Ga0207706_10004710 3300025933 Bacteria 12777
391 Ga0207706_10015998 3300025933 Bacteria 6778
392 Ga0207706_10054002 3300025933 Bacteria 3546
393 Ga0207706_10404618 3300025933 Unclassified 1183
394 Ga0207686_10029678 3300025934 Bacteria 3229
395 Ga0207686_10090156 3300025934 Unclassified 2022
396 Ga0207670_10016254 3300025936 Bacteria 4467
397 Ga0207670_10076046 3300025936 Bacteria 2336
398 Ga0207669_10037332 3300025937 Bacteria 2786
399 Ga0207669_10065043 3300025937 Bacteria 2260
400 Ga0207669_10069562 3300025937 Unclassified 2203
401 Ga0207704_10025253 3300025938 Bacteria 3238
402 Ga0207704_10038307 3300025938 Bacteria 2779
403 Ga0207704_10091562 3300025938 Bacteria 1999
404 Ga0207691_10001280 3300025940 Bacteria 25134
405 Ga0207691_10020036 3300025940 Bacteria 6327
406 Ga0207691_10031370 3300025940 Bacteria 4960
407 Ga0207691_10039933 3300025940 Bacteria 4340
408 Ga0207691_10542377 3300025940 Unclassified 986
409 Ga0207689_10001049 3300025942 Bacteria 26546
410 Ga0207689_10010413 3300025942 Bacteria 8005
411 Ga0207689_10012954 3300025942 Bacteria 7122
412 Ga0207689_10022449 3300025942 Bacteria 5307
413 Ga0207689_10023916 3300025942 Bacteria 5125
414 Ga0207689_10067436 3300025942 Bacteria 2941
415 Ga0207689_10077907 3300025942 Bacteria 2724
416 Ga0207689_10179033 3300025942 Unclassified 1748
417 Ga0207689_10285414 3300025942 Bacteria 1367
418 Ga0207689_10475385 3300025942 Bacteria 1046
419 Ga0207689_10497951 3300025942 Unclassified 1021
420 Ga0207661_10015192 3300025944 Bacteria 5661
421 Ga0207661_10053129 3300025944 Bacteria 3240
422 Ga0207661_10072945 3300025944 Bacteria 2810
423 Ga0207661_10466835 3300025944 Bacteria 1151
424 Ga0207661_10649239 3300025944 Unclassified 970
425 Ga0207679_10001622 3300025945 Bacteria 14023
426 Ga0207679_10043404 3300025945 Bacteria 3237
427 Ga0207679_10070163 3300025945 Bacteria 2640
428 Ga0207679_10432389 3300025945 Bacteria 1164
429 Ga0207667_10000584 3300025949 Bacteria 47412
430 Ga0207667_10001242 3300025949 Bacteria 31953
431 Ga0207667_10016385 3300025949 Bacteria 8378
432 Ga0207667_10020034 3300025949 Bacteria 7449
433 Ga0207667_10178887 3300025949 Bacteria 2179
434 Ga0207667_10232600 3300025949 Bacteria 1887
435 Ga0207667_10834000 3300025949 Unclassified 917
436 Ga0207651_10003648 3300025960 Bacteria 7594
437 Ga0207651_10023738 3300025960 Bacteria 3780
438 Ga0207651_10047510 3300025960 Bacteria 2895
439 Ga0207651_10107640 3300025960 Bacteria 2084
440 Ga0207712_10002942 3300025961 Bacteria 10882
441 Ga0207712_10047061 3300025961 Bacteria 2993
442 Ga0207712_10329655 3300025961 Unclassified 1262
443 Ga0207668_10000514 3300025972 Bacteria 24251
444 Ga0207668_10048032 3300025972 Bacteria 2926
445 Ga0207668_10173375 3300025972 Bacteria 1694
446 Ga0207668_10240264 3300025972 Bacteria 1465
447 Ga0207640_10022459 3300025981 Bacteria 3776
448 Ga0207640_10108873 3300025981 Bacteria 1959
449 Ga0207640_10220798 3300025981 Bacteria 1451
450 Ga0207640_10317530 3300025981 Bacteria 1239
451 Ga0207658_10004126 3300025986 Bacteria 10133
452 Ga0207658_10068969 3300025986 Bacteria 2670
453 Ga0207658_10121304 3300025986 Bacteria 2085
454 Ga0207658_10529642 3300025986 Unclassified 1052
455 Ga0207658_10583704 3300025986 Bacteria 1003
456 Ga0207658_10591604 3300025986 Bacteria 996
457 Ga0207677_10002620 3300026023 Bacteria 9469
458 Ga0207677_10014804 3300026023 Bacteria 4568
459 Ga0207677_10044906 3300026023 Bacteria 2947
460 Ga0207703_10006377 3300026035 Bacteria 9427
461 Ga0207703_10547498 3300026035 Unclassified 1091
462 Ga0207703_11347763 3300026035 Unclassified 686
463 Ga0207639_10025183 3300026041 Bacteria 4314
464 Ga0207639_10034764 3300026041 Bacteria 3727
465 Ga0207639_10132463 3300026041 Bacteria 2066
466 Ga0207639_10158522 3300026041 Bacteria 1904
467 Ga0207639_10237680 3300026041 Bacteria 1582
468 Ga0207639_10270654 3300026041 Bacteria 1490
469 Ga0207678_10048119 3300026067 Bacteria 3686
470 Ga0207708_10516618 3300026075 Unclassified 1003
471 Ga0207702_10038731 3300026078 Bacteria 3993
472 Ga0207702_10050648 3300026078 Bacteria 3506
473 Ga0207702_10084238 3300026078 Bacteria 2768
474 Ga0207702_10100657 3300026078 Bacteria 2550
475 Ga0207641_10006788 3300026088 Bacteria 9591
476 Ga0207641_10100939 3300026088 Unclassified 2542
477 Ga0207641_10115135 3300026088 Bacteria 2390
478 Ga0207641_10292124 3300026088 Bacteria 1537
479 Ga0207648_10001955 3300026089 Bacteria 22528
480 Ga0207648_10005292 3300026089 Bacteria 13021
481 Ga0207648_10006356 3300026089 Bacteria 11747
482 Ga0207648_10024957 3300026089 Bacteria 5328
483 Ga0207648_10092461 3300026089 Unclassified 2645
484 Ga0207648_10206548 3300026089 Bacteria 1743
485 Ga0207676_10006594 3300026095 Bacteria 8212
486 Ga0207676_10909651 3300026095 Bacteria 863
487 Ga0207674_10000453 3300026116 Bacteria 53589
488 Ga0207674_10037607 3300026116 Bacteria 5032
489 Ga0207674_10385921 3300026116 Bacteria 1354
490 Ga0207674_10432229 3300026116 Bacteria 1272
491 Ga0207674_10530736 3300026116 Bacteria 1137
492 Ga0207674_11030910 3300026116 Bacteria 792
493 Ga0207675_100009475 3300026118 Bacteria 9115
494 Ga0207675_100019228 3300026118 Bacteria 6373
495 Ga0207675_100426292 3300026118 Bacteria 1311
496 Ga0207675_100447412 3300026118 Bacteria 1280
497 Ga0207675_100954772 3300026118 Bacteria 875
498 Ga0207683_10000957 3300026121 Bacteria 26469
499 Ga0207683_10003845 3300026121 Bacteria 13020
500 Ga0207698_10018924 3300026142 Bacteria 4703
501 Ga0207698_10022200 3300026142 Bacteria 4405
502 Ga0207698_10094545 3300026142 Unclassified 2458
503 Ga0207698_10101490 3300026142 Bacteria 2386
504 Ga0207698_10442344 3300026142 Bacteria 1253
505 Ga0207698_10583537 3300026142 Bacteria 1100
506 Ga0207698_10687034 3300026142 Bacteria 1017
507 Ga0268266_10000048 3300028379 Bacteria 310336
508 Ga0268266_10006796 3300028379 Bacteria 10422
509 Ga0268266_10022104 3300028379 Bacteria 5422
510 Ga0268266_10146482 3300028379 Bacteria 2124
511 Ga0268265_10432795 3300028380 Bacteria 1224
512 Ga0268265_10583094 3300028380 Bacteria 1066
513 Ga0268264_10000028 3300028381 Bacteria 426662
514 Ga0268264_10010248 3300028381 Bacteria 7759
515 Ga0268264_10014008 3300028381 Bacteria 6593
516 Ga0268264_10291970 3300028381 Unclassified 1532
517 Ga0268264_11199342 3300028381 Bacteria 768
518 Ga0268264_11493738 3300028381 Unclassified 686
519 Ga0307517_10000268 3300028786 Bacteria 89531
520 Ga0307511_10000076 3300030521 Bacteria 82520
521 Ga0265340_10036934 3300031247 Bacteria 2420
522 Ga0265327_10018351 3300031251 Bacteria 4342
523 Ga0307509_10404052 3300031507 Bacteria 1072
524 Ga0307408_100448363 3300031548 Bacteria 1119
525 Ga0265313_10066817 3300031595 Bacteria 1665
526 Ga0307516_10000159 3300031730 Bacteria 84553
527 Ga0307516_10273191 3300031730 Bacteria 1375
528 Ga0307405_10628317 3300031731 Bacteria 880
529 Ga0307405_11073395 3300031731 Bacteria 691
530 Ga0307410_10568053 3300031852 Bacteria 942
531 Ga0307406_10264003 3300031901 Bacteria 1304
532 Ga0307416_100281525 3300032002 Bacteria 1640
533 Ga0307416_100698974 3300032002 Bacteria 1103
534 Ga0307414_10126860 3300032004 Bacteria 1973
535 Ga0307414_10226041 3300032004 Bacteria 1540
536 Ga0307415_100385683 3300032126 Bacteria 1191
537 Ga0307510_10005955 3300033180 Bacteria 14550
538 Ga0373939_0508008 3300035114 Bacteria 515
539 Ga0373954_0447123 3300035118 Bacteria 640
540 Ga0373946_0048655 3300035171 Bacteria 1766
541 Ga0373924_0317785 3300035410 Bacteria 692
542 Ga0373935_0294447 3300035692 Bacteria 1146
543 Ga0373935_0639946 3300035692 Bacteria 779
544 Ga0373947_0346643 3300035725 Bacteria 996
545 Ga0373937_0019641 3300036401 Bacteria 6049
546 Ga0373937_0021464 3300036401 Bacteria 5796
547 Ga0373937_0096634 3300036401 Bacteria 2740
548 Ga0439439_0045514 3300041406 Bacteria 1144
549 Ga0451835_0055831 3300041492 Bacteria 628
550 Ga0451847_0839165 3300041503 Unclassified 604
551 Ga0451849_0123964 3300041505 Bacteria 824
552 Ga0439433_0025381 3300041999 Bacteria 1338
553 Ga0439457_008871 3300042014 Bacteria 2358
554 Ga0451577_0186842 3300042876 Bacteria 1869
555 Ga0466972_0000640 3300044658 Bacteria 16947
556 Ga0466972_0111016 3300044658 Bacteria 1296
557 Ga0453683_0121321 3300044673 Bacteria 1646
558 Ga0466961_0167063 3300044693 Bacteria 1369
559 Ga0466968_0006651 3300044735 Bacteria 4366
560 Ga0466957_0229833 3300044842 Bacteria 1228
561 Ga0466960_0127587 3300044901 Bacteria 1339
562 Ga0466959_0001773 3300045049 Bacteria 13455
563 Ga0495592_0140843 3300046454 Unclassified 1678
564 Ga0495603_0228239 3300046455 Bacteria 1074
565 Ga0495638_0031164 3300046460 Bacteria 3428
566 Ga0495638_0075489 3300046460 Bacteria 2054
567 Ga0495638_0226480 3300046460 Bacteria 1042
568 Ga0495582_0039653 3300046473 Bacteria 2593
569 Ga0495664_0326103 3300046477 Bacteria 926
570 Ga0495606_0007339 3300046507 Bacteria 9904
571 Ga0495608_0795222 3300046511 Unclassified 558
572 Ga0495628_0115970 3300046516 Bacteria 2057
573 Ga0495630_0053840 3300046517 Bacteria 3014
574 Ga0495630_0103456 3300046517 Bacteria 2155
575 Ga0495648_0001979 3300046524 Bacteria 19467
576 Ga0495665_0207860 3300046531 Bacteria 1014
577 Ga0495586_0056497 3300046535 Bacteria 2129
578 Ga0495586_0302383 3300046535 Bacteria 917
579 Ga0495645_0305333 3300046543 Bacteria 1038
580 Ga0495633_0052789 3300046558 Bacteria 1914
581 Ga0495667_0492329 3300046559 Bacteria 768
582 Ga0495634_0038674 3300046642 Bacteria 3252
583 Ga0495611_0001743 3300046648 Bacteria 10530
584 Ga0495635_0670860 3300046663 Bacteria 674
585 Ga0495657_0460042 3300046675 Bacteria 744
586 Ga0495599_0137916 3300046678 Unclassified 1514
587 Ga0495658_0056145 3300046683 Bacteria 2245
588 Ga0495670_0008617 3300046691 Bacteria 5021
589 Ga0495600_0179947 3300046809 Unclassified 1363
590 Ga0495674_0058855 3300047319 Bacteria 3358
591 Ga0495672_0086171 3300047320 Bacteria 1738
592 Ga0495676_0080168 3300047321 Bacteria 2480
593 Ga0495687_002362 3300047443 Bacteria 15287
594 Ga0495684_0100619 3300047471 Unclassified 2186
595 Ga0495684_0310765 3300047471 Bacteria 1130
596 Ga0495684_0363307 3300047471 Bacteria 1025
597 Ga0495686_0000005 3300047472 Bacteria 827143
598 Ga0496100_0908163 3300048903 Bacteria 692
599 Ga0496104_0590565 3300048907 Bacteria 1021
600 Ga0496110_1260090 3300048913 Unclassified 648
601 Ga0496113_0389219 3300048916 Bacteria 1119
602 Ga0496114_0273822 3300048917 Bacteria 1488
603 Ga0501032_0004878 3300049569 Bacteria 10041
604 Ga0501034_0070687 3300049571 Bacteria 3501
605 Ga0501034_0355495 3300049571 Bacteria 1392
606 Ga0501036_0030098 3300049572 Bacteria 4586
607 Ga0501036_0039650 3300049572 Bacteria 3985
608 Ga0501037_0004952 3300049573 Bacteria 9685
609 Ga0501037_0059666 3300049573 Bacteria 2782
610 Ga0501038_0002256 3300049574 Bacteria 17927
611 Ga0501038_0003120 3300049574 Bacteria 15461
612 Ga0501039_0081163 3300049575 Bacteria 2524
613 Ga0501039_0776968 3300049575 Bacteria 747
614 Ga0501043_0002067 3300049579 Bacteria 17117
615 Ga0501043_0012846 3300049579 Bacteria 6545
616 Ga0501046_0043360 3300049580 Bacteria 3582
617 Ga0501046_0058214 3300049580 Bacteria 3029
618 Ga0501047_0321689 3300049581 Bacteria 1386
619 Ga0501048_0002001 3300049582 Bacteria 15480
620 Ga0501067_0009389 3300049583 Bacteria 5418
621 Ga0501068_0132718 3300049584 Bacteria 1558
622 Ga0501070_0008938 3300049586 Bacteria 8470
623 Ga0501072_0079427 3300049588 Unclassified 2598
624 Ga0501072_0084708 3300049588 Bacteria 2514
625 Ga0501072_0175959 3300049588 Bacteria 1707
626 Ga0501073_0009042 3300049589 Bacteria 7355
627 Ga0501073_0268093 3300049589 Bacteria 1178
628 Ga0501074_0001847 3300049590 Bacteria 14526
629 Ga0501077_0051664 3300049593 Bacteria 2612
630 Ga0501202_011460 3300049652 Bacteria 1661
631 Ga0501217_038096 3300049661 Bacteria 1213
632 Ga0501223_007789 3300049663 Bacteria 2187
633 Ga0501228_010737 3300049666 Bacteria 916
634 Ga0501235_028613 3300049669 Bacteria 1252
635 Ga0501245_022625 3300049708 Bacteria 993
636 Ga0501079_0031838 3300049741 Bacteria 4053
637 Ga0501080_0019814 3300049742 Bacteria 6227
638 Ga0501080_0065777 3300049742 Bacteria 3372
639 Ga0501083_0015996 3300049744 Bacteria 5253
640 Ga0501266_020311 3300049763 Bacteria 903
641 Ga0501035_0001762 3300049822 Bacteria 21856
642 Ga0501035_0016465 3300049822 Bacteria 6818
643 Ga0501044_0003029 3300049823 Bacteria 19020
644 Ga0501044_0026464 3300049823 Bacteria 6139
645 Ga0501044_0674680 3300049823 Bacteria 921
646 Ga0501212_058958 3300049851 Bacteria 662
647 nmdc:mga0k408_10187_c1 3300050493 Bacteria 5081
648 nmdc:mga0k408_36936_c1 3300050493 Bacteria 2804
649 nmdc:mga07m45_491829_c1 3300050496 Unclassified 710
650 nmdc:mga08y16_224931_c1 3300050511 Bacteria 1942
651 nmdc:mga08x19_226271_c1 3300050514 Bacteria 1286
652 Ga0495619_0060746 3300053085 Bacteria 2513
653 Ga0500583_0000568 3300053092 Bacteria 11176
654 Ga0500583_0158573 3300053092 Bacteria 1127
655 Ga0500568_0025320 3300053139 Bacteria 2505
656 Ga0500588_0115282 3300053146 Bacteria 942
657 Ga0500637_0290982 3300053178 Bacteria 895
658 Ga0500611_000003 3300053727 Bacteria 333431
659 Ga0501084_0039762 3300054114 Bacteria 3934
660 Ga0501082_0287656 3300060353 Bacteria 1431
661 Ga0501082_0628135 3300060353 Bacteria 940
662 Ga0466962_0015449 3300061719 Bacteria 3680
663 Ga0466962_0078930 3300061719 Bacteria 1573

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100188094 Ga0068869_1001880942 161
2 3300035114 Ga0373939_0508008 Ga0373939_0508008_11_499 161
3 3300035118 Ga0373954_0447123 Ga0373954_0447123_89_577 161
4 3300041492 Ga0451835_0055831 Ga0451835_0055831_57_545 161
5 3300041503 Ga0451847_0839165 Ga0451847_0839165_95_583 161
6 3300046511 Ga0495608_0795222 Ga0495608_0795222_56_544 161
7 3300046517 Ga0495630_0053840 Ga0495630_0053840_2495_2983 161
8 3300050496 nmdc:mga07m45_491829_c1 nmdc:mga07m45_491829_c1_13_501 161
9 3300005345 Ga0070692_10833372 Ga0070692_108333721 170
10 3300031730 Ga0307516_10000159 Ga0307516_1000015922 170
11 3300054114 Ga0501084_0039762 Ga0501084_0039762_3367_3882 170
12 3300005458 Ga0070681_10045020 Ga0070681_100450203 173
13 3300005841 Ga0068863_101198808 Ga0068863_1011988082 173
14 3300025912 Ga0207707_10214341 Ga0207707_102143412 173
15 3300035692 Ga0373935_0639946 Ga0373935_0639946_135_749 176
16 3300009553 Ga0105249_10112821 Ga0105249_101128213 178
17 3300026041 Ga0207639_10270654 Ga0207639_102706542 178
18 3300028786 Ga0307517_10000268 Ga0307517_1000026850 178
19 3300046460 Ga0495638_0031164 Ga0495638_0031164_1555_2130 178
20 3300046524 Ga0495648_0001979 Ga0495648_0001979_4087_4662 178
21 3300053092 Ga0500583_0000568 Ga0500583_0000568_2566_3141 178
22 3300005548 Ga0070665_100000014 Ga0070665_10000001487 179
23 3300013297 Ga0157378_10703313 Ga0157378_107033132 179
24 3300028379 Ga0268266_10000048 Ga0268266_10000048166 179
25 3300005344 Ga0070661_100467337 Ga0070661_1004673371 184
26 3300005366 Ga0070659_100075000 Ga0070659_1000750003 184
27 3300005458 Ga0070681_11435717 Ga0070681_114357171 184
28 3300005563 Ga0068855_100127618 Ga0068855_1001276183 184
29 3300005577 Ga0068857_100002147 Ga0068857_1000021478 184
30 3300005614 Ga0068856_100056543 Ga0068856_1000565434 184
31 3300005616 Ga0068852_100012296 Ga0068852_1000122963 184
32 3300025904 Ga0207647_10004599 Ga0207647_100045996 184
33 3300025911 Ga0207654_10026063 Ga0207654_100260633 184
34 3300025913 Ga0207695_10036339 Ga0207695_100363396 184
35 3300025924 Ga0207694_10005398 Ga0207694_100053988 184
36 3300025949 Ga0207667_10001242 Ga0207667_1000124216 184
37 3300025981 Ga0207640_10022459 Ga0207640_100224591 184
38 3300026078 Ga0207702_10050648 Ga0207702_100506483 184
39 3300026116 Ga0207674_10000453 Ga0207674_1000045317 184
40 3300005614 Ga0068856_100042327 Ga0068856_1000423272 185
41 3300026078 Ga0207702_10038731 Ga0207702_100387312 185
42 3300005327 Ga0070658_10012615 Ga0070658_100126155 186
43 3300005328 Ga0070676_10018990 Ga0070676_100189903 186
44 3300005335 Ga0070666_10041311 Ga0070666_100413112 186
45 3300005338 Ga0068868_100003574 Ga0068868_1000035744 186
46 3300005339 Ga0070660_100931232 Ga0070660_1009312321 186
47 3300005340 Ga0070689_101072005 Ga0070689_1010720051 186
48 3300005364 Ga0070673_100060620 Ga0070673_1000606204 186
49 3300005367 Ga0070667_100021240 Ga0070667_1000212403 186
50 3300005455 Ga0070663_100091947 Ga0070663_1000919472 186
51 3300005459 Ga0068867_100026025 Ga0068867_1000260252 186
52 3300005539 Ga0068853_100091687 Ga0068853_1000916874 186
53 3300005841 Ga0068863_100316193 Ga0068863_1003161932 186
54 3300006931 Ga0097620_100534384 Ga0097620_1005343842 186
55 3300026088 Ga0207641_10115135 Ga0207641_101151352 186
56 3300002077 JGI24744J21845_10024993 JGI24744J21845_100249932 187
57 3300005330 Ga0070690_100247796 Ga0070690_1002477961 187
58 3300005334 Ga0068869_100040117 Ga0068869_1000401173 187
59 3300005338 Ga0068868_100176158 Ga0068868_1001761583 187
60 3300005343 Ga0070687_100006709 Ga0070687_1000067093 187
61 3300005344 Ga0070661_100319166 Ga0070661_1003191662 187
62 3300005353 Ga0070669_100378550 Ga0070669_1003785502 187
63 3300005354 Ga0070675_100076880 Ga0070675_1000768804 187
64 3300005355 Ga0070671_100007908 Ga0070671_1000079088 187
65 3300005356 Ga0070674_100066226 Ga0070674_1000662264 187
66 3300005367 Ga0070667_100651887 Ga0070667_1006518871 187
67 3300005456 Ga0070678_100190194 Ga0070678_1001901942 187
68 3300005459 Ga0068867_100090140 Ga0068867_1000901403 187
69 3300005535 Ga0070684_100002074 Ga0070684_1000020747 187
70 3300005544 Ga0070686_100041453 Ga0070686_1000414532 187
71 3300005547 Ga0070693_100255075 Ga0070693_1002550751 187
72 3300005563 Ga0068855_100073045 Ga0068855_1000730452 187
73 3300005577 Ga0068857_100255575 Ga0068857_1002555753 187
74 3300005578 Ga0068854_100268281 Ga0068854_1002682812 187
75 3300005616 Ga0068852_100102778 Ga0068852_1001027782 187
76 3300005983 Ga0081540_1013840 Ga0081540_10138403 187
77 3300006881 Ga0068865_100483463 Ga0068865_1004834631 187
78 3300009093 Ga0105240_10006529 Ga0105240_100065297 187
79 3300009094 Ga0111539_10071473 Ga0111539_100714735 187
80 3300009177 Ga0105248_10837533 Ga0105248_108375332 187
81 3300009553 Ga0105249_10116464 Ga0105249_101164643 187
82 3300010375 Ga0105239_10000580 Ga0105239_1000058030 187
83 3300010375 Ga0105239_10030051 Ga0105239_100300518 187
84 3300010375 Ga0105239_10604079 Ga0105239_106040792 187
85 3300013100 Ga0157373_10068009 Ga0157373_100680092 187
86 3300013105 Ga0157369_10319984 Ga0157369_103199842 187
87 3300013297 Ga0157378_10006519 Ga0157378_100065196 187
88 3300013306 Ga0163162_10078768 Ga0163162_100787683 187
89 3300013307 Ga0157372_10403572 Ga0157372_104035722 187
90 3300013308 Ga0157375_10814121 Ga0157375_108141212 187
91 3300014326 Ga0157380_10667978 Ga0157380_106679782 187
92 3300014968 Ga0157379_10430730 Ga0157379_104307302 187
93 3300014969 Ga0157376_11315761 Ga0157376_113157611 187
94 3300017792 Ga0163161_10142880 Ga0163161_101428801 187
95 3300025901 Ga0207688_10058259 Ga0207688_100582592 187
96 3300025904 Ga0207647_10025873 Ga0207647_100258732 187
97 3300025913 Ga0207695_10000087 Ga0207695_10000087153 187
98 3300025913 Ga0207695_10203184 Ga0207695_102031842 187
99 3300025918 Ga0207662_10023616 Ga0207662_100236164 187
100 3300025924 Ga0207694_10040792 Ga0207694_100407925 187
101 3300025926 Ga0207659_10060935 Ga0207659_100609353 187
102 3300025933 Ga0207706_10404618 Ga0207706_104046182 187
103 3300025937 Ga0207669_10065043 Ga0207669_100650433 187
104 3300025937 Ga0207669_10069562 Ga0207669_100695623 187
105 3300025940 Ga0207691_10020036 Ga0207691_100200363 187
106 3300025942 Ga0207689_10179033 Ga0207689_101790332 187
107 3300025949 Ga0207667_10000584 Ga0207667_1000058421 187
108 3300025949 Ga0207667_10016385 Ga0207667_100163856 187
109 3300025981 Ga0207640_10220798 Ga0207640_102207982 187
110 3300026089 Ga0207648_10092461 Ga0207648_100924613 187
111 3300026116 Ga0207674_10530736 Ga0207674_105307361 187
112 3300026118 Ga0207675_100426292 Ga0207675_1004262922 187
113 3300026142 Ga0207698_10094545 Ga0207698_100945453 187
114 3300026142 Ga0207698_10442344 Ga0207698_104423442 187
115 3300045049 Ga0466959_0001773 Ga0466959_0001773_4787_5350 187
116 3300046477 Ga0495664_0326103 Ga0495664_0326103_86_649 187
117 3300046559 Ga0495667_0492329 Ga0495667_0492329_100_663 187
118 3300047471 Ga0495684_0363307 Ga0495684_0363307_352_915 187
119 3300050511 nmdc:mga08y16_224931_c1 nmdc:mga08y16_224931_c1_703_1266 187
120 3300061719 Ga0466962_0015449 Ga0466962_0015449_1744_2307 187
121 3300003322 rootL2_10072075 rootL2_100720752 188
122 3300003322 rootL2_10326007 rootL2_103260071 188
123 3300003323 rootH1_10243153 rootH1_102431532 188
124 3300005290 Ga0065712_10181075 Ga0065712_101810752 188
125 3300005290 Ga0065712_10284438 Ga0065712_102844381 188
126 3300005328 Ga0070676_10014319 Ga0070676_100143192 188
127 3300005329 Ga0070683_100191390 Ga0070683_1001913903 188
128 3300005329 Ga0070683_100418339 Ga0070683_1004183392 188
129 3300005329 Ga0070683_100936182 Ga0070683_1009361821 188
130 3300005330 Ga0070690_100471088 Ga0070690_1004710882 188
131 3300005331 Ga0070670_100791104 Ga0070670_1007911041 188
132 3300005334 Ga0068869_100074258 Ga0068869_1000742582 188
133 3300005334 Ga0068869_100761899 Ga0068869_1007618991 188
134 3300005335 Ga0070666_10002756 Ga0070666_100027567 188
135 3300005338 Ga0068868_100013885 Ga0068868_1000138854 188
136 3300005340 Ga0070689_100578268 Ga0070689_1005782682 188
137 3300005344 Ga0070661_100019264 Ga0070661_1000192645 188
138 3300005344 Ga0070661_100676657 Ga0070661_1006766571 188
139 3300005347 Ga0070668_100009928 Ga0070668_1000099282 188
140 3300005353 Ga0070669_100037400 Ga0070669_1000374003 188
141 3300005354 Ga0070675_100791776 Ga0070675_1007917761 188
142 3300005355 Ga0070671_100153841 Ga0070671_1001538412 188
143 3300005356 Ga0070674_100049306 Ga0070674_1000493062 188
144 3300005364 Ga0070673_100025956 Ga0070673_1000259562 188
145 3300005365 Ga0070688_100029947 Ga0070688_1000299472 188
146 3300005366 Ga0070659_100531771 Ga0070659_1005317712 188
147 3300005367 Ga0070667_100071668 Ga0070667_1000716682 188
148 3300005455 Ga0070663_100119899 Ga0070663_1001198992 188
149 3300005456 Ga0070678_100046738 Ga0070678_1000467383 188
150 3300005457 Ga0070662_100328508 Ga0070662_1003285082 188
151 3300005459 Ga0068867_100055002 Ga0068867_1000550023 188
152 3300005466 Ga0070685_10003854 Ga0070685_100038545 188
153 3300005535 Ga0070684_100021281 Ga0070684_1000212813 188
154 3300005535 Ga0070684_100190517 Ga0070684_1001905171 188
155 3300005539 Ga0068853_100026519 Ga0068853_1000265193 188
156 3300005543 Ga0070672_100005202 Ga0070672_1000052028 188
157 3300005548 Ga0070665_100381189 Ga0070665_1003811892 188
158 3300005548 Ga0070665_100410328 Ga0070665_1004103282 188
159 3300005548 Ga0070665_100548896 Ga0070665_1005488962 188
160 3300005563 Ga0068855_100001990 Ga0068855_10000199020 188
161 3300005564 Ga0070664_100002665 Ga0070664_10000266511 188
162 3300005577 Ga0068857_100021713 Ga0068857_1000217133 188
163 3300005577 Ga0068857_100100927 Ga0068857_1001009274 188
164 3300005577 Ga0068857_100430041 Ga0068857_1004300412 188
165 3300005578 Ga0068854_100023210 Ga0068854_1000232102 188
166 3300005578 Ga0068854_100134265 Ga0068854_1001342652 188
167 3300005614 Ga0068856_100028452 Ga0068856_1000284524 188
168 3300005616 Ga0068852_100031270 Ga0068852_1000312702 188
169 3300005616 Ga0068852_100294580 Ga0068852_1002945802 188
170 3300005617 Ga0068859_100002273 Ga0068859_1000022739 188
171 3300005617 Ga0068859_100072081 Ga0068859_1000720815 188
172 3300005618 Ga0068864_101117914 Ga0068864_1011179141 188
173 3300005719 Ga0068861_100631836 Ga0068861_1006318361 188
174 3300005840 Ga0068870_10156742 Ga0068870_101567422 188
175 3300005841 Ga0068863_100129113 Ga0068863_1001291132 188
176 3300005843 Ga0068860_100104673 Ga0068860_1001046734 188
177 3300005985 Ga0081539_10047752 Ga0081539_100477523 188
178 3300006195 Ga0075366_10008625 Ga0075366_100086254 188
179 3300006195 Ga0075366_10012354 Ga0075366_100123542 188
180 3300006237 Ga0097621_100018519 Ga0097621_1000185195 188
181 3300006237 Ga0097621_101159982 Ga0097621_1011599821 188
182 3300006358 Ga0068871_100053443 Ga0068871_1000534432 188
183 3300006358 Ga0068871_100224705 Ga0068871_1002247052 188
184 3300006871 Ga0075434_100044282 Ga0075434_1000442823 188
185 3300006881 Ga0068865_100006196 Ga0068865_1000061964 188
186 3300006931 Ga0097620_100002273 Ga0097620_1000022739 188
187 3300006931 Ga0097620_100072079 Ga0097620_1000720792 188
188 3300009098 Ga0105245_10233630 Ga0105245_102336302 188
189 3300009174 Ga0105241_10042451 Ga0105241_100424513 188
190 3300009174 Ga0105241_10093641 Ga0105241_100936412 188
191 3300009176 Ga0105242_10012927 Ga0105242_100129274 188
192 3300009553 Ga0105249_10124897 Ga0105249_101248973 188
193 3300009553 Ga0105249_10409303 Ga0105249_104093032 188
194 3300010375 Ga0105239_10007405 Ga0105239_100074053 188
195 3300010375 Ga0105239_11301017 Ga0105239_113010171 188
196 3300011119 Ga0105246_10001264 Ga0105246_1000126411 188
197 3300013100 Ga0157373_10184227 Ga0157373_101842272 188
198 3300013104 Ga0157370_10004229 Ga0157370_100042292 188
199 3300013105 Ga0157369_11300717 Ga0157369_113007172 188
200 3300013296 Ga0157374_10135901 Ga0157374_101359011 188
201 3300013297 Ga0157378_10434717 Ga0157378_104347172 188
202 3300013306 Ga0163162_10242469 Ga0163162_102424693 188
203 3300013306 Ga0163162_10279101 Ga0163162_102791012 188
204 3300013307 Ga0157372_10322297 Ga0157372_103222972 188
205 3300013308 Ga0157375_10055142 Ga0157375_100551421 188
206 3300013308 Ga0157375_10257203 Ga0157375_102572032 188
207 3300013308 Ga0157375_10470675 Ga0157375_104706752 188
208 3300014325 Ga0163163_10553015 Ga0163163_105530152 188
209 3300014325 Ga0163163_10645329 Ga0163163_106453292 188
210 3300014326 Ga0157380_10122130 Ga0157380_101221302 188
211 3300014326 Ga0157380_11040956 Ga0157380_110409562 188
212 3300014969 Ga0157376_10026592 Ga0157376_100265924 188
213 3300014969 Ga0157376_10150053 Ga0157376_101500533 188
214 3300025901 Ga0207688_10003300 Ga0207688_100033005 188
215 3300025903 Ga0207680_10047349 Ga0207680_100473493 188
216 3300025903 Ga0207680_10234927 Ga0207680_102349272 188
217 3300025907 Ga0207645_10003291 Ga0207645_1000329110 188
218 3300025908 Ga0207643_10129266 Ga0207643_101292662 188
219 3300025911 Ga0207654_10024091 Ga0207654_100240913 188
220 3300025920 Ga0207649_10068425 Ga0207649_100684251 188
221 3300025920 Ga0207649_10942154 Ga0207649_109421541 188
222 3300025933 Ga0207706_10054002 Ga0207706_100540024 188
223 3300025934 Ga0207686_10029678 Ga0207686_100296782 188
224 3300025936 Ga0207670_10016254 Ga0207670_100162543 188
225 3300025937 Ga0207669_10037332 Ga0207669_100373322 188
226 3300025938 Ga0207704_10038307 Ga0207704_100383073 188
227 3300025940 Ga0207691_10031370 Ga0207691_100313704 188
228 3300025942 Ga0207689_10001049 Ga0207689_100010499 188
229 3300025942 Ga0207689_10475385 Ga0207689_104753852 188
230 3300025942 Ga0207689_10497951 Ga0207689_104979511 188
231 3300025944 Ga0207661_10053129 Ga0207661_100531293 188
232 3300025944 Ga0207661_10072945 Ga0207661_100729453 188
233 3300025945 Ga0207679_10043404 Ga0207679_100434042 188
234 3300025945 Ga0207679_10070163 Ga0207679_100701632 188
235 3300025949 Ga0207667_10020034 Ga0207667_100200343 188
236 3300025960 Ga0207651_10107640 Ga0207651_101076401 188
237 3300025961 Ga0207712_10047061 Ga0207712_100470612 188
238 3300025961 Ga0207712_10329655 Ga0207712_103296552 188
239 3300025972 Ga0207668_10048032 Ga0207668_100480323 188
240 3300025972 Ga0207668_10173375 Ga0207668_101733752 188
241 3300025981 Ga0207640_10108873 Ga0207640_101088732 188
242 3300025986 Ga0207658_10068969 Ga0207658_100689692 188
243 3300025986 Ga0207658_10591604 Ga0207658_105916042 188
244 3300026023 Ga0207677_10044906 Ga0207677_100449063 188
245 3300026041 Ga0207639_10034764 Ga0207639_100347645 188
246 3300026041 Ga0207639_10237680 Ga0207639_102376802 188
247 3300026075 Ga0207708_10516618 Ga0207708_105166181 188
248 3300026078 Ga0207702_10100657 Ga0207702_101006572 188
249 3300026088 Ga0207641_10100939 Ga0207641_101009393 188
250 3300026089 Ga0207648_10005292 Ga0207648_100052929 188
251 3300026095 Ga0207676_10909651 Ga0207676_109096511 188
252 3300026116 Ga0207674_10037607 Ga0207674_100376073 188
253 3300026116 Ga0207674_10432229 Ga0207674_104322292 188
254 3300026116 Ga0207674_11030910 Ga0207674_110309101 188
255 3300026118 Ga0207675_100447412 Ga0207675_1004474122 188
256 3300026121 Ga0207683_10000957 Ga0207683_1000095721 188
257 3300026142 Ga0207698_10018924 Ga0207698_100189244 188
258 3300028379 Ga0268266_10022104 Ga0268266_100221044 188
259 3300028379 Ga0268266_10146482 Ga0268266_101464822 188
260 3300028380 Ga0268265_10583094 Ga0268265_105830941 188
261 3300028381 Ga0268264_11493738 Ga0268264_114937381 188
262 3300031548 Ga0307408_100448363 Ga0307408_1004483631 188
263 3300031731 Ga0307405_10628317 Ga0307405_106283171 188
264 3300031852 Ga0307410_10568053 Ga0307410_105680531 188
265 3300031901 Ga0307406_10264003 Ga0307406_102640032 188
266 3300032002 Ga0307416_100281525 Ga0307416_1002815252 188
267 3300032004 Ga0307414_10226041 Ga0307414_102260412 188
268 3300032126 Ga0307415_100385683 Ga0307415_1003856831 188
269 3300035171 Ga0373946_0048655 Ga0373946_0048655_1055_1630 188
270 3300035725 Ga0373947_0346643 Ga0373947_0346643_228_803 188
271 3300041406 Ga0439439_0045514 Ga0439439_0045514_111_677 188
272 3300041505 Ga0451849_0123964 Ga0451849_0123964_16_591 188
273 3300041999 Ga0439433_0025381 Ga0439433_0025381_468_1034 188
274 3300042014 Ga0439457_008871 Ga0439457_008871_1234_1800 188
275 3300042876 Ga0451577_0186842 Ga0451577_0186842_351_926 188
276 3300044658 Ga0466972_0111016 Ga0466972_0111016_499_1065 188
277 3300044673 Ga0453683_0121321 Ga0453683_0121321_488_1057 188
278 3300044693 Ga0466961_0167063 Ga0466961_0167063_758_1324 188
279 3300047321 Ga0495676_0080168 Ga0495676_0080168_264_839 188
280 3300048913 Ga0496110_1260090 Ga0496110_1260090_29_604 188
281 3300048916 Ga0496113_0389219 Ga0496113_0389219_63_638 188
282 3300049569 Ga0501032_0004878 Ga0501032_0004878_3368_3937 188
283 3300049571 Ga0501034_0070687 Ga0501034_0070687_789_1358 188
284 3300049572 Ga0501036_0030098 Ga0501036_0030098_171_740 188
285 3300049572 Ga0501036_0039650 Ga0501036_0039650_1565_2131 188
286 3300049573 Ga0501037_0004952 Ga0501037_0004952_3215_3784 188
287 3300049573 Ga0501037_0059666 Ga0501037_0059666_470_1036 188
288 3300049574 Ga0501038_0003120 Ga0501038_0003120_1190_1759 188
289 3300049575 Ga0501039_0776968 Ga0501039_0776968_32_601 188
290 3300049579 Ga0501043_0002067 Ga0501043_0002067_12076_12645 188
291 3300049579 Ga0501043_0012846 Ga0501043_0012846_2252_2818 188
292 3300049580 Ga0501046_0043360 Ga0501046_0043360_2678_3244 188
293 3300049580 Ga0501046_0058214 Ga0501046_0058214_661_1230 188
294 3300049581 Ga0501047_0321689 Ga0501047_0321689_120_689 188
295 3300049582 Ga0501048_0002001 Ga0501048_0002001_3226_3795 188
296 3300049583 Ga0501067_0009389 Ga0501067_0009389_2383_2952 188
297 3300049586 Ga0501070_0008938 Ga0501070_0008938_4513_5082 188
298 3300049588 Ga0501072_0079427 Ga0501072_0079427_630_1205 188
299 3300049588 Ga0501072_0084708 Ga0501072_0084708_1618_2184 188
300 3300049588 Ga0501072_0175959 Ga0501072_0175959_39_608 188
301 3300049589 Ga0501073_0009042 Ga0501073_0009042_3720_4289 188
302 3300049589 Ga0501073_0268093 Ga0501073_0268093_39_605 188
303 3300049590 Ga0501074_0001847 Ga0501074_0001847_895_1464 188
304 3300049593 Ga0501077_0051664 Ga0501077_0051664_804_1373 188
305 3300049652 Ga0501202_011460 Ga0501202_011460_85_651 188
306 3300049661 Ga0501217_038096 Ga0501217_038096_323_889 188
307 3300049663 Ga0501223_007789 Ga0501223_007789_134_700 188
308 3300049666 Ga0501228_010737 Ga0501228_010737_134_700 188
309 3300049669 Ga0501235_028613 Ga0501235_028613_230_796 188
310 3300049708 Ga0501245_022625 Ga0501245_022625_42_608 188
311 3300049741 Ga0501079_0031838 Ga0501079_0031838_2428_2997 188
312 3300049742 Ga0501080_0019814 Ga0501080_0019814_2468_3037 188
313 3300049742 Ga0501080_0065777 Ga0501080_0065777_2438_3013 188
314 3300049744 Ga0501083_0015996 Ga0501083_0015996_696_1265 188
315 3300049822 Ga0501035_0001762 Ga0501035_0001762_7934_8503 188
316 3300049822 Ga0501035_0016465 Ga0501035_0016465_1022_1588 188
317 3300049823 Ga0501044_0003029 Ga0501044_0003029_4846_5415 188
318 3300049851 Ga0501212_058958 Ga0501212_058958_37_603 188
319 3300050493 nmdc:mga0k408_10187_c1 nmdc:mga0k408_10187_c1_2416_2985 188
320 3300050493 nmdc:mga0k408_36936_c1 nmdc:mga0k408_36936_c1_886_1455 188
321 3300060353 Ga0501082_0287656 Ga0501082_0287656_28_597 188
322 3300061719 Ga0466962_0078930 Ga0466962_0078930_401_967 188
323 3300003320 rootH2_10027245 rootH2_100272453 189
324 3300005335 Ga0070666_10053529 Ga0070666_100535292 189
325 3300005338 Ga0068868_101510350 Ga0068868_1015103501 189
326 3300005367 Ga0070667_100151519 Ga0070667_1001515192 189
327 3300005539 Ga0068853_100057447 Ga0068853_1000574472 189
328 3300005539 Ga0068853_100296514 Ga0068853_1002965142 189
329 3300005539 Ga0068853_100313542 Ga0068853_1003135422 189
330 3300005563 Ga0068855_101245394 Ga0068855_1012453941 189
331 3300005578 Ga0068854_100462433 Ga0068854_1004624332 189
332 3300005843 Ga0068860_100000024 Ga0068860_100000024141 189
333 3300009093 Ga0105240_10000106 Ga0105240_1000010660 189
334 3300009093 Ga0105240_10396227 Ga0105240_103962271 189
335 3300009174 Ga0105241_10001117 Ga0105241_100011178 189
336 3300009174 Ga0105241_10062358 Ga0105241_100623583 189
337 3300009545 Ga0105237_10005940 Ga0105237_1000594013 189
338 3300009545 Ga0105237_10014958 Ga0105237_100149588 189
339 3300009545 Ga0105237_10018678 Ga0105237_100186788 189
340 3300009551 Ga0105238_10001211 Ga0105238_1000121126 189
341 3300009551 Ga0105238_10017549 Ga0105238_100175493 189
342 3300009551 Ga0105238_10089770 Ga0105238_100897703 189
343 3300009553 Ga0105249_10318984 Ga0105249_103189842 189
344 3300010375 Ga0105239_10009676 Ga0105239_100096763 189
345 3300010375 Ga0105239_10015390 Ga0105239_100153908 189
346 3300013104 Ga0157370_10026848 Ga0157370_100268482 189
347 3300013105 Ga0157369_10288022 Ga0157369_102880222 189
348 3300013296 Ga0157374_10000011 Ga0157374_10000011429 189
349 3300013306 Ga0163162_10001786 Ga0163162_100017868 189
350 3300013306 Ga0163162_10785843 Ga0163162_107858432 189
351 3300013307 Ga0157372_10000171 Ga0157372_1000017140 189
352 3300013307 Ga0157372_10000463 Ga0157372_1000046332 189
353 3300013307 Ga0157372_10181378 Ga0157372_101813783 189
354 3300014969 Ga0157376_10013842 Ga0157376_100138423 189
355 3300025903 Ga0207680_10007538 Ga0207680_100075384 189
356 3300025911 Ga0207654_10000620 Ga0207654_1000062012 189
357 3300025913 Ga0207695_10003167 Ga0207695_1000316713 189
358 3300025913 Ga0207695_10018118 Ga0207695_100181184 189
359 3300025914 Ga0207671_10002324 Ga0207671_1000232414 189
360 3300025914 Ga0207671_10002511 Ga0207671_100025115 189
361 3300025914 Ga0207671_10008910 Ga0207671_100089108 189
362 3300025924 Ga0207694_10177014 Ga0207694_101770142 189
363 3300025942 Ga0207689_10285414 Ga0207689_102854142 189
364 3300025949 Ga0207667_10834000 Ga0207667_108340001 189
365 3300026041 Ga0207639_10158522 Ga0207639_101585223 189
366 3300026078 Ga0207702_10084238 Ga0207702_100842382 189
367 3300026142 Ga0207698_10583537 Ga0207698_105835372 189
368 3300028381 Ga0268264_10000028 Ga0268264_10000028322 189
369 3300044658 Ga0466972_0000640 Ga0466972_0000640_3507_4082 189
370 3300044735 Ga0466968_0006651 Ga0466968_0006651_2481_3056 189
371 3300044842 Ga0466957_0229833 Ga0466957_0229833_556_1131 189
372 3300044901 Ga0466960_0127587 Ga0466960_0127587_751_1326 189
373 3300047443 Ga0495687_002362 Ga0495687_002362_13845_14420 189
374 3300049763 Ga0501266_020311 Ga0501266_020311_40_633 189
375 3300049823 Ga0501044_0674680 Ga0501044_0674680_125_700 189
376 3300053139 Ga0500568_0025320 Ga0500568_0025320_256_831 189
377 3300005328 Ga0070676_10020683 Ga0070676_100206833 190
378 3300005328 Ga0070676_10355691 Ga0070676_103556911 190
379 3300005330 Ga0070690_100031252 Ga0070690_1000312523 190
380 3300005330 Ga0070690_100096016 Ga0070690_1000960161 190
381 3300005334 Ga0068869_100015272 Ga0068869_1000152725 190
382 3300005334 Ga0068869_100027016 Ga0068869_1000270163 190
383 3300005335 Ga0070666_10058363 Ga0070666_100583634 190
384 3300005338 Ga0068868_100007171 Ga0068868_1000071713 190
385 3300005338 Ga0068868_100008105 Ga0068868_1000081056 190
386 3300005340 Ga0070689_100138505 Ga0070689_1001385053 190
387 3300005344 Ga0070661_100010809 Ga0070661_1000108092 190
388 3300005344 Ga0070661_100058296 Ga0070661_1000582964 190
389 3300005344 Ga0070661_100304644 Ga0070661_1003046442 190
390 3300005347 Ga0070668_100001487 Ga0070668_1000014875 190
391 3300005354 Ga0070675_100022703 Ga0070675_1000227034 190
392 3300005354 Ga0070675_100046846 Ga0070675_1000468463 190
393 3300005355 Ga0070671_100736279 Ga0070671_1007362791 190
394 3300005364 Ga0070673_100306920 Ga0070673_1003069202 190
395 3300005365 Ga0070688_100012159 Ga0070688_1000121593 190
396 3300005365 Ga0070688_100215677 Ga0070688_1002156771 190
397 3300005366 Ga0070659_100617771 Ga0070659_1006177711 190
398 3300005367 Ga0070667_100039008 Ga0070667_1000390084 190
399 3300005367 Ga0070667_100430442 Ga0070667_1004304422 190
400 3300005367 Ga0070667_100489979 Ga0070667_1004899791 190
401 3300005456 Ga0070678_100043720 Ga0070678_1000437202 190
402 3300005457 Ga0070662_100001127 Ga0070662_10000112711 190
403 3300005457 Ga0070662_100011969 Ga0070662_1000119695 190
404 3300005457 Ga0070662_100013705 Ga0070662_1000137053 190
405 3300005457 Ga0070662_100070814 Ga0070662_1000708143 190
406 3300005459 Ga0068867_100077338 Ga0068867_1000773382 190
407 3300005459 Ga0068867_100169885 Ga0068867_1001698852 190
408 3300005466 Ga0070685_10063093 Ga0070685_100630933 190
409 3300005466 Ga0070685_10542127 Ga0070685_105421271 190
410 3300005539 Ga0068853_100067657 Ga0068853_1000676572 190
411 3300005539 Ga0068853_100289597 Ga0068853_1002895971 190
412 3300005539 Ga0068853_100647209 Ga0068853_1006472092 190
413 3300005543 Ga0070672_100008264 Ga0070672_1000082644 190
414 3300005543 Ga0070672_100085732 Ga0070672_1000857323 190
415 3300005543 Ga0070672_100195370 Ga0070672_1001953702 190
416 3300005547 Ga0070693_100714743 Ga0070693_1007147431 190
417 3300005548 Ga0070665_100056759 Ga0070665_1000567594 190
418 3300005563 Ga0068855_100220498 Ga0068855_1002204983 190
419 3300005563 Ga0068855_100396567 Ga0068855_1003965672 190
420 3300005564 Ga0070664_100341116 Ga0070664_1003411162 190
421 3300005564 Ga0070664_100840199 Ga0070664_1008401991 190
422 3300005577 Ga0068857_100104372 Ga0068857_1001043722 190
423 3300005578 Ga0068854_100047100 Ga0068854_1000471002 190
424 3300005616 Ga0068852_100045007 Ga0068852_1000450074 190
425 3300005616 Ga0068852_100131504 Ga0068852_1001315043 190
426 3300005616 Ga0068852_100163276 Ga0068852_1001632763 190
427 3300005617 Ga0068859_100032409 Ga0068859_1000324095 190
428 3300005617 Ga0068859_100092631 Ga0068859_1000926314 190
429 3300005617 Ga0068859_100097017 Ga0068859_1000970174 190
430 3300005618 Ga0068864_100046417 Ga0068864_1000464174 190
431 3300005618 Ga0068864_100135996 Ga0068864_1001359963 190
432 3300005618 Ga0068864_100356178 Ga0068864_1003561782 190
433 3300005719 Ga0068861_100009713 Ga0068861_1000097137 190
434 3300005719 Ga0068861_100092367 Ga0068861_1000923672 190
435 3300005719 Ga0068861_100386590 Ga0068861_1003865902 190
436 3300005834 Ga0068851_10004181 Ga0068851_100041817 190
437 3300005841 Ga0068863_100005185 Ga0068863_1000051854 190
438 3300005841 Ga0068863_100302435 Ga0068863_1003024352 190
439 3300005841 Ga0068863_100714170 Ga0068863_1007141701 190
440 3300005842 Ga0068858_100002187 Ga0068858_10000218711 190
441 3300005842 Ga0068858_100309167 Ga0068858_1003091672 190
442 3300005843 Ga0068860_100000691 Ga0068860_10000069118 190
443 3300005843 Ga0068860_100010899 Ga0068860_1000108995 190
444 3300005843 Ga0068860_100429764 Ga0068860_1004297642 190
445 3300005844 Ga0068862_100452765 Ga0068862_1004527652 190
446 3300006163 Ga0070715_10094422 Ga0070715_100944222 190
447 3300006237 Ga0097621_100005475 Ga0097621_1000054757 190
448 3300006237 Ga0097621_100056807 Ga0097621_1000568074 190
449 3300006237 Ga0097621_100210073 Ga0097621_1002100732 190
450 3300006237 Ga0097621_100219087 Ga0097621_1002190872 190
451 3300006237 Ga0097621_100259485 Ga0097621_1002594852 190
452 3300006358 Ga0068871_100022329 Ga0068871_1000223297 190
453 3300006358 Ga0068871_100167943 Ga0068871_1001679432 190
454 3300006358 Ga0068871_100412353 Ga0068871_1004123532 190
455 3300006881 Ga0068865_100034522 Ga0068865_1000345224 190
456 3300006881 Ga0068865_100053771 Ga0068865_1000537714 190
457 3300006881 Ga0068865_100349662 Ga0068865_1003496622 190
458 3300006914 Ga0075436_100413795 Ga0075436_1004137952 190
459 3300006931 Ga0097620_100032409 Ga0097620_1000324095 190
460 3300006931 Ga0097620_100092635 Ga0097620_1000926352 190
461 3300006931 Ga0097620_100097017 Ga0097620_1000970172 190
462 3300009093 Ga0105240_10002904 Ga0105240_1000290421 190
463 3300009093 Ga0105240_10022621 Ga0105240_1002262110 190
464 3300009093 Ga0105240_10042604 Ga0105240_100426043 190
465 3300009093 Ga0105240_10133685 Ga0105240_101336852 190
466 3300009098 Ga0105245_10063131 Ga0105245_100631313 190
467 3300009101 Ga0105247_10002404 Ga0105247_1000240413 190
468 3300009101 Ga0105247_10121504 Ga0105247_101215042 190
469 3300009101 Ga0105247_10538032 Ga0105247_105380321 190
470 3300009176 Ga0105242_10320433 Ga0105242_103204332 190
471 3300009176 Ga0105242_10647460 Ga0105242_106474602 190
472 3300009177 Ga0105248_10084854 Ga0105248_100848545 190
473 3300009545 Ga0105237_10000561 Ga0105237_1000056128 190
474 3300009551 Ga0105238_10131358 Ga0105238_101313582 190
475 3300009553 Ga0105249_10005427 Ga0105249_100054278 190
476 3300009553 Ga0105249_10048728 Ga0105249_100487284 190
477 3300010375 Ga0105239_10003763 Ga0105239_100037633 190
478 3300010375 Ga0105239_10211340 Ga0105239_102113402 190
479 3300010375 Ga0105239_10353094 Ga0105239_103530941 190
480 3300010375 Ga0105239_10661080 Ga0105239_106610802 190
481 3300010375 Ga0105239_10662127 Ga0105239_106621272 190
482 3300011119 Ga0105246_10143669 Ga0105246_101436693 190
483 3300011119 Ga0105246_10969391 Ga0105246_109693911 190
484 3300013100 Ga0157373_10835971 Ga0157373_108359711 190
485 3300013102 Ga0157371_10421205 Ga0157371_104212052 190
486 3300013296 Ga0157374_10038728 Ga0157374_100387283 190
487 3300013296 Ga0157374_10058869 Ga0157374_100588692 190
488 3300013296 Ga0157374_10119566 Ga0157374_101195664 190
489 3300013297 Ga0157378_10021695 Ga0157378_100216953 190
490 3300013297 Ga0157378_10036639 Ga0157378_100366392 190
491 3300013306 Ga0163162_10001367 Ga0163162_100013676 190
492 3300013306 Ga0163162_10002933 Ga0163162_100029334 190
493 3300013306 Ga0163162_10023782 Ga0163162_100237824 190
494 3300013306 Ga0163162_10048969 Ga0163162_100489694 190
495 3300013306 Ga0163162_10165389 Ga0163162_101653893 190
496 3300013306 Ga0163162_10199989 Ga0163162_101999892 190
497 3300013306 Ga0163162_10242383 Ga0163162_102423832 190
498 3300013307 Ga0157372_10630786 Ga0157372_106307862 190
499 3300013308 Ga0157375_10009867 Ga0157375_100098675 190
500 3300013308 Ga0157375_10085503 Ga0157375_100855033 190
501 3300013308 Ga0157375_10121739 Ga0157375_101217393 190
502 3300013308 Ga0157375_10328462 Ga0157375_103284622 190
503 3300014325 Ga0163163_10001998 Ga0163163_100019982 190
504 3300014325 Ga0163163_10005703 Ga0163163_100057037 190
505 3300014325 Ga0163163_10089414 Ga0163163_100894144 190
506 3300014325 Ga0163163_10254464 Ga0163163_102544642 190
507 3300014326 Ga0157380_10350484 Ga0157380_103504842 190
508 3300014326 Ga0157380_10780370 Ga0157380_107803701 190
509 3300014745 Ga0157377_10010026 Ga0157377_100100265 190
510 3300014968 Ga0157379_10010876 Ga0157379_100108762 190
511 3300014968 Ga0157379_10018539 Ga0157379_100185396 190
512 3300014968 Ga0157379_10304355 Ga0157379_103043552 190
513 3300014968 Ga0157379_10643729 Ga0157379_106437292 190
514 3300014968 Ga0157379_10884674 Ga0157379_108846742 190
515 3300014969 Ga0157376_10023416 Ga0157376_100234162 190
516 3300014969 Ga0157376_10240327 Ga0157376_102403273 190
517 3300014969 Ga0157376_10265119 Ga0157376_102651192 190
518 3300014969 Ga0157376_10494472 Ga0157376_104944722 190
519 3300014969 Ga0157376_11355907 Ga0157376_113559071 190
520 3300017792 Ga0163161_10008435 Ga0163161_100084355 190
521 3300017792 Ga0163161_10024623 Ga0163161_100246233 190
522 3300017792 Ga0163161_10070335 Ga0163161_100703353 190
523 3300025315 Ga0207697_10226660 Ga0207697_102266602 190
524 3300025321 Ga0207656_10006384 Ga0207656_100063843 190
525 3300025899 Ga0207642_10004323 Ga0207642_100043233 190
526 3300025899 Ga0207642_10160687 Ga0207642_101606872 190
527 3300025900 Ga0207710_10001781 Ga0207710_1000178110 190
528 3300025903 Ga0207680_10079798 Ga0207680_100797982 190
529 3300025903 Ga0207680_10084183 Ga0207680_100841832 190
530 3300025904 Ga0207647_10107014 Ga0207647_101070142 190
531 3300025905 Ga0207685_10082641 Ga0207685_100826411 190
532 3300025907 Ga0207645_10005892 Ga0207645_100058923 190
533 3300025907 Ga0207645_10223630 Ga0207645_102236302 190
534 3300025909 Ga0207705_10045085 Ga0207705_100450852 190
535 3300025913 Ga0207695_10000582 Ga0207695_1000058269 190
536 3300025913 Ga0207695_10001064 Ga0207695_1000106410 190
537 3300025913 Ga0207695_10037729 Ga0207695_100377296 190
538 3300025914 Ga0207671_10002275 Ga0207671_100022759 190
539 3300025924 Ga0207694_10187485 Ga0207694_101874851 190
540 3300025926 Ga0207659_10015767 Ga0207659_100157673 190
541 3300025926 Ga0207659_10980117 Ga0207659_109801171 190
542 3300025927 Ga0207687_10039213 Ga0207687_100392133 190
543 3300025932 Ga0207690_10313283 Ga0207690_103132831 190
544 3300025933 Ga0207706_10003305 Ga0207706_1000330513 190
545 3300025933 Ga0207706_10004710 Ga0207706_1000471010 190
546 3300025933 Ga0207706_10015998 Ga0207706_100159987 190
547 3300025934 Ga0207686_10090156 Ga0207686_100901561 190
548 3300025936 Ga0207670_10076046 Ga0207670_100760462 190
549 3300025938 Ga0207704_10025253 Ga0207704_100252532 190
550 3300025938 Ga0207704_10091562 Ga0207704_100915622 190
551 3300025940 Ga0207691_10001280 Ga0207691_1000128016 190
552 3300025940 Ga0207691_10039933 Ga0207691_100399335 190
553 3300025940 Ga0207691_10542377 Ga0207691_105423772 190
554 3300025942 Ga0207689_10010413 Ga0207689_100104134 190
555 3300025942 Ga0207689_10012954 Ga0207689_100129544 190
556 3300025942 Ga0207689_10022449 Ga0207689_100224494 190
557 3300025942 Ga0207689_10023916 Ga0207689_100239164 190
558 3300025942 Ga0207689_10067436 Ga0207689_100674361 190
559 3300025942 Ga0207689_10077907 Ga0207689_100779072 190
560 3300025944 Ga0207661_10015192 Ga0207661_100151922 190
561 3300025944 Ga0207661_10466835 Ga0207661_104668352 190
562 3300025944 Ga0207661_10649239 Ga0207661_106492391 190
563 3300025945 Ga0207679_10001622 Ga0207679_100016229 190
564 3300025945 Ga0207679_10432389 Ga0207679_104323891 190
565 3300025949 Ga0207667_10178887 Ga0207667_101788872 190
566 3300025949 Ga0207667_10232600 Ga0207667_102326002 190
567 3300025960 Ga0207651_10003648 Ga0207651_100036486 190
568 3300025960 Ga0207651_10023738 Ga0207651_100237385 190
569 3300025960 Ga0207651_10047510 Ga0207651_100475103 190
570 3300025961 Ga0207712_10002942 Ga0207712_100029428 190
571 3300025972 Ga0207668_10000514 Ga0207668_100005148 190
572 3300025972 Ga0207668_10240264 Ga0207668_102402642 190
573 3300025981 Ga0207640_10317530 Ga0207640_103175301 190
574 3300025986 Ga0207658_10004126 Ga0207658_100041266 190
575 3300025986 Ga0207658_10121304 Ga0207658_101213042 190
576 3300025986 Ga0207658_10529642 Ga0207658_105296422 190
577 3300025986 Ga0207658_10583704 Ga0207658_105837042 190
578 3300026023 Ga0207677_10002620 Ga0207677_100026204 190
579 3300026023 Ga0207677_10014804 Ga0207677_100148042 190
580 3300026035 Ga0207703_10006377 Ga0207703_100063775 190
581 3300026035 Ga0207703_10547498 Ga0207703_105474981 190
582 3300026035 Ga0207703_11347763 Ga0207703_113477631 190
583 3300026041 Ga0207639_10025183 Ga0207639_100251835 190
584 3300026041 Ga0207639_10132463 Ga0207639_101324633 190
585 3300026067 Ga0207678_10048119 Ga0207678_100481195 190
586 3300026088 Ga0207641_10006788 Ga0207641_100067884 190
587 3300026088 Ga0207641_10292124 Ga0207641_102921241 190
588 3300026089 Ga0207648_10001955 Ga0207648_1000195514 190
589 3300026089 Ga0207648_10006356 Ga0207648_100063565 190
590 3300026089 Ga0207648_10024957 Ga0207648_100249575 190
591 3300026089 Ga0207648_10206548 Ga0207648_102065483 190
592 3300026095 Ga0207676_10006594 Ga0207676_100065946 190
593 3300026116 Ga0207674_10385921 Ga0207674_103859212 190
594 3300026118 Ga0207675_100009475 Ga0207675_1000094757 190
595 3300026118 Ga0207675_100019228 Ga0207675_1000192285 190
596 3300026118 Ga0207675_100954772 Ga0207675_1009547722 190
597 3300026121 Ga0207683_10003845 Ga0207683_100038455 190
598 3300026142 Ga0207698_10022200 Ga0207698_100222003 190
599 3300026142 Ga0207698_10101490 Ga0207698_101014902 190
600 3300026142 Ga0207698_10687034 Ga0207698_106870342 190
601 3300028379 Ga0268266_10006796 Ga0268266_100067967 190
602 3300028380 Ga0268265_10432795 Ga0268265_104327952 190
603 3300028381 Ga0268264_10010248 Ga0268264_100102484 190
604 3300028381 Ga0268264_10014008 Ga0268264_100140085 190
605 3300028381 Ga0268264_10291970 Ga0268264_102919702 190
606 3300028381 Ga0268264_11199342 Ga0268264_111993422 190
607 3300030521 Ga0307511_10000076 Ga0307511_100000765 190
608 3300031247 Ga0265340_10036934 Ga0265340_100369342 190
609 3300031251 Ga0265327_10018351 Ga0265327_100183512 190
610 3300031507 Ga0307509_10404052 Ga0307509_104040522 190
611 3300031595 Ga0265313_10066817 Ga0265313_100668172 190
612 3300031730 Ga0307516_10273191 Ga0307516_102731912 190
613 3300031731 Ga0307405_11073395 Ga0307405_110733951 190
614 3300032002 Ga0307416_100698974 Ga0307416_1006989741 190
615 3300032004 Ga0307414_10126860 Ga0307414_101268601 190
616 3300033180 Ga0307510_10005955 Ga0307510_100059557 190
617 3300035410 Ga0373924_0317785 Ga0373924_0317785_24_623 190
618 3300035692 Ga0373935_0294447 Ga0373935_0294447_209_790 190
619 3300036401 Ga0373937_0019641 Ga0373937_0019641_221_820 190
620 3300036401 Ga0373937_0021464 Ga0373937_0021464_1474_2055 190
621 3300036401 Ga0373937_0096634 Ga0373937_0096634_1217_1798 190
622 3300046454 Ga0495592_0140843 Ga0495592_0140843_281_880 190
623 3300046455 Ga0495603_0228239 Ga0495603_0228239_249_848 190
624 3300046460 Ga0495638_0075489 Ga0495638_0075489_864_1439 190
625 3300046460 Ga0495638_0226480 Ga0495638_0226480_53_637 190
626 3300046473 Ga0495582_0039653 Ga0495582_0039653_58_639 190
627 3300046507 Ga0495606_0007339 Ga0495606_0007339_5922_6506 190
628 3300046516 Ga0495628_0115970 Ga0495628_0115970_1331_1930 190
629 3300046517 Ga0495630_0103456 Ga0495630_0103456_1303_1884 190
630 3300046531 Ga0495665_0207860 Ga0495665_0207860_183_764 190
631 3300046535 Ga0495586_0056497 Ga0495586_0056497_192_773 190
632 3300046535 Ga0495586_0302383 Ga0495586_0302383_244_843 190
633 3300046543 Ga0495645_0305333 Ga0495645_0305333_190_789 190
634 3300046558 Ga0495633_0052789 Ga0495633_0052789_635_1216 190
635 3300046642 Ga0495634_0038674 Ga0495634_0038674_995_1594 190
636 3300046648 Ga0495611_0001743 Ga0495611_0001743_3522_4106 190
637 3300046663 Ga0495635_0670860 Ga0495635_0670860_62_661 190
638 3300046675 Ga0495657_0460042 Ga0495657_0460042_60_659 190
639 3300046678 Ga0495599_0137916 Ga0495599_0137916_425_1024 190
640 3300046683 Ga0495658_0056145 Ga0495658_0056145_431_1012 190
641 3300046691 Ga0495670_0008617 Ga0495670_0008617_2028_2609 190
642 3300046809 Ga0495600_0179947 Ga0495600_0179947_159_758 190
643 3300047319 Ga0495674_0058855 Ga0495674_0058855_663_1244 190
644 3300047320 Ga0495672_0086171 Ga0495672_0086171_188_772 190
645 3300047471 Ga0495684_0100619 Ga0495684_0100619_817_1416 190
646 3300047471 Ga0495684_0310765 Ga0495684_0310765_193_774 190
647 3300047472 Ga0495686_0000005 Ga0495686_0000005_617570_618154 190
648 3300048903 Ga0496100_0908163 Ga0496100_0908163_10_609 190
649 3300048907 Ga0496104_0590565 Ga0496104_0590565_306_887 190
650 3300048917 Ga0496114_0273822 Ga0496114_0273822_182_763 190
651 3300049571 Ga0501034_0355495 Ga0501034_0355495_81_779 190
652 3300049574 Ga0501038_0002256 Ga0501038_0002256_1434_2132 190
653 3300049575 Ga0501039_0081163 Ga0501039_0081163_522_1220 190
654 3300049584 Ga0501068_0132718 Ga0501068_0132718_772_1470 190
655 3300049823 Ga0501044_0026464 Ga0501044_0026464_690_1388 190
656 3300050514 nmdc:mga08x19_226271_c1 nmdc:mga08x19_226271_c1_197_802 190
657 3300053085 Ga0495619_0060746 Ga0495619_0060746_223_822 190
658 3300053092 Ga0500583_0158573 Ga0500583_0158573_418_1002 190
659 3300053146 Ga0500588_0115282 Ga0500588_0115282_28_612 190
660 3300053178 Ga0500637_0290982 Ga0500637_0290982_41_625 190
661 3300053727 Ga0500611_000003 Ga0500611_000003_229021_229596 190
662 3300060353 Ga0501082_0628135 Ga0501082_0628135_40_738 190
663 3300000545 CNXas_1000706 CNXas_10007063 192

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

28

201

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uxt-assembly1.cif.gz_A crystal structure of unknown function protein yfdx from shigella flexneri 0.9572 61 97
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.8872 19 192
8hcr-assembly1.cif.gz_S cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci 0.8708 13 183
6adq-assembly1.cif.gz_S respiratory complex ciii2civ2sod2 from mycobacterium smegmatis 0.8692 21 182
8dh6-assembly1.cif.gz_c cryo-em structure of saccharomyces cerevisiae cytochrome c oxidase (complex iv) extracted in lipid nanodiscs 0.866 19 186
ID Description Score Start End Superfamily
af_Q69QX2_16_155_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9801 60 96 1.25.40.10
af_K7L171_45_128_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9719 60 100 1.25.40.10
af_Q94K88_63_147_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.968 60 100 1.25.40.10
af_A0A1D6NW80_40_127_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8895 54 99 1.20.58.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8818 12 183 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A2M9CY49-F1-model_v4 Cytochrome c oxidase subunit 3 0.9701 10 189 GO:0004129
GO:0005886
GO:0019646
AF-A0A1J5SN52-F1-model_v4 Cytochrome c oxidase subunit 3 (EC 1.9.3.1) 0.9657 12 187 GO:0004129
GO:0016020
GO:0019646
AF-A0A4V3GLI3-F1-model_v4 Cytochrome c oxidase subunit 3 0.9614 12 189 GO:0004129
GO:0005886
GO:0019646
AF-A0A4Q3RBB8-F1-model_v4 Heme-copper oxidase subunit III 0.9612 31 188 GO:0004129
GO:0005886
GO:0019646
AF-A0A3M1NEG7-F1-model_v4 Heme-copper oxidase subunit III 0.953 12 192 GO:0004129
GO:0005886
GO:0019646

Feature Viewer

pLDDT pTM Quality
86.29 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map