F473541
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 663 | 268 | 1326 | 242 |
Family's Representative Sequence
| Representative Sequence | 3300005468|Ga0070707_100000445|Ga0070707_10000044524 |
| Length | 267 |
| Sequence | VSNRRSRCLSFLTVASVLFLVALLAGPAFSGTRRAGAAAQPQVTVYAAASLTNVFPKIDSQATYSFGGSNALAAQIRQGAPADVFASANMKLPTGLNQDGLCSKPVVFTRNRLVIIVPTANPAHIGNIYGLTKTGVTIDIAAAGVPVGDYTRQILKNMNLTAALMKNVVSQETDVREVLSKVALGEVDAGFVYSTDAKTVPGKVNVIKVPAWAQPKVQYGICVVSASTHKAAAQAFVKLVLSKAGQKKLLKFGFLPRVKHTAKHRKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 52 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 61 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 139 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 140 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 141 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 142 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 144 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 145 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 146 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 148 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 149 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 150 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 151 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 152 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 153 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 154 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 155 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 156 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 158 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 159 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 160 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 161 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 166 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 169 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 177 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 178 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 179 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 180 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 181 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 182 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 185 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 186 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 187 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 188 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 189 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 190 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 242 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 243 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 244 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 245 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 250 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 251 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 252 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 253 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 254 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 257 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.85 |
| Metatranscriptomes | 0.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.75 |
| Nodule | 0 |
| Rhizoplane | 16.89 |
| Rhizosphere | 82.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070707_100000445 | 3300005468 | Bacteria | 40989 |
| 2 | Ga0070683_100001618 | 3300005329 | Bacteria | 17420 |
| 3 | Ga0070683_100331414 | 3300005329 | Bacteria | 1449 |
| 4 | Ga0068869_100374860 | 3300005334 | Bacteria | 1165 |
| 5 | Ga0070680_100038421 | 3300005336 | Bacteria | 3872 |
| 6 | Ga0070680_100113619 | 3300005336 | Bacteria | 2256 |
| 7 | Ga0070682_100036952 | 3300005337 | Bacteria | 2988 |
| 8 | Ga0068868_100119059 | 3300005338 | Bacteria | 2153 |
| 9 | Ga0070660_100008236 | 3300005339 | Bacteria | 7286 |
| 10 | Ga0070660_100030781 | 3300005339 | Bacteria | 4027 |
| 11 | Ga0070660_100340188 | 3300005339 | Bacteria | 1235 |
| 12 | Ga0070691_10020490 | 3300005341 | Bacteria | 3056 |
| 13 | Ga0070691_10105179 | 3300005341 | Unclassified | 1406 |
| 14 | Ga0070661_100031242 | 3300005344 | Bacteria | 3849 |
| 15 | Ga0070692_10113771 | 3300005345 | Bacteria | 1500 |
| 16 | Ga0070668_100025235 | 3300005347 | Bacteria | 4505 |
| 17 | Ga0070668_100252715 | 3300005347 | Bacteria | 1464 |
| 18 | Ga0070668_100502204 | 3300005347 | Bacteria | 1050 |
| 19 | Ga0070669_100211063 | 3300005353 | Bacteria | 1532 |
| 20 | Ga0070671_100051609 | 3300005355 | Bacteria | 3420 |
| 21 | Ga0070674_100015115 | 3300005356 | Bacteria | 4812 |
| 22 | Ga0070659_100044012 | 3300005366 | Bacteria | 3493 |
| 23 | Ga0070659_100198257 | 3300005366 | Bacteria | 1652 |
| 24 | Ga0070709_10041206 | 3300005434 | Bacteria | 2844 |
| 25 | Ga0070709_10194030 | 3300005434 | Bacteria | 1434 |
| 26 | Ga0070714_100001615 | 3300005435 | Bacteria | 16390 |
| 27 | Ga0070714_100007601 | 3300005435 | Bacteria | 8438 |
| 28 | Ga0070714_100007814 | 3300005435 | Bacteria | 8332 |
| 29 | Ga0070714_100016982 | 3300005435 | Bacteria | 5889 |
| 30 | Ga0070714_100163085 | 3300005435 | Bacteria | 2018 |
| 31 | Ga0070714_100183010 | 3300005435 | Bacteria | 1907 |
| 32 | Ga0070714_100313347 | 3300005435 | Unclassified | 1466 |
| 33 | Ga0070713_100001979 | 3300005436 | Bacteria | 13224 |
| 34 | Ga0070713_100046856 | 3300005436 | Bacteria | 3549 |
| 35 | Ga0070713_100063409 | 3300005436 | Bacteria | 3098 |
| 36 | Ga0070713_100135039 | 3300005436 | Bacteria | 2179 |
| 37 | Ga0070713_100137844 | 3300005436 | Bacteria | 2158 |
| 38 | Ga0070713_100142875 | 3300005436 | Bacteria | 2121 |
| 39 | Ga0070713_100151127 | 3300005436 | Bacteria | 2066 |
| 40 | Ga0070713_100175846 | 3300005436 | Bacteria | 1921 |
| 41 | Ga0070710_10001198 | 3300005437 | Bacteria | 12272 |
| 42 | Ga0070710_10022719 | 3300005437 | Bacteria | 3285 |
| 43 | Ga0070710_10027716 | 3300005437 | Bacteria | 3024 |
| 44 | Ga0070711_100016338 | 3300005439 | Bacteria | 4712 |
| 45 | Ga0070711_100016526 | 3300005439 | Bacteria | 4687 |
| 46 | Ga0070711_100027857 | 3300005439 | Bacteria | 3713 |
| 47 | Ga0070711_100052570 | 3300005439 | Bacteria | 2804 |
| 48 | Ga0070711_100053977 | 3300005439 | Bacteria | 2772 |
| 49 | Ga0070711_100405946 | 3300005439 | Bacteria | 1107 |
| 50 | Ga0070705_100004172 | 3300005440 | Bacteria | 7058 |
| 51 | Ga0070705_100052988 | 3300005440 | Bacteria | 2373 |
| 52 | Ga0070700_100103151 | 3300005441 | Bacteria | 1883 |
| 53 | Ga0070694_100097957 | 3300005444 | Bacteria | 2069 |
| 54 | Ga0070694_100115975 | 3300005444 | Bacteria | 1915 |
| 55 | Ga0070694_100417451 | 3300005444 | Bacteria | 1053 |
| 56 | Ga0070678_100035759 | 3300005456 | Bacteria | 3471 |
| 57 | Ga0070678_100106715 | 3300005456 | Bacteria | 2183 |
| 58 | Ga0070678_100344256 | 3300005456 | Bacteria | 1280 |
| 59 | Ga0070662_100081026 | 3300005457 | Bacteria | 2418 |
| 60 | Ga0070681_10003984 | 3300005458 | Bacteria | 13931 |
| 61 | Ga0070681_10009371 | 3300005458 | Bacteria | 9633 |
| 62 | Ga0070681_10020410 | 3300005458 | Bacteria | 6641 |
| 63 | Ga0070681_10178293 | 3300005458 | Bacteria | 2047 |
| 64 | Ga0068867_100150855 | 3300005459 | Bacteria | 1825 |
| 65 | Ga0070706_100106082 | 3300005467 | Bacteria | 2614 |
| 66 | Ga0070707_100327840 | 3300005468 | Bacteria | 1488 |
| 67 | Ga0070707_100365301 | 3300005468 | Bacteria | 1402 |
| 68 | Ga0070679_100014687 | 3300005530 | Bacteria | 7528 |
| 69 | Ga0070679_100031637 | 3300005530 | Bacteria | 5229 |
| 70 | Ga0070679_100092184 | 3300005530 | Bacteria | 3017 |
| 71 | Ga0070679_100093684 | 3300005530 | Bacteria | 2991 |
| 72 | Ga0070679_100391083 | 3300005530 | Bacteria | 1337 |
| 73 | Ga0070679_100501557 | 3300005530 | Bacteria | 1158 |
| 74 | Ga0070684_100020900 | 3300005535 | Bacteria | 5433 |
| 75 | Ga0070684_100046844 | 3300005535 | Bacteria | 3746 |
| 76 | Ga0070684_100252893 | 3300005535 | Unclassified | 1611 |
| 77 | Ga0070684_100256801 | 3300005535 | Bacteria | 1598 |
| 78 | Ga0070684_100278586 | 3300005535 | Bacteria | 1532 |
| 79 | Ga0070684_100456038 | 3300005535 | Bacteria | 1182 |
| 80 | Ga0070697_100110712 | 3300005536 | Bacteria | 2288 |
| 81 | Ga0068853_100030330 | 3300005539 | Bacteria | 4567 |
| 82 | Ga0068853_100087810 | 3300005539 | Bacteria | 2729 |
| 83 | Ga0068853_100591319 | 3300005539 | Unclassified | 1053 |
| 84 | Ga0070695_100142910 | 3300005545 | Bacteria | 1662 |
| 85 | Ga0070696_100034855 | 3300005546 | Bacteria | 3464 |
| 86 | Ga0070696_100105810 | 3300005546 | Bacteria | 2022 |
| 87 | Ga0070693_100053663 | 3300005547 | Bacteria | 2315 |
| 88 | Ga0070693_100065862 | 3300005547 | Bacteria | 2118 |
| 89 | Ga0070693_100099925 | 3300005547 | Bacteria | 1766 |
| 90 | Ga0070693_100374074 | 3300005547 | Unclassified | 981 |
| 91 | Ga0070665_100056274 | 3300005548 | Bacteria | 3944 |
| 92 | Ga0070704_100046747 | 3300005549 | Bacteria | 3021 |
| 93 | Ga0070704_100047488 | 3300005549 | Bacteria | 3001 |
| 94 | Ga0070704_100199977 | 3300005549 | Bacteria | 1612 |
| 95 | Ga0068855_100029199 | 3300005563 | Bacteria | 6595 |
| 96 | Ga0068855_100072111 | 3300005563 | Bacteria | 4015 |
| 97 | Ga0070664_100066143 | 3300005564 | Bacteria | 3086 |
| 98 | Ga0068857_100077305 | 3300005577 | Bacteria | 2969 |
| 99 | Ga0068854_100064201 | 3300005578 | Bacteria | 2667 |
| 100 | Ga0068854_100539937 | 3300005578 | Bacteria | 987 |
| 101 | Ga0068856_100060019 | 3300005614 | Bacteria | 3757 |
| 102 | Ga0068856_100143335 | 3300005614 | Bacteria | 2397 |
| 103 | Ga0068856_100242294 | 3300005614 | Bacteria | 1818 |
| 104 | Ga0068856_100381942 | 3300005614 | Bacteria | 1428 |
| 105 | Ga0068856_100387088 | 3300005614 | Bacteria | 1418 |
| 106 | Ga0068856_100419727 | 3300005614 | Unclassified | 1358 |
| 107 | Ga0070702_100055343 | 3300005615 | Unclassified | 2287 |
| 108 | Ga0070702_100067827 | 3300005615 | Bacteria | 2097 |
| 109 | Ga0068852_100156433 | 3300005616 | Bacteria | 2124 |
| 110 | Ga0068861_100000522 | 3300005719 | Bacteria | 22465 |
| 111 | Ga0068861_100178050 | 3300005719 | Bacteria | 1768 |
| 112 | Ga0068858_100605590 | 3300005842 | Bacteria | 1063 |
| 113 | Ga0068862_100040614 | 3300005844 | Bacteria | 3954 |
| 114 | Ga0081455_10007728 | 3300005937 | Bacteria | 11280 |
| 115 | Ga0081455_10067362 | 3300005937 | Bacteria | 2984 |
| 116 | Ga0081540_1002900 | 3300005983 | Bacteria | 13822 |
| 117 | Ga0070717_10002428 | 3300006028 | Bacteria | 13160 |
| 118 | Ga0070717_10015481 | 3300006028 | Bacteria | 5892 |
| 119 | Ga0070717_10083763 | 3300006028 | Bacteria | 2682 |
| 120 | Ga0075365_10001119 | 3300006038 | Bacteria | 11701 |
| 121 | Ga0070715_10000804 | 3300006163 | Bacteria | 8554 |
| 122 | Ga0070715_10007258 | 3300006163 | Bacteria | 3810 |
| 123 | Ga0070715_10026658 | 3300006163 | Bacteria | 2301 |
| 124 | Ga0070716_100001564 | 3300006173 | Bacteria | 10277 |
| 125 | Ga0070716_100033017 | 3300006173 | Bacteria | 2828 |
| 126 | Ga0070712_100016804 | 3300006175 | Bacteria | 4732 |
| 127 | Ga0070712_100065676 | 3300006175 | Bacteria | 2576 |
| 128 | Ga0070712_100092879 | 3300006175 | Unclassified | 2214 |
| 129 | Ga0070712_100311231 | 3300006175 | Unclassified | 1278 |
| 130 | Ga0075367_10155356 | 3300006178 | Bacteria | 1421 |
| 131 | Ga0075428_100716779 | 3300006844 | Bacteria | 1065 |
| 132 | Ga0075431_100162024 | 3300006847 | Bacteria | 2300 |
| 133 | Ga0075433_10062525 | 3300006852 | Bacteria | 3260 |
| 134 | Ga0075434_100023820 | 3300006871 | Bacteria | 5973 |
| 135 | Ga0075434_100144728 | 3300006871 | Bacteria | 2397 |
| 136 | Ga0075436_100018494 | 3300006914 | Bacteria | 4770 |
| 137 | Ga0075435_100049436 | 3300007076 | Bacteria | 3382 |
| 138 | Ga0075435_100104294 | 3300007076 | Bacteria | 2352 |
| 139 | Ga0105240_10080020 | 3300009093 | Bacteria | 4020 |
| 140 | Ga0111539_10108143 | 3300009094 | Bacteria | 3263 |
| 141 | Ga0111539_10248111 | 3300009094 | Bacteria | 2073 |
| 142 | Ga0105245_10010834 | 3300009098 | Bacteria | 7933 |
| 143 | Ga0105245_10028788 | 3300009098 | Bacteria | 4902 |
| 144 | Ga0105245_10030025 | 3300009098 | Bacteria | 4806 |
| 145 | Ga0105245_10061579 | 3300009098 | Bacteria | 3383 |
| 146 | Ga0105245_10072772 | 3300009098 | Bacteria | 3123 |
| 147 | Ga0105245_10171030 | 3300009098 | Bacteria | 2069 |
| 148 | Ga0105245_10305383 | 3300009098 | Bacteria | 1563 |
| 149 | Ga0105245_10817461 | 3300009098 | Bacteria | 971 |
| 150 | Ga0114129_10725491 | 3300009147 | Bacteria | 1275 |
| 151 | Ga0105243_10020436 | 3300009148 | Bacteria | 5021 |
| 152 | Ga0105243_10265719 | 3300009148 | Bacteria | 1538 |
| 153 | Ga0105243_10494826 | 3300009148 | Bacteria | 1157 |
| 154 | Ga0105241_10084203 | 3300009174 | Bacteria | 2496 |
| 155 | Ga0105241_10111169 | 3300009174 | Bacteria | 2193 |
| 156 | Ga0105242_10030581 | 3300009176 | Bacteria | 4300 |
| 157 | Ga0105242_10084528 | 3300009176 | Bacteria | 2660 |
| 158 | Ga0105242_10424274 | 3300009176 | Bacteria | 1247 |
| 159 | Ga0105242_10567460 | 3300009176 | Bacteria | 1091 |
| 160 | Ga0105248_10090057 | 3300009177 | Bacteria | 3454 |
| 161 | Ga0105248_10411059 | 3300009177 | Unclassified | 1523 |
| 162 | Ga0105237_10054714 | 3300009545 | Bacteria | 3998 |
| 163 | Ga0105237_10085590 | 3300009545 | Bacteria | 3142 |
| 164 | Ga0105237_10163848 | 3300009545 | Bacteria | 2222 |
| 165 | Ga0105237_10328245 | 3300009545 | Bacteria | 1534 |
| 166 | Ga0105238_10056329 | 3300009551 | Bacteria | 3944 |
| 167 | Ga0105238_10088524 | 3300009551 | Bacteria | 3082 |
| 168 | Ga0105238_10525085 | 3300009551 | Bacteria | 1187 |
| 169 | Ga0105249_10002723 | 3300009553 | Bacteria | 15279 |
| 170 | Ga0105249_10088354 | 3300009553 | Bacteria | 2895 |
| 171 | Ga0105249_10197095 | 3300009553 | Bacteria | 1969 |
| 172 | Ga0105239_10088652 | 3300010375 | Bacteria | 3411 |
| 173 | Ga0105239_10117623 | 3300010375 | Bacteria | 2950 |
| 174 | Ga0105239_10235874 | 3300010375 | Bacteria | 2053 |
| 175 | Ga0105239_10253259 | 3300010375 | Bacteria | 1978 |
| 176 | Ga0105239_10283961 | 3300010375 | Bacteria | 1864 |
| 177 | Ga0105239_10558908 | 3300010375 | Bacteria | 1303 |
| 178 | Ga0105246_10061389 | 3300011119 | Bacteria | 2615 |
| 179 | Ga0105246_10677620 | 3300011119 | Bacteria | 901 |
| 180 | Ga0157373_10057890 | 3300013100 | Bacteria | 2748 |
| 181 | Ga0157371_10155000 | 3300013102 | Bacteria | 1634 |
| 182 | Ga0157370_10030905 | 3300013104 | Bacteria | 5245 |
| 183 | Ga0157370_10104682 | 3300013104 | Bacteria | 2649 |
| 184 | Ga0157370_10277101 | 3300013104 | Bacteria | 1550 |
| 185 | Ga0157369_10018647 | 3300013105 | Bacteria | 7780 |
| 186 | Ga0157369_10037234 | 3300013105 | Bacteria | 5326 |
| 187 | Ga0157369_10599472 | 3300013105 | Bacteria | 1137 |
| 188 | Ga0157374_10041234 | 3300013296 | Bacteria | 4254 |
| 189 | Ga0157374_10063540 | 3300013296 | Bacteria | 3462 |
| 190 | Ga0157374_10100741 | 3300013296 | Bacteria | 2769 |
| 191 | Ga0157374_10254169 | 3300013296 | Bacteria | 1730 |
| 192 | Ga0157378_10304071 | 3300013297 | Bacteria | 1544 |
| 193 | Ga0163162_10094964 | 3300013306 | Unclassified | 3068 |
| 194 | Ga0163162_10182777 | 3300013306 | Bacteria | 2223 |
| 195 | Ga0157372_10059549 | 3300013307 | Bacteria | 4272 |
| 196 | Ga0157372_10099027 | 3300013307 | Bacteria | 3325 |
| 197 | Ga0157372_10142077 | 3300013307 | Bacteria | 2767 |
| 198 | Ga0157372_10726938 | 3300013307 | Bacteria | 1155 |
| 199 | Ga0157375_10078085 | 3300013308 | Bacteria | 3343 |
| 200 | Ga0157375_10079912 | 3300013308 | Bacteria | 3307 |
| 201 | Ga0157375_10434154 | 3300013308 | Bacteria | 1479 |
| 202 | Ga0157375_10718261 | 3300013308 | Unclassified | 1152 |
| 203 | Ga0163163_10052763 | 3300014325 | Bacteria | 4012 |
| 204 | Ga0157380_10256063 | 3300014326 | Bacteria | 1587 |
| 205 | Ga0182008_10045157 | 3300014497 | Bacteria | 2191 |
| 206 | Ga0157377_10251175 | 3300014745 | Bacteria | 1146 |
| 207 | Ga0157377_10314700 | 3300014745 | Bacteria | 1038 |
| 208 | Ga0157376_10005638 | 3300014969 | Bacteria | 8762 |
| 209 | Ga0157376_10078509 | 3300014969 | Unclassified | 2827 |
| 210 | Ga0163161_10049254 | 3300017792 | Bacteria | 3044 |
| 211 | Ga0206356_10803830 | 3300020070 | Bacteria | 1303 |
| 212 | Ga0207692_10012838 | 3300025898 | Bacteria | 3612 |
| 213 | Ga0207692_10041406 | 3300025898 | Bacteria | 2280 |
| 214 | Ga0207692_10221256 | 3300025898 | Bacteria | 1122 |
| 215 | Ga0207688_10272405 | 3300025901 | Bacteria | 1030 |
| 216 | Ga0207680_10285334 | 3300025903 | Bacteria | 1148 |
| 217 | Ga0207685_10044908 | 3300025905 | Bacteria | 1673 |
| 218 | Ga0207699_10025007 | 3300025906 | Bacteria | 3273 |
| 219 | Ga0207699_10142354 | 3300025906 | Bacteria | 1577 |
| 220 | Ga0207699_10271057 | 3300025906 | Unclassified | 1176 |
| 221 | Ga0207699_10360065 | 3300025906 | Unclassified | 1028 |
| 222 | Ga0207699_10379703 | 3300025906 | Unclassified | 1003 |
| 223 | Ga0207654_10196375 | 3300025911 | Bacteria | 1326 |
| 224 | Ga0207707_10012789 | 3300025912 | Bacteria | 7301 |
| 225 | Ga0207707_10135027 | 3300025912 | Bacteria | 2157 |
| 226 | Ga0207707_10142166 | 3300025912 | Bacteria | 2098 |
| 227 | Ga0207671_10072414 | 3300025914 | Bacteria | 2572 |
| 228 | Ga0207671_10251144 | 3300025914 | Bacteria | 1390 |
| 229 | Ga0207693_10001250 | 3300025915 | Bacteria | 22628 |
| 230 | Ga0207693_10002631 | 3300025915 | Bacteria | 15592 |
| 231 | Ga0207693_10004134 | 3300025915 | Bacteria | 12318 |
| 232 | Ga0207693_10028352 | 3300025915 | Bacteria | 4424 |
| 233 | Ga0207693_10224527 | 3300025915 | Bacteria | 1475 |
| 234 | Ga0207663_10008967 | 3300025916 | Bacteria | 5264 |
| 235 | Ga0207663_10032736 | 3300025916 | Bacteria | 3089 |
| 236 | Ga0207663_10047309 | 3300025916 | Bacteria | 2655 |
| 237 | Ga0207663_10206484 | 3300025916 | Bacteria | 1421 |
| 238 | Ga0207660_10050421 | 3300025917 | Bacteria | 2955 |
| 239 | Ga0207660_10134111 | 3300025917 | Bacteria | 1888 |
| 240 | Ga0207660_10185956 | 3300025917 | Unclassified | 1616 |
| 241 | Ga0207660_10204209 | 3300025917 | Bacteria | 1544 |
| 242 | Ga0207662_10229760 | 3300025918 | Bacteria | 1211 |
| 243 | Ga0207657_10000184 | 3300025919 | Bacteria | 64813 |
| 244 | Ga0207657_10006110 | 3300025919 | Bacteria | 12520 |
| 245 | Ga0207657_10031436 | 3300025919 | Bacteria | 4808 |
| 246 | Ga0207657_10152363 | 3300025919 | Bacteria | 1882 |
| 247 | Ga0207649_10015676 | 3300025920 | Bacteria | 4258 |
| 248 | Ga0207649_10185695 | 3300025920 | Unclassified | 1458 |
| 249 | Ga0207652_10043679 | 3300025921 | Bacteria | 3817 |
| 250 | Ga0207652_10053119 | 3300025921 | Bacteria | 3480 |
| 251 | Ga0207652_10346784 | 3300025921 | Bacteria | 1340 |
| 252 | Ga0207652_10408806 | 3300025921 | Bacteria | 1224 |
| 253 | Ga0207646_10001908 | 3300025922 | Bacteria | 25106 |
| 254 | Ga0207646_10368153 | 3300025922 | Bacteria | 1298 |
| 255 | Ga0207694_10105774 | 3300025924 | Bacteria | 2234 |
| 256 | Ga0207659_10524127 | 3300025926 | Bacteria | 1005 |
| 257 | Ga0207687_10065531 | 3300025927 | Bacteria | 2580 |
| 258 | Ga0207687_10089512 | 3300025927 | Bacteria | 2241 |
| 259 | Ga0207687_10444777 | 3300025927 | Bacteria | 1074 |
| 260 | Ga0207687_10628980 | 3300025927 | Bacteria | 907 |
| 261 | Ga0207700_10004525 | 3300025928 | Bacteria | 8212 |
| 262 | Ga0207700_10052779 | 3300025928 | Bacteria | 3042 |
| 263 | Ga0207700_10062354 | 3300025928 | Bacteria | 2831 |
| 264 | Ga0207700_10066737 | 3300025928 | Bacteria | 2751 |
| 265 | Ga0207700_10143629 | 3300025928 | Bacteria | 1964 |
| 266 | Ga0207700_10160909 | 3300025928 | Bacteria | 1864 |
| 267 | Ga0207700_10615431 | 3300025928 | Bacteria | 967 |
| 268 | Ga0207664_10003765 | 3300025929 | Bacteria | 10188 |
| 269 | Ga0207664_10006073 | 3300025929 | Bacteria | 8272 |
| 270 | Ga0207664_10097280 | 3300025929 | Bacteria | 2424 |
| 271 | Ga0207664_10236486 | 3300025929 | Bacteria | 1589 |
| 272 | Ga0207664_10546104 | 3300025929 | Unclassified | 1039 |
| 273 | Ga0207644_10036655 | 3300025931 | Bacteria | 3445 |
| 274 | Ga0207690_10023249 | 3300025932 | Bacteria | 3867 |
| 275 | Ga0207706_10009100 | 3300025933 | Bacteria | 9131 |
| 276 | Ga0207706_10024089 | 3300025933 | Bacteria | 5459 |
| 277 | Ga0207686_10025828 | 3300025934 | Bacteria | 3422 |
| 278 | Ga0207704_10323057 | 3300025938 | Bacteria | 1191 |
| 279 | Ga0207665_10000620 | 3300025939 | Bacteria | 23807 |
| 280 | Ga0207665_10000927 | 3300025939 | Bacteria | 19822 |
| 281 | Ga0207665_10092557 | 3300025939 | Bacteria | 2098 |
| 282 | Ga0207665_10578282 | 3300025939 | Bacteria | 875 |
| 283 | Ga0207711_10596433 | 3300025941 | Bacteria | 1031 |
| 284 | Ga0207689_10502057 | 3300025942 | Bacteria | 1016 |
| 285 | Ga0207661_10001205 | 3300025944 | Bacteria | 17301 |
| 286 | Ga0207679_10151806 | 3300025945 | Bacteria | 1886 |
| 287 | Ga0207667_10024085 | 3300025949 | Bacteria | 6693 |
| 288 | Ga0207667_10098365 | 3300025949 | Bacteria | 3019 |
| 289 | Ga0207667_10306785 | 3300025949 | Bacteria | 1621 |
| 290 | Ga0207667_10632673 | 3300025949 | Bacteria | 1077 |
| 291 | Ga0207712_10277185 | 3300025961 | Bacteria | 1367 |
| 292 | Ga0207668_10524364 | 3300025972 | Bacteria | 1023 |
| 293 | Ga0207640_10070584 | 3300025981 | Bacteria | 2350 |
| 294 | Ga0207640_10334824 | 3300025981 | Bacteria | 1210 |
| 295 | Ga0207640_10445475 | 3300025981 | Bacteria | 1066 |
| 296 | Ga0207639_10236421 | 3300026041 | Bacteria | 1586 |
| 297 | Ga0207639_10543804 | 3300026041 | Unclassified | 1066 |
| 298 | Ga0207678_10046356 | 3300026067 | Bacteria | 3759 |
| 299 | Ga0207708_10016108 | 3300026075 | Bacteria | 5615 |
| 300 | Ga0207708_10152727 | 3300026075 | Bacteria | 1819 |
| 301 | Ga0207702_10001791 | 3300026078 | Bacteria | 21150 |
| 302 | Ga0207702_10049373 | 3300026078 | Bacteria | 3551 |
| 303 | Ga0207702_10143391 | 3300026078 | Unclassified | 2164 |
| 304 | Ga0207702_10901451 | 3300026078 | Unclassified | 876 |
| 305 | Ga0207648_10799280 | 3300026089 | Bacteria | 878 |
| 306 | Ga0207674_10025286 | 3300026116 | Bacteria | 6336 |
| 307 | Ga0207674_10050877 | 3300026116 | Bacteria | 4230 |
| 308 | Ga0207675_100001195 | 3300026118 | Bacteria | 25880 |
| 309 | Ga0207675_100149496 | 3300026118 | Bacteria | 2222 |
| 310 | Ga0207683_10004424 | 3300026121 | Bacteria | 12146 |
| 311 | Ga0207683_10111714 | 3300026121 | Bacteria | 2447 |
| 312 | Ga0207683_10161967 | 3300026121 | Unclassified | 2023 |
| 313 | Ga0207683_10400372 | 3300026121 | Bacteria | 1263 |
| 314 | Ga0207428_10006125 | 3300027907 | Bacteria | 11112 |
| 315 | Ga0207428_10064822 | 3300027907 | Bacteria | 2884 |
| 316 | Ga0268266_10485389 | 3300028379 | Bacteria | 1178 |
| 317 | Ga0268265_10042602 | 3300028380 | Bacteria | 3370 |
| 318 | Ga0265338_10014335 | 3300028800 | Bacteria | 8828 |
| 319 | Ga0265330_10095104 | 3300031235 | Bacteria | 1277 |
| 320 | Ga0265328_10007616 | 3300031239 | Bacteria | 4505 |
| 321 | Ga0265329_10040426 | 3300031242 | Bacteria | 1496 |
| 322 | Ga0265340_10065712 | 3300031247 | Bacteria | 1727 |
| 323 | Ga0265339_10070399 | 3300031249 | Bacteria | 1865 |
| 324 | Ga0265327_10003767 | 3300031251 | Bacteria | 14076 |
| 325 | Ga0265316_10029734 | 3300031344 | Bacteria | 4487 |
| 326 | Ga0265316_10032014 | 3300031344 | Bacteria | 4296 |
| 327 | Ga0265313_10018343 | 3300031595 | Bacteria | 3931 |
| 328 | Ga0265314_10020854 | 3300031711 | Bacteria | 5053 |
| 329 | Ga0265342_10038478 | 3300031712 | Bacteria | 2913 |
| 330 | Ga0307410_10068334 | 3300031852 | Bacteria | 2454 |
| 331 | Ga0307409_100071566 | 3300031995 | Bacteria | 2758 |
| 332 | Ga0307416_100125707 | 3300032002 | Bacteria | 2296 |
| 333 | Ga0307414_10192164 | 3300032004 | Bacteria | 1653 |
| 334 | Ga0373959_0002199 | 3300034820 | Bacteria | 3109 |
| 335 | Ga0373926_0030362 | 3300035083 | Bacteria | 1903 |
| 336 | Ga0373929_0012024 | 3300035085 | Bacteria | 1640 |
| 337 | Ga0373940_0129589 | 3300035088 | Bacteria | 789 |
| 338 | Ga0373951_0022425 | 3300035091 | Bacteria | 1454 |
| 339 | Ga0373936_0180911 | 3300035113 | Bacteria | 925 |
| 340 | Ga0373939_0076002 | 3300035114 | Bacteria | 1105 |
| 341 | Ga0373941_0139883 | 3300035115 | Bacteria | 879 |
| 342 | Ga0373945_0002914 | 3300035116 | Bacteria | 5376 |
| 343 | Ga0373943_0002185 | 3300035170 | Bacteria | 8897 |
| 344 | Ga0373946_0019620 | 3300035171 | Bacteria | 2606 |
| 345 | Ga0373942_0009510 | 3300035207 | Bacteria | 2278 |
| 346 | Ga0373961_0005949 | 3300035241 | Bacteria | 2931 |
| 347 | Ga0373962_0051698 | 3300035242 | Bacteria | 1186 |
| 348 | Ga0373935_0008309 | 3300035692 | Bacteria | 6210 |
| 349 | Ga0373935_0054227 | 3300035692 | Bacteria | 2552 |
| 350 | Ga0373933_0093576 | 3300035724 | Unclassified | 1858 |
| 351 | Ga0373947_0000992 | 3300035725 | Bacteria | 17358 |
| 352 | Ga0373947_0001831 | 3300035725 | Bacteria | 13012 |
| 353 | Ga0373947_0087473 | 3300035725 | Bacteria | 1938 |
| 354 | Ga0373947_0177796 | 3300035725 | Bacteria | 1384 |
| 355 | Ga0373937_0000308 | 3300036401 | Bacteria | 46115 |
| 356 | Ga0373925_0001399 | 3300037068 | Bacteria | 20978 |
| 357 | Ga0373925_0021650 | 3300037068 | Bacteria | 4686 |
| 358 | Ga0395899_0038486 | 3300037312 | Bacteria | 3582 |
| 359 | Ga0395900_0150400 | 3300037418 | Bacteria | 2378 |
| 360 | Ga0395898_0457868 | 3300037466 | Unclassified | 1215 |
| 361 | Ga0395905_0301261 | 3300037471 | Bacteria | 1490 |
| 362 | Ga0395901_0086924 | 3300038443 | Bacteria | 3269 |
| 363 | Ga0395901_0635424 | 3300038443 | Bacteria | 1073 |
| 364 | Ga0242420_057567 | 3300038996 | Bacteria | 770 |
| 365 | Ga0451853_1625358 | 3300041512 | Bacteria | 1132 |
| 366 | Ga0439448_0014822 | 3300042005 | Bacteria | 2355 |
| 367 | Ga0439455_0057634 | 3300042012 | Bacteria | 1025 |
| 368 | Ga0439463_020636 | 3300042016 | Unclassified | 1644 |
| 369 | Ga0439458_0036103 | 3300042157 | Bacteria | 1189 |
| 370 | Ga0466965_0100297 | 3300044683 | Unclassified | 1480 |
| 371 | Ga0466966_0049919 | 3300044684 | Unclassified | 2663 |
| 372 | Ga0466966_0110380 | 3300044684 | Bacteria | 1696 |
| 373 | Ga0466963_0000532 | 3300044694 | Bacteria | 17888 |
| 374 | Ga0466963_0007505 | 3300044694 | Bacteria | 6507 |
| 375 | Ga0466963_0082771 | 3300044694 | Bacteria | 2176 |
| 376 | Ga0466963_0145721 | 3300044694 | Bacteria | 1643 |
| 377 | Ga0466968_0010627 | 3300044735 | Bacteria | 3574 |
| 378 | Ga0466957_0007081 | 3300044842 | Bacteria | 6341 |
| 379 | Ga0466959_0011375 | 3300045049 | Bacteria | 6393 |
| 380 | Ga0451576_0115678 | 3300045051 | Bacteria | 2792 |
| 381 | Ga0451576_0167075 | 3300045051 | Bacteria | 2296 |
| 382 | Ga0466967_0006110 | 3300045976 | Bacteria | 8470 |
| 383 | Ga0466967_0009880 | 3300045976 | Bacteria | 7117 |
| 384 | Ga0466967_0015339 | 3300045976 | Bacteria | 6001 |
| 385 | Ga0466967_0055221 | 3300045976 | Bacteria | 3498 |
| 386 | Ga0466967_0064317 | 3300045976 | Bacteria | 3262 |
| 387 | Ga0466967_0120169 | 3300045976 | Bacteria | 2426 |
| 388 | Ga0466967_0153259 | 3300045976 | Bacteria | 2156 |
| 389 | Ga0466967_0327674 | 3300045976 | Bacteria | 1478 |
| 390 | Ga0466967_0887812 | 3300045976 | Bacteria | 886 |
| 391 | Ga0495592_0000410 | 3300046454 | Bacteria | 32753 |
| 392 | Ga0495592_0008108 | 3300046454 | Bacteria | 7887 |
| 393 | Ga0495603_0001721 | 3300046455 | Bacteria | 12889 |
| 394 | Ga0495629_0026042 | 3300046459 | Bacteria | 4156 |
| 395 | Ga0495629_0034789 | 3300046459 | Bacteria | 3561 |
| 396 | Ga0495629_0084672 | 3300046459 | Bacteria | 2212 |
| 397 | Ga0495641_0001084 | 3300046461 | Bacteria | 23453 |
| 398 | Ga0495641_0005629 | 3300046461 | Bacteria | 8372 |
| 399 | Ga0495641_0009652 | 3300046461 | Bacteria | 5708 |
| 400 | Ga0495641_0055377 | 3300046461 | Bacteria | 1801 |
| 401 | Ga0495651_0000034 | 3300046462 | Bacteria | 99213 |
| 402 | Ga0495651_0056976 | 3300046462 | Bacteria | 3001 |
| 403 | Ga0495651_0213358 | 3300046462 | Unclassified | 1341 |
| 404 | Ga0495651_0216323 | 3300046462 | Bacteria | 1329 |
| 405 | Ga0495653_0001634 | 3300046463 | Bacteria | 17597 |
| 406 | Ga0495653_0007842 | 3300046463 | Bacteria | 8742 |
| 407 | Ga0495653_0257790 | 3300046463 | Bacteria | 1154 |
| 408 | Ga0495580_0018581 | 3300046472 | Bacteria | 5174 |
| 409 | Ga0495582_0008933 | 3300046473 | Bacteria | 5530 |
| 410 | Ga0495582_0025609 | 3300046473 | Bacteria | 3232 |
| 411 | Ga0495582_0072154 | 3300046473 | Bacteria | 1910 |
| 412 | Ga0495582_0098452 | 3300046473 | Bacteria | 1636 |
| 413 | Ga0495582_0125692 | 3300046473 | Bacteria | 1447 |
| 414 | Ga0495582_0232603 | 3300046473 | Unclassified | 1055 |
| 415 | Ga0495605_0167914 | 3300046474 | Unclassified | 971 |
| 416 | Ga0495639_0009322 | 3300046475 | Bacteria | 4209 |
| 417 | Ga0495662_0005815 | 3300046476 | Bacteria | 6172 |
| 418 | Ga0495662_0029769 | 3300046476 | Bacteria | 2635 |
| 419 | Ga0495664_0003716 | 3300046477 | Bacteria | 8323 |
| 420 | Ga0495594_0016808 | 3300046499 | Bacteria | 3859 |
| 421 | Ga0495608_0001004 | 3300046511 | Bacteria | 19861 |
| 422 | Ga0495608_0027586 | 3300046511 | Bacteria | 3863 |
| 423 | Ga0495608_0035988 | 3300046511 | Bacteria | 3334 |
| 424 | Ga0495618_0008709 | 3300046514 | Bacteria | 6132 |
| 425 | Ga0495618_0048730 | 3300046514 | Bacteria | 2675 |
| 426 | Ga0495618_0082861 | 3300046514 | Bacteria | 2048 |
| 427 | Ga0495618_0108172 | 3300046514 | Bacteria | 1780 |
| 428 | Ga0495618_0133082 | 3300046514 | Bacteria | 1591 |
| 429 | Ga0495618_0260617 | 3300046514 | Bacteria | 1086 |
| 430 | Ga0495618_0320776 | 3300046514 | Bacteria | 960 |
| 431 | Ga0495628_0000184 | 3300046516 | Bacteria | 54832 |
| 432 | Ga0495628_0176333 | 3300046516 | Unclassified | 1619 |
| 433 | Ga0495628_0237549 | 3300046516 | Bacteria | 1364 |
| 434 | Ga0495630_0006556 | 3300046517 | Bacteria | 8289 |
| 435 | Ga0495630_0022305 | 3300046517 | Bacteria | 4676 |
| 436 | Ga0495630_0064879 | 3300046517 | Bacteria | 2744 |
| 437 | Ga0495630_0405452 | 3300046517 | Unclassified | 1045 |
| 438 | Ga0495630_0446491 | 3300046517 | Bacteria | 991 |
| 439 | Ga0495666_0001186 | 3300046526 | Bacteria | 12548 |
| 440 | Ga0495652_0000319 | 3300046529 | Bacteria | 56845 |
| 441 | Ga0495652_0018630 | 3300046529 | Bacteria | 6186 |
| 442 | Ga0495652_0029124 | 3300046529 | Bacteria | 4851 |
| 443 | Ga0495652_0113041 | 3300046529 | Bacteria | 2180 |
| 444 | Ga0495665_0003752 | 3300046531 | Bacteria | 8219 |
| 445 | Ga0495640_0010802 | 3300046533 | Bacteria | 7043 |
| 446 | Ga0495640_0016364 | 3300046533 | Bacteria | 5548 |
| 447 | Ga0495586_0052035 | 3300046535 | Bacteria | 2216 |
| 448 | Ga0495587_0000055 | 3300046536 | Bacteria | 97024 |
| 449 | Ga0495587_0137127 | 3300046536 | Unclassified | 1397 |
| 450 | Ga0495645_0000170 | 3300046543 | Bacteria | 45455 |
| 451 | Ga0495645_0075458 | 3300046543 | Bacteria | 2426 |
| 452 | Ga0495645_0110009 | 3300046543 | Bacteria | 1950 |
| 453 | Ga0495622_0030902 | 3300046557 | Bacteria | 2504 |
| 454 | Ga0495667_0021039 | 3300046559 | Bacteria | 4400 |
| 455 | Ga0495667_0039955 | 3300046559 | Bacteria | 3116 |
| 456 | Ga0495667_0043555 | 3300046559 | Bacteria | 2974 |
| 457 | Ga0495667_0128935 | 3300046559 | Bacteria | 1632 |
| 458 | Ga0495667_0161893 | 3300046559 | Bacteria | 1439 |
| 459 | Ga0495634_0008630 | 3300046642 | Bacteria | 7563 |
| 460 | Ga0495634_0075314 | 3300046642 | Bacteria | 2216 |
| 461 | Ga0495635_0011475 | 3300046663 | Bacteria | 6212 |
| 462 | Ga0495635_0031624 | 3300046663 | Bacteria | 3673 |
| 463 | Ga0495635_0032560 | 3300046663 | Bacteria | 3616 |
| 464 | Ga0495635_0059979 | 3300046663 | Bacteria | 2616 |
| 465 | Ga0495635_0315941 | 3300046663 | Bacteria | 1046 |
| 466 | Ga0495588_0000750 | 3300046674 | Bacteria | 14820 |
| 467 | Ga0495657_0025578 | 3300046675 | Bacteria | 4190 |
| 468 | Ga0495657_0069002 | 3300046675 | Bacteria | 2314 |
| 469 | Ga0495657_0122028 | 3300046675 | Bacteria | 1640 |
| 470 | Ga0495657_0165095 | 3300046675 | Bacteria | 1367 |
| 471 | Ga0495599_0001220 | 3300046678 | Bacteria | 14572 |
| 472 | Ga0495599_0061558 | 3300046678 | Bacteria | 2345 |
| 473 | Ga0495599_0216738 | 3300046678 | Bacteria | 1172 |
| 474 | Ga0495623_0000149 | 3300046679 | Bacteria | 42958 |
| 475 | Ga0495623_0041042 | 3300046679 | Bacteria | 2953 |
| 476 | Ga0495646_0010301 | 3300046680 | Bacteria | 5946 |
| 477 | Ga0495646_0042997 | 3300046680 | Bacteria | 2769 |
| 478 | Ga0495646_0079788 | 3300046680 | Bacteria | 1910 |
| 479 | Ga0495646_0097428 | 3300046680 | Bacteria | 1690 |
| 480 | Ga0495647_0001212 | 3300046681 | Bacteria | 7962 |
| 481 | Ga0495658_0004111 | 3300046683 | Bacteria | 7167 |
| 482 | Ga0495658_0039083 | 3300046683 | Bacteria | 2631 |
| 483 | Ga0495658_0047705 | 3300046683 | Bacteria | 2413 |
| 484 | Ga0495658_0069176 | 3300046683 | Bacteria | 2046 |
| 485 | Ga0495613_0005204 | 3300046689 | Bacteria | 9767 |
| 486 | Ga0495613_0011084 | 3300046689 | Bacteria | 6693 |
| 487 | Ga0495613_0052186 | 3300046689 | Bacteria | 3012 |
| 488 | Ga0495613_0070496 | 3300046689 | Bacteria | 2549 |
| 489 | Ga0495613_0094827 | 3300046689 | Bacteria | 2159 |
| 490 | Ga0495624_0026752 | 3300046690 | Bacteria | 3779 |
| 491 | Ga0495624_0106305 | 3300046690 | Bacteria | 1727 |
| 492 | Ga0495600_0170324 | 3300046809 | Bacteria | 1406 |
| 493 | Ga0495600_0188059 | 3300046809 | Bacteria | 1329 |
| 494 | Ga0495581_0005286 | 3300047315 | Bacteria | 7468 |
| 495 | Ga0495581_0023901 | 3300047315 | Bacteria | 3542 |
| 496 | Ga0495581_0108837 | 3300047315 | Bacteria | 1611 |
| 497 | Ga0495604_0000194 | 3300047317 | Bacteria | 54877 |
| 498 | Ga0495604_0038396 | 3300047317 | Bacteria | 3767 |
| 499 | Ga0495604_0040857 | 3300047317 | Bacteria | 3640 |
| 500 | Ga0495674_0009278 | 3300047319 | Bacteria | 9349 |
| 501 | Ga0495674_0023647 | 3300047319 | Bacteria | 5658 |
| 502 | Ga0495674_0270217 | 3300047319 | Bacteria | 1395 |
| 503 | Ga0495676_0001211 | 3300047321 | Bacteria | 22079 |
| 504 | Ga0495676_0066273 | 3300047321 | Bacteria | 2799 |
| 505 | Ga0495676_0068155 | 3300047321 | Bacteria | 2750 |
| 506 | Ga0495676_0109712 | 3300047321 | Bacteria | 2027 |
| 507 | Ga0495680_0017928 | 3300047322 | Bacteria | 6024 |
| 508 | Ga0495680_0028662 | 3300047322 | Bacteria | 4564 |
| 509 | Ga0495680_0034084 | 3300047322 | Bacteria | 4117 |
| 510 | Ga0495680_0036955 | 3300047322 | Bacteria | 3915 |
| 511 | Ga0495680_0107767 | 3300047322 | Bacteria | 2069 |
| 512 | Ga0495680_0200853 | 3300047322 | Bacteria | 1430 |
| 513 | Ga0495675_0000029 | 3300047444 | Bacteria | 105305 |
| 514 | Ga0495684_0008421 | 3300047471 | Bacteria | 7990 |
| 515 | Ga0495684_0019490 | 3300047471 | Bacteria | 5225 |
| 516 | Ga0495684_0052586 | 3300047471 | Bacteria | 3108 |
| 517 | Ga0495684_0073849 | 3300047471 | Bacteria | 2591 |
| 518 | Ga0495593_0000750 | 3300047673 | Bacteria | 18855 |
| 519 | Ga0495593_0150247 | 3300047673 | Bacteria | 1178 |
| 520 | Ga0495602_0000741 | 3300048088 | Bacteria | 30911 |
| 521 | Ga0495602_0061366 | 3300048088 | Bacteria | 3270 |
| 522 | Ga0495602_0201833 | 3300048088 | Bacteria | 1516 |
| 523 | Ga0495614_0000802 | 3300048089 | Bacteria | 13308 |
| 524 | Ga0496100_0002026 | 3300048903 | Bacteria | 10143 |
| 525 | Ga0496100_0050577 | 3300048903 | Bacteria | 2693 |
| 526 | Ga0496100_0073853 | 3300048903 | Bacteria | 2284 |
| 527 | Ga0496100_0120248 | 3300048903 | Bacteria | 1836 |
| 528 | Ga0496100_0598253 | 3300048903 | Bacteria | 856 |
| 529 | Ga0496101_0028953 | 3300048904 | Bacteria | 3871 |
| 530 | Ga0496101_0081381 | 3300048904 | Bacteria | 2395 |
| 531 | Ga0496101_0110777 | 3300048904 | Bacteria | 2066 |
| 532 | Ga0496101_0117841 | 3300048904 | Bacteria | 2005 |
| 533 | Ga0496101_0176060 | 3300048904 | Bacteria | 1645 |
| 534 | Ga0496101_0334672 | 3300048904 | Bacteria | 1188 |
| 535 | Ga0496102_0015239 | 3300048905 | Bacteria | 6693 |
| 536 | Ga0496102_0016614 | 3300048905 | Bacteria | 6434 |
| 537 | Ga0496102_0049344 | 3300048905 | Bacteria | 3829 |
| 538 | Ga0496102_0087137 | 3300048905 | Bacteria | 2884 |
| 539 | Ga0496102_0535189 | 3300048905 | Bacteria | 1094 |
| 540 | Ga0496103_0011554 | 3300048906 | Bacteria | 5235 |
| 541 | Ga0496103_0013849 | 3300048906 | Bacteria | 4788 |
| 542 | Ga0496103_0016165 | 3300048906 | Bacteria | 4454 |
| 543 | Ga0496103_0028616 | 3300048906 | Bacteria | 3383 |
| 544 | Ga0496103_0125660 | 3300048906 | Bacteria | 1636 |
| 545 | Ga0496103_0227698 | 3300048906 | Unclassified | 1199 |
| 546 | Ga0496104_0007841 | 3300048907 | Bacteria | 9462 |
| 547 | Ga0496104_0026485 | 3300048907 | Bacteria | 5355 |
| 548 | Ga0496104_0035240 | 3300048907 | Bacteria | 4673 |
| 549 | Ga0496104_0051552 | 3300048907 | Bacteria | 3884 |
| 550 | Ga0496104_0053431 | 3300048907 | Bacteria | 3816 |
| 551 | Ga0496104_0119132 | 3300048907 | Bacteria | 2535 |
| 552 | Ga0496104_0137659 | 3300048907 | Bacteria | 2346 |
| 553 | Ga0496104_0299279 | 3300048907 | Bacteria | 1521 |
| 554 | Ga0496104_0337923 | 3300048907 | Unclassified | 1419 |
| 555 | Ga0496104_0497368 | 3300048907 | Unclassified | 1130 |
| 556 | Ga0496104_0794107 | 3300048907 | Bacteria | 853 |
| 557 | Ga0496105_0013301 | 3300048908 | Bacteria | 6530 |
| 558 | Ga0496105_0018312 | 3300048908 | Bacteria | 5626 |
| 559 | Ga0496105_0024704 | 3300048908 | Bacteria | 4884 |
| 560 | Ga0496105_0031426 | 3300048908 | Bacteria | 4352 |
| 561 | Ga0496105_0048496 | 3300048908 | Bacteria | 3505 |
| 562 | Ga0496105_0096726 | 3300048908 | Bacteria | 2438 |
| 563 | Ga0496105_0116215 | 3300048908 | Bacteria | 2207 |
| 564 | Ga0496105_0272699 | 3300048908 | Bacteria | 1366 |
| 565 | Ga0496105_0355204 | 3300048908 | Bacteria | 1170 |
| 566 | Ga0496106_0001209 | 3300048909 | Bacteria | 19302 |
| 567 | Ga0496106_0003352 | 3300048909 | Bacteria | 11940 |
| 568 | Ga0496106_0034352 | 3300048909 | Bacteria | 3786 |
| 569 | Ga0496106_0072264 | 3300048909 | Bacteria | 2638 |
| 570 | Ga0496106_0645948 | 3300048909 | Bacteria | 845 |
| 571 | Ga0496107_0002153 | 3300048910 | Bacteria | 12650 |
| 572 | Ga0496107_0022234 | 3300048910 | Bacteria | 4481 |
| 573 | Ga0496107_0043009 | 3300048910 | Bacteria | 3245 |
| 574 | Ga0496107_0056189 | 3300048910 | Bacteria | 2844 |
| 575 | Ga0496107_0064351 | 3300048910 | Bacteria | 2659 |
| 576 | Ga0496107_0077123 | 3300048910 | Bacteria | 2427 |
| 577 | Ga0496107_0092092 | 3300048910 | Bacteria | 2216 |
| 578 | Ga0496107_0147530 | 3300048910 | Bacteria | 1739 |
| 579 | Ga0496107_0174266 | 3300048910 | Bacteria | 1597 |
| 580 | Ga0496107_0183736 | 3300048910 | Bacteria | 1553 |
| 581 | Ga0496108_0002815 | 3300048911 | Bacteria | 13953 |
| 582 | Ga0496108_0019238 | 3300048911 | Bacteria | 5605 |
| 583 | Ga0496108_0021287 | 3300048911 | Bacteria | 5330 |
| 584 | Ga0496108_0029182 | 3300048911 | Bacteria | 4567 |
| 585 | Ga0496109_0001232 | 3300048912 | Bacteria | 21266 |
| 586 | Ga0496109_0005020 | 3300048912 | Bacteria | 11054 |
| 587 | Ga0496109_0005573 | 3300048912 | Bacteria | 10539 |
| 588 | Ga0496109_0047881 | 3300048912 | Bacteria | 3888 |
| 589 | Ga0496109_0071841 | 3300048912 | Bacteria | 3178 |
| 590 | Ga0496109_0227494 | 3300048912 | Bacteria | 1754 |
| 591 | Ga0496109_0374737 | 3300048912 | Bacteria | 1344 |
| 592 | Ga0496109_0434249 | 3300048912 | Bacteria | 1240 |
| 593 | Ga0496110_0009067 | 3300048913 | Bacteria | 8030 |
| 594 | Ga0496110_0033218 | 3300048913 | Bacteria | 4461 |
| 595 | Ga0496110_0046222 | 3300048913 | Bacteria | 3808 |
| 596 | Ga0496110_0050897 | 3300048913 | Bacteria | 3639 |
| 597 | Ga0496110_0167232 | 3300048913 | Bacteria | 1994 |
| 598 | Ga0496110_0212550 | 3300048913 | Bacteria | 1758 |
| 599 | Ga0496110_0401278 | 3300048913 | Unclassified | 1250 |
| 600 | Ga0496110_0844660 | 3300048913 | Unclassified | 821 |
| 601 | Ga0496110_0891434 | 3300048913 | Bacteria | 795 |
| 602 | Ga0496111_0005326 | 3300048914 | Bacteria | 8220 |
| 603 | Ga0496111_0015430 | 3300048914 | Bacteria | 5243 |
| 604 | Ga0496111_0031394 | 3300048914 | Bacteria | 3784 |
| 605 | Ga0496111_0042948 | 3300048914 | Bacteria | 3248 |
| 606 | Ga0496111_0125221 | 3300048914 | Bacteria | 1899 |
| 607 | Ga0496112_0004871 | 3300048915 | Bacteria | 11475 |
| 608 | Ga0496112_0006887 | 3300048915 | Bacteria | 10023 |
| 609 | Ga0496112_0022139 | 3300048915 | Bacteria | 6055 |
| 610 | Ga0496112_0060726 | 3300048915 | Bacteria | 3725 |
| 611 | Ga0496112_0126562 | 3300048915 | Bacteria | 2525 |
| 612 | Ga0496112_0147595 | 3300048915 | Bacteria | 2320 |
| 613 | Ga0496112_0212009 | 3300048915 | Bacteria | 1894 |
| 614 | Ga0496112_0376562 | 3300048915 | Bacteria | 1361 |
| 615 | Ga0496112_0451272 | 3300048915 | Bacteria | 1223 |
| 616 | Ga0496112_0591204 | 3300048915 | Bacteria | 1042 |
| 617 | Ga0496113_0047407 | 3300048916 | Bacteria | 3193 |
| 618 | Ga0496113_0060094 | 3300048916 | Bacteria | 2864 |
| 619 | Ga0496113_0148427 | 3300048916 | Bacteria | 1849 |
| 620 | Ga0496113_0194542 | 3300048916 | Bacteria | 1610 |
| 621 | Ga0496113_0235370 | 3300048916 | Unclassified | 1461 |
| 622 | Ga0496114_0010264 | 3300048917 | Bacteria | 7452 |
| 623 | Ga0496114_0023553 | 3300048917 | Bacteria | 5025 |
| 624 | Ga0496114_0037856 | 3300048917 | Bacteria | 3991 |
| 625 | Ga0496114_0052431 | 3300048917 | Bacteria | 3399 |
| 626 | Ga0496114_0119004 | 3300048917 | Bacteria | 2270 |
| 627 | Ga0496114_0177480 | 3300048917 | Bacteria | 1859 |
| 628 | Ga0496114_0190790 | 3300048917 | Bacteria | 1793 |
| 629 | Ga0496114_0215113 | 3300048917 | Bacteria | 1686 |
| 630 | Ga0496114_1017841 | 3300048917 | Unclassified | 712 |
| 631 | Ga0496115_0008936 | 3300048918 | Bacteria | 7430 |
| 632 | Ga0496115_0011555 | 3300048918 | Bacteria | 6619 |
| 633 | Ga0496115_0079634 | 3300048918 | Bacteria | 2667 |
| 634 | Ga0496115_0352285 | 3300048918 | Bacteria | 1200 |
| 635 | Ga0496115_0397596 | 3300048918 | Bacteria | 1118 |
| 636 | Ga0501067_0010506 | 3300049583 | Bacteria | 5126 |
| 637 | Ga0501080_0238083 | 3300049742 | Bacteria | 1662 |
| 638 | nmdc:mga0yw44_59693_c1 | 3300050492 | Bacteria | 2334 |
| 639 | nmdc:mga05p37_147843_c1 | 3300050507 | Bacteria | 2876 |
| 640 | nmdc:mga06r32_172321_c1 | 3300050510 | Unclassified | 2148 |
| 641 | nmdc:mga08y16_129259_c1 | 3300050511 | Bacteria | 2628 |
| 642 | nmdc:mga08y16_28704_c1 | 3300050511 | Bacteria | 5864 |
| 643 | nmdc:mga0n895_124533_c1 | 3300050512 | Bacteria | 2600 |
| 644 | nmdc:mga0n895_4355_c1 | 3300050512 | Bacteria | 11608 |
| 645 | nmdc:mga0rr50_17967_c1 | 3300050513 | Bacteria | 4738 |
| 646 | nmdc:mga0rr50_63024_c1 | 3300050513 | Bacteria | 2799 |
| 647 | nmdc:mga08x19_15363_c1 | 3300050514 | Bacteria | 4658 |
| 648 | nmdc:mga0a205_4902_c1 | 3300050515 | Bacteria | 12033 |
| 649 | Ga0495601_0000082 | 3300053077 | Bacteria | 51242 |
| 650 | Ga0495601_0011446 | 3300053077 | Bacteria | 5306 |
| 651 | Ga0495601_0121088 | 3300053077 | Unclassified | 1699 |
| 652 | Ga0495612_0001482 | 3300053078 | Bacteria | 9660 |
| 653 | Ga0495612_0008514 | 3300053078 | Bacteria | 4160 |
| 654 | Ga0495595_0014003 | 3300053084 | Bacteria | 3395 |
| 655 | Ga0495595_0043100 | 3300053084 | Bacteria | 2068 |
| 656 | Ga0495595_0053143 | 3300053084 | Bacteria | 1881 |
| 657 | Ga0495595_0054672 | 3300053084 | Bacteria | 1857 |
| 658 | Ga0495619_0006116 | 3300053085 | Bacteria | 7624 |
| 659 | Ga0495619_0160097 | 3300053085 | Bacteria | 1554 |
| 660 | Ga0495619_0174712 | 3300053085 | Bacteria | 1486 |
| 661 | Ga0495619_0175909 | 3300053085 | Bacteria | 1480 |
| 662 | Ga0500566_0036553 | 3300053094 | Bacteria | 2848 |
| 663 | Ga0500566_0039718 | 3300053094 | Bacteria | 2720 |
| 664 | Ga0070707_100000445 | |||
| 665 | Ga0070683_100001618 | |||
| 666 | Ga0070683_100331414 | |||
| 667 | Ga0068869_100374860 | |||
| 668 | Ga0070680_100038421 | |||
| 669 | Ga0070680_100113619 | |||
| 670 | Ga0070682_100036952 | |||
| 671 | Ga0068868_100119059 | |||
| 672 | Ga0070660_100008236 | |||
| 673 | Ga0070660_100030781 | |||
| 674 | Ga0070660_100340188 | |||
| 675 | Ga0070691_10020490 | |||
| 676 | Ga0070691_10105179 | |||
| 677 | Ga0070661_100031242 | |||
| 678 | Ga0070692_10113771 | |||
| 679 | Ga0070668_100025235 | |||
| 680 | Ga0070668_100252715 | |||
| 681 | Ga0070668_100502204 | |||
| 682 | Ga0070669_100211063 | |||
| 683 | Ga0070671_100051609 | |||
| 684 | Ga0070674_100015115 | |||
| 685 | Ga0070659_100044012 | |||
| 686 | Ga0070659_100198257 | |||
| 687 | Ga0070709_10041206 | |||
| 688 | Ga0070709_10194030 | |||
| 689 | Ga0070714_100001615 | |||
| 690 | Ga0070714_100007601 | |||
| 691 | Ga0070714_100007814 | |||
| 692 | Ga0070714_100016982 | |||
| 693 | Ga0070714_100163085 | |||
| 694 | Ga0070714_100183010 | |||
| 695 | Ga0070714_100313347 | |||
| 696 | Ga0070713_100001979 | |||
| 697 | Ga0070713_100046856 | |||
| 698 | Ga0070713_100063409 | |||
| 699 | Ga0070713_100135039 | |||
| 700 | Ga0070713_100137844 | |||
| 701 | Ga0070713_100142875 | |||
| 702 | Ga0070713_100151127 | |||
| 703 | Ga0070713_100175846 | |||
| 704 | Ga0070710_10001198 | |||
| 705 | Ga0070710_10022719 | |||
| 706 | Ga0070710_10027716 | |||
| 707 | Ga0070711_100016338 | |||
| 708 | Ga0070711_100016526 | |||
| 709 | Ga0070711_100027857 | |||
| 710 | Ga0070711_100052570 | |||
| 711 | Ga0070711_100053977 | |||
| 712 | Ga0070711_100405946 | |||
| 713 | Ga0070705_100004172 | |||
| 714 | Ga0070705_100052988 | |||
| 715 | Ga0070700_100103151 | |||
| 716 | Ga0070694_100097957 | |||
| 717 | Ga0070694_100115975 | |||
| 718 | Ga0070694_100417451 | |||
| 719 | Ga0070678_100035759 | |||
| 720 | Ga0070678_100106715 | |||
| 721 | Ga0070678_100344256 | |||
| 722 | Ga0070662_100081026 | |||
| 723 | Ga0070681_10003984 | |||
| 724 | Ga0070681_10009371 | |||
| 725 | Ga0070681_10020410 | |||
| 726 | Ga0070681_10178293 | |||
| 727 | Ga0068867_100150855 | |||
| 728 | Ga0070706_100106082 | |||
| 729 | Ga0070707_100327840 | |||
| 730 | Ga0070707_100365301 | |||
| 731 | Ga0070679_100014687 | |||
| 732 | Ga0070679_100031637 | |||
| 733 | Ga0070679_100092184 | |||
| 734 | Ga0070679_100093684 | |||
| 735 | Ga0070679_100391083 | |||
| 736 | Ga0070679_100501557 | |||
| 737 | Ga0070684_100020900 | |||
| 738 | Ga0070684_100046844 | |||
| 739 | Ga0070684_100252893 | |||
| 740 | Ga0070684_100256801 | |||
| 741 | Ga0070684_100278586 | |||
| 742 | Ga0070684_100456038 | |||
| 743 | Ga0070697_100110712 | |||
| 744 | Ga0068853_100030330 | |||
| 745 | Ga0068853_100087810 | |||
| 746 | Ga0068853_100591319 | |||
| 747 | Ga0070695_100142910 | |||
| 748 | Ga0070696_100034855 | |||
| 749 | Ga0070696_100105810 | |||
| 750 | Ga0070693_100053663 | |||
| 751 | Ga0070693_100065862 | |||
| 752 | Ga0070693_100099925 | |||
| 753 | Ga0070693_100374074 | |||
| 754 | Ga0070665_100056274 | |||
| 755 | Ga0070704_100046747 | |||
| 756 | Ga0070704_100047488 | |||
| 757 | Ga0070704_100199977 | |||
| 758 | Ga0068855_100029199 | |||
| 759 | Ga0068855_100072111 | |||
| 760 | Ga0070664_100066143 | |||
| 761 | Ga0068857_100077305 | |||
| 762 | Ga0068854_100064201 | |||
| 763 | Ga0068854_100539937 | |||
| 764 | Ga0068856_100060019 | |||
| 765 | Ga0068856_100143335 | |||
| 766 | Ga0068856_100242294 | |||
| 767 | Ga0068856_100381942 | |||
| 768 | Ga0068856_100387088 | |||
| 769 | Ga0068856_100419727 | |||
| 770 | Ga0070702_100055343 | |||
| 771 | Ga0070702_100067827 | |||
| 772 | Ga0068852_100156433 | |||
| 773 | Ga0068861_100000522 | |||
| 774 | Ga0068861_100178050 | |||
| 775 | Ga0068858_100605590 | |||
| 776 | Ga0068862_100040614 | |||
| 777 | Ga0081455_10007728 | |||
| 778 | Ga0081455_10067362 | |||
| 779 | Ga0081540_1002900 | |||
| 780 | Ga0070717_10002428 | |||
| 781 | Ga0070717_10015481 | |||
| 782 | Ga0070717_10083763 | |||
| 783 | Ga0075365_10001119 | |||
| 784 | Ga0070715_10000804 | |||
| 785 | Ga0070715_10007258 | |||
| 786 | Ga0070715_10026658 | |||
| 787 | Ga0070716_100001564 | |||
| 788 | Ga0070716_100033017 | |||
| 789 | Ga0070712_100016804 | |||
| 790 | Ga0070712_100065676 | |||
| 791 | Ga0070712_100092879 | |||
| 792 | Ga0070712_100311231 | |||
| 793 | Ga0075367_10155356 | |||
| 794 | Ga0075428_100716779 | |||
| 795 | Ga0075431_100162024 | |||
| 796 | Ga0075433_10062525 | |||
| 797 | Ga0075434_100023820 | |||
| 798 | Ga0075434_100144728 | |||
| 799 | Ga0075436_100018494 | |||
| 800 | Ga0075435_100049436 | |||
| 801 | Ga0075435_100104294 | |||
| 802 | Ga0105240_10080020 | |||
| 803 | Ga0111539_10108143 | |||
| 804 | Ga0111539_10248111 | |||
| 805 | Ga0105245_10010834 | |||
| 806 | Ga0105245_10028788 | |||
| 807 | Ga0105245_10030025 | |||
| 808 | Ga0105245_10061579 | |||
| 809 | Ga0105245_10072772 | |||
| 810 | Ga0105245_10171030 | |||
| 811 | Ga0105245_10305383 | |||
| 812 | Ga0105245_10817461 | |||
| 813 | Ga0114129_10725491 | |||
| 814 | Ga0105243_10020436 | |||
| 815 | Ga0105243_10265719 | |||
| 816 | Ga0105243_10494826 | |||
| 817 | Ga0105241_10084203 | |||
| 818 | Ga0105241_10111169 | |||
| 819 | Ga0105242_10030581 | |||
| 820 | Ga0105242_10084528 | |||
| 821 | Ga0105242_10424274 | |||
| 822 | Ga0105242_10567460 | |||
| 823 | Ga0105248_10090057 | |||
| 824 | Ga0105248_10411059 | |||
| 825 | Ga0105237_10054714 | |||
| 826 | Ga0105237_10085590 | |||
| 827 | Ga0105237_10163848 | |||
| 828 | Ga0105237_10328245 | |||
| 829 | Ga0105238_10056329 | |||
| 830 | Ga0105238_10088524 | |||
| 831 | Ga0105238_10525085 | |||
| 832 | Ga0105249_10002723 | |||
| 833 | Ga0105249_10088354 | |||
| 834 | Ga0105249_10197095 | |||
| 835 | Ga0105239_10088652 | |||
| 836 | Ga0105239_10117623 | |||
| 837 | Ga0105239_10235874 | |||
| 838 | Ga0105239_10253259 | |||
| 839 | Ga0105239_10283961 | |||
| 840 | Ga0105239_10558908 | |||
| 841 | Ga0105246_10061389 | |||
| 842 | Ga0105246_10677620 | |||
| 843 | Ga0157373_10057890 | |||
| 844 | Ga0157371_10155000 | |||
| 845 | Ga0157370_10030905 | |||
| 846 | Ga0157370_10104682 | |||
| 847 | Ga0157370_10277101 | |||
| 848 | Ga0157369_10018647 | |||
| 849 | Ga0157369_10037234 | |||
| 850 | Ga0157369_10599472 | |||
| 851 | Ga0157374_10041234 | |||
| 852 | Ga0157374_10063540 | |||
| 853 | Ga0157374_10100741 | |||
| 854 | Ga0157374_10254169 | |||
| 855 | Ga0157378_10304071 | |||
| 856 | Ga0163162_10094964 | |||
| 857 | Ga0163162_10182777 | |||
| 858 | Ga0157372_10059549 | |||
| 859 | Ga0157372_10099027 | |||
| 860 | Ga0157372_10142077 | |||
| 861 | Ga0157372_10726938 | |||
| 862 | Ga0157375_10078085 | |||
| 863 | Ga0157375_10079912 | |||
| 864 | Ga0157375_10434154 | |||
| 865 | Ga0157375_10718261 | |||
| 866 | Ga0163163_10052763 | |||
| 867 | Ga0157380_10256063 | |||
| 868 | Ga0182008_10045157 | |||
| 869 | Ga0157377_10251175 | |||
| 870 | Ga0157377_10314700 | |||
| 871 | Ga0157376_10005638 | |||
| 872 | Ga0157376_10078509 | |||
| 873 | Ga0163161_10049254 | |||
| 874 | Ga0206356_10803830 | |||
| 875 | Ga0207692_10012838 | |||
| 876 | Ga0207692_10041406 | |||
| 877 | Ga0207692_10221256 | |||
| 878 | Ga0207688_10272405 | |||
| 879 | Ga0207680_10285334 | |||
| 880 | Ga0207685_10044908 | |||
| 881 | Ga0207699_10025007 | |||
| 882 | Ga0207699_10142354 | |||
| 883 | Ga0207699_10271057 | |||
| 884 | Ga0207699_10360065 | |||
| 885 | Ga0207699_10379703 | |||
| 886 | Ga0207654_10196375 | |||
| 887 | Ga0207707_10012789 | |||
| 888 | Ga0207707_10135027 | |||
| 889 | Ga0207707_10142166 | |||
| 890 | Ga0207671_10072414 | |||
| 891 | Ga0207671_10251144 | |||
| 892 | Ga0207693_10001250 | |||
| 893 | Ga0207693_10002631 | |||
| 894 | Ga0207693_10004134 | |||
| 895 | Ga0207693_10028352 | |||
| 896 | Ga0207693_10224527 | |||
| 897 | Ga0207663_10008967 | |||
| 898 | Ga0207663_10032736 | |||
| 899 | Ga0207663_10047309 | |||
| 900 | Ga0207663_10206484 | |||
| 901 | Ga0207660_10050421 | |||
| 902 | Ga0207660_10134111 | |||
| 903 | Ga0207660_10185956 | |||
| 904 | Ga0207660_10204209 | |||
| 905 | Ga0207662_10229760 | |||
| 906 | Ga0207657_10000184 | |||
| 907 | Ga0207657_10006110 | |||
| 908 | Ga0207657_10031436 | |||
| 909 | Ga0207657_10152363 | |||
| 910 | Ga0207649_10015676 | |||
| 911 | Ga0207649_10185695 | |||
| 912 | Ga0207652_10043679 | |||
| 913 | Ga0207652_10053119 | |||
| 914 | Ga0207652_10346784 | |||
| 915 | Ga0207652_10408806 | |||
| 916 | Ga0207646_10001908 | |||
| 917 | Ga0207646_10368153 | |||
| 918 | Ga0207694_10105774 | |||
| 919 | Ga0207659_10524127 | |||
| 920 | Ga0207687_10065531 | |||
| 921 | Ga0207687_10089512 | |||
| 922 | Ga0207687_10444777 | |||
| 923 | Ga0207687_10628980 | |||
| 924 | Ga0207700_10004525 | |||
| 925 | Ga0207700_10052779 | |||
| 926 | Ga0207700_10062354 | |||
| 927 | Ga0207700_10066737 | |||
| 928 | Ga0207700_10143629 | |||
| 929 | Ga0207700_10160909 | |||
| 930 | Ga0207700_10615431 | |||
| 931 | Ga0207664_10003765 | |||
| 932 | Ga0207664_10006073 | |||
| 933 | Ga0207664_10097280 | |||
| 934 | Ga0207664_10236486 | |||
| 935 | Ga0207664_10546104 | |||
| 936 | Ga0207644_10036655 | |||
| 937 | Ga0207690_10023249 | |||
| 938 | Ga0207706_10009100 | |||
| 939 | Ga0207706_10024089 | |||
| 940 | Ga0207686_10025828 | |||
| 941 | Ga0207704_10323057 | |||
| 942 | Ga0207665_10000620 | |||
| 943 | Ga0207665_10000927 | |||
| 944 | Ga0207665_10092557 | |||
| 945 | Ga0207665_10578282 | |||
| 946 | Ga0207711_10596433 | |||
| 947 | Ga0207689_10502057 | |||
| 948 | Ga0207661_10001205 | |||
| 949 | Ga0207679_10151806 | |||
| 950 | Ga0207667_10024085 | |||
| 951 | Ga0207667_10098365 | |||
| 952 | Ga0207667_10306785 | |||
| 953 | Ga0207667_10632673 | |||
| 954 | Ga0207712_10277185 | |||
| 955 | Ga0207668_10524364 | |||
| 956 | Ga0207640_10070584 | |||
| 957 | Ga0207640_10334824 | |||
| 958 | Ga0207640_10445475 | |||
| 959 | Ga0207639_10236421 | |||
| 960 | Ga0207639_10543804 | |||
| 961 | Ga0207678_10046356 | |||
| 962 | Ga0207708_10016108 | |||
| 963 | Ga0207708_10152727 | |||
| 964 | Ga0207702_10001791 | |||
| 965 | Ga0207702_10049373 | |||
| 966 | Ga0207702_10143391 | |||
| 967 | Ga0207702_10901451 | |||
| 968 | Ga0207648_10799280 | |||
| 969 | Ga0207674_10025286 | |||
| 970 | Ga0207674_10050877 | |||
| 971 | Ga0207675_100001195 | |||
| 972 | Ga0207675_100149496 | |||
| 973 | Ga0207683_10004424 | |||
| 974 | Ga0207683_10111714 | |||
| 975 | Ga0207683_10161967 | |||
| 976 | Ga0207683_10400372 | |||
| 977 | Ga0207428_10006125 | |||
| 978 | Ga0207428_10064822 | |||
| 979 | Ga0268266_10485389 | |||
| 980 | Ga0268265_10042602 | |||
| 981 | Ga0265338_10014335 | |||
| 982 | Ga0265330_10095104 | |||
| 983 | Ga0265328_10007616 | |||
| 984 | Ga0265329_10040426 | |||
| 985 | Ga0265340_10065712 | |||
| 986 | Ga0265339_10070399 | |||
| 987 | Ga0265327_10003767 | |||
| 988 | Ga0265316_10029734 | |||
| 989 | Ga0265316_10032014 | |||
| 990 | Ga0265313_10018343 | |||
| 991 | Ga0265314_10020854 | |||
| 992 | Ga0265342_10038478 | |||
| 993 | Ga0307410_10068334 | |||
| 994 | Ga0307409_100071566 | |||
| 995 | Ga0307416_100125707 | |||
| 996 | Ga0307414_10192164 | |||
| 997 | Ga0373959_0002199 | |||
| 998 | Ga0373926_0030362 | |||
| 999 | Ga0373929_0012024 | |||
| 1000 | Ga0373940_0129589 | |||
| 1001 | Ga0373951_0022425 | |||
| 1002 | Ga0373936_0180911 | |||
| 1003 | Ga0373939_0076002 | |||
| 1004 | Ga0373941_0139883 | |||
| 1005 | Ga0373945_0002914 | |||
| 1006 | Ga0373943_0002185 | |||
| 1007 | Ga0373946_0019620 | |||
| 1008 | Ga0373942_0009510 | |||
| 1009 | Ga0373961_0005949 | |||
| 1010 | Ga0373962_0051698 | |||
| 1011 | Ga0373935_0008309 | |||
| 1012 | Ga0373935_0054227 | |||
| 1013 | Ga0373933_0093576 | |||
| 1014 | Ga0373947_0000992 | |||
| 1015 | Ga0373947_0001831 | |||
| 1016 | Ga0373947_0087473 | |||
| 1017 | Ga0373947_0177796 | |||
| 1018 | Ga0373937_0000308 | |||
| 1019 | Ga0373925_0001399 | |||
| 1020 | Ga0373925_0021650 | |||
| 1021 | Ga0395899_0038486 | |||
| 1022 | Ga0395900_0150400 | |||
| 1023 | Ga0395898_0457868 | |||
| 1024 | Ga0395905_0301261 | |||
| 1025 | Ga0395901_0086924 | |||
| 1026 | Ga0395901_0635424 | |||
| 1027 | Ga0242420_057567 | |||
| 1028 | Ga0451853_1625358 | |||
| 1029 | Ga0439448_0014822 | |||
| 1030 | Ga0439455_0057634 | |||
| 1031 | Ga0439463_020636 | |||
| 1032 | Ga0439458_0036103 | |||
| 1033 | Ga0466965_0100297 | |||
| 1034 | Ga0466966_0049919 | |||
| 1035 | Ga0466966_0110380 | |||
| 1036 | Ga0466963_0000532 | |||
| 1037 | Ga0466963_0007505 | |||
| 1038 | Ga0466963_0082771 | |||
| 1039 | Ga0466963_0145721 | |||
| 1040 | Ga0466968_0010627 | |||
| 1041 | Ga0466957_0007081 | |||
| 1042 | Ga0466959_0011375 | |||
| 1043 | Ga0451576_0115678 | |||
| 1044 | Ga0451576_0167075 | |||
| 1045 | Ga0466967_0006110 | |||
| 1046 | Ga0466967_0009880 | |||
| 1047 | Ga0466967_0015339 | |||
| 1048 | Ga0466967_0055221 | |||
| 1049 | Ga0466967_0064317 | |||
| 1050 | Ga0466967_0120169 | |||
| 1051 | Ga0466967_0153259 | |||
| 1052 | Ga0466967_0327674 | |||
| 1053 | Ga0466967_0887812 | |||
| 1054 | Ga0495592_0000410 | |||
| 1055 | Ga0495592_0008108 | |||
| 1056 | Ga0495603_0001721 | |||
| 1057 | Ga0495629_0026042 | |||
| 1058 | Ga0495629_0034789 | |||
| 1059 | Ga0495629_0084672 | |||
| 1060 | Ga0495641_0001084 | |||
| 1061 | Ga0495641_0005629 | |||
| 1062 | Ga0495641_0009652 | |||
| 1063 | Ga0495641_0055377 | |||
| 1064 | Ga0495651_0000034 | |||
| 1065 | Ga0495651_0056976 | |||
| 1066 | Ga0495651_0213358 | |||
| 1067 | Ga0495651_0216323 | |||
| 1068 | Ga0495653_0001634 | |||
| 1069 | Ga0495653_0007842 | |||
| 1070 | Ga0495653_0257790 | |||
| 1071 | Ga0495580_0018581 | |||
| 1072 | Ga0495582_0008933 | |||
| 1073 | Ga0495582_0025609 | |||
| 1074 | Ga0495582_0072154 | |||
| 1075 | Ga0495582_0098452 | |||
| 1076 | Ga0495582_0125692 | |||
| 1077 | Ga0495582_0232603 | |||
| 1078 | Ga0495605_0167914 | |||
| 1079 | Ga0495639_0009322 | |||
| 1080 | Ga0495662_0005815 | |||
| 1081 | Ga0495662_0029769 | |||
| 1082 | Ga0495664_0003716 | |||
| 1083 | Ga0495594_0016808 | |||
| 1084 | Ga0495608_0001004 | |||
| 1085 | Ga0495608_0027586 | |||
| 1086 | Ga0495608_0035988 | |||
| 1087 | Ga0495618_0008709 | |||
| 1088 | Ga0495618_0048730 | |||
| 1089 | Ga0495618_0082861 | |||
| 1090 | Ga0495618_0108172 | |||
| 1091 | Ga0495618_0133082 | |||
| 1092 | Ga0495618_0260617 | |||
| 1093 | Ga0495618_0320776 | |||
| 1094 | Ga0495628_0000184 | |||
| 1095 | Ga0495628_0176333 | |||
| 1096 | Ga0495628_0237549 | |||
| 1097 | Ga0495630_0006556 | |||
| 1098 | Ga0495630_0022305 | |||
| 1099 | Ga0495630_0064879 | |||
| 1100 | Ga0495630_0405452 | |||
| 1101 | Ga0495630_0446491 | |||
| 1102 | Ga0495666_0001186 | |||
| 1103 | Ga0495652_0000319 | |||
| 1104 | Ga0495652_0018630 | |||
| 1105 | Ga0495652_0029124 | |||
| 1106 | Ga0495652_0113041 | |||
| 1107 | Ga0495665_0003752 | |||
| 1108 | Ga0495640_0010802 | |||
| 1109 | Ga0495640_0016364 | |||
| 1110 | Ga0495586_0052035 | |||
| 1111 | Ga0495587_0000055 | |||
| 1112 | Ga0495587_0137127 | |||
| 1113 | Ga0495645_0000170 | |||
| 1114 | Ga0495645_0075458 | |||
| 1115 | Ga0495645_0110009 | |||
| 1116 | Ga0495622_0030902 | |||
| 1117 | Ga0495667_0021039 | |||
| 1118 | Ga0495667_0039955 | |||
| 1119 | Ga0495667_0043555 | |||
| 1120 | Ga0495667_0128935 | |||
| 1121 | Ga0495667_0161893 | |||
| 1122 | Ga0495634_0008630 | |||
| 1123 | Ga0495634_0075314 | |||
| 1124 | Ga0495635_0011475 | |||
| 1125 | Ga0495635_0031624 | |||
| 1126 | Ga0495635_0032560 | |||
| 1127 | Ga0495635_0059979 | |||
| 1128 | Ga0495635_0315941 | |||
| 1129 | Ga0495588_0000750 | |||
| 1130 | Ga0495657_0025578 | |||
| 1131 | Ga0495657_0069002 | |||
| 1132 | Ga0495657_0122028 | |||
| 1133 | Ga0495657_0165095 | |||
| 1134 | Ga0495599_0001220 | |||
| 1135 | Ga0495599_0061558 | |||
| 1136 | Ga0495599_0216738 | |||
| 1137 | Ga0495623_0000149 | |||
| 1138 | Ga0495623_0041042 | |||
| 1139 | Ga0495646_0010301 | |||
| 1140 | Ga0495646_0042997 | |||
| 1141 | Ga0495646_0079788 | |||
| 1142 | Ga0495646_0097428 | |||
| 1143 | Ga0495647_0001212 | |||
| 1144 | Ga0495658_0004111 | |||
| 1145 | Ga0495658_0039083 | |||
| 1146 | Ga0495658_0047705 | |||
| 1147 | Ga0495658_0069176 | |||
| 1148 | Ga0495613_0005204 | |||
| 1149 | Ga0495613_0011084 | |||
| 1150 | Ga0495613_0052186 | |||
| 1151 | Ga0495613_0070496 | |||
| 1152 | Ga0495613_0094827 | |||
| 1153 | Ga0495624_0026752 | |||
| 1154 | Ga0495624_0106305 | |||
| 1155 | Ga0495600_0170324 | |||
| 1156 | Ga0495600_0188059 | |||
| 1157 | Ga0495581_0005286 | |||
| 1158 | Ga0495581_0023901 | |||
| 1159 | Ga0495581_0108837 | |||
| 1160 | Ga0495604_0000194 | |||
| 1161 | Ga0495604_0038396 | |||
| 1162 | Ga0495604_0040857 | |||
| 1163 | Ga0495674_0009278 | |||
| 1164 | Ga0495674_0023647 | |||
| 1165 | Ga0495674_0270217 | |||
| 1166 | Ga0495676_0001211 | |||
| 1167 | Ga0495676_0066273 | |||
| 1168 | Ga0495676_0068155 | |||
| 1169 | Ga0495676_0109712 | |||
| 1170 | Ga0495680_0017928 | |||
| 1171 | Ga0495680_0028662 | |||
| 1172 | Ga0495680_0034084 | |||
| 1173 | Ga0495680_0036955 | |||
| 1174 | Ga0495680_0107767 | |||
| 1175 | Ga0495680_0200853 | |||
| 1176 | Ga0495675_0000029 | |||
| 1177 | Ga0495684_0008421 | |||
| 1178 | Ga0495684_0019490 | |||
| 1179 | Ga0495684_0052586 | |||
| 1180 | Ga0495684_0073849 | |||
| 1181 | Ga0495593_0000750 | |||
| 1182 | Ga0495593_0150247 | |||
| 1183 | Ga0495602_0000741 | |||
| 1184 | Ga0495602_0061366 | |||
| 1185 | Ga0495602_0201833 | |||
| 1186 | Ga0495614_0000802 | |||
| 1187 | Ga0496100_0002026 | |||
| 1188 | Ga0496100_0050577 | |||
| 1189 | Ga0496100_0073853 | |||
| 1190 | Ga0496100_0120248 | |||
| 1191 | Ga0496100_0598253 | |||
| 1192 | Ga0496101_0028953 | |||
| 1193 | Ga0496101_0081381 | |||
| 1194 | Ga0496101_0110777 | |||
| 1195 | Ga0496101_0117841 | |||
| 1196 | Ga0496101_0176060 | |||
| 1197 | Ga0496101_0334672 | |||
| 1198 | Ga0496102_0015239 | |||
| 1199 | Ga0496102_0016614 | |||
| 1200 | Ga0496102_0049344 | |||
| 1201 | Ga0496102_0087137 | |||
| 1202 | Ga0496102_0535189 | |||
| 1203 | Ga0496103_0011554 | |||
| 1204 | Ga0496103_0013849 | |||
| 1205 | Ga0496103_0016165 | |||
| 1206 | Ga0496103_0028616 | |||
| 1207 | Ga0496103_0125660 | |||
| 1208 | Ga0496103_0227698 | |||
| 1209 | Ga0496104_0007841 | |||
| 1210 | Ga0496104_0026485 | |||
| 1211 | Ga0496104_0035240 | |||
| 1212 | Ga0496104_0051552 | |||
| 1213 | Ga0496104_0053431 | |||
| 1214 | Ga0496104_0119132 | |||
| 1215 | Ga0496104_0137659 | |||
| 1216 | Ga0496104_0299279 | |||
| 1217 | Ga0496104_0337923 | |||
| 1218 | Ga0496104_0497368 | |||
| 1219 | Ga0496104_0794107 | |||
| 1220 | Ga0496105_0013301 | |||
| 1221 | Ga0496105_0018312 | |||
| 1222 | Ga0496105_0024704 | |||
| 1223 | Ga0496105_0031426 | |||
| 1224 | Ga0496105_0048496 | |||
| 1225 | Ga0496105_0096726 | |||
| 1226 | Ga0496105_0116215 | |||
| 1227 | Ga0496105_0272699 | |||
| 1228 | Ga0496105_0355204 | |||
| 1229 | Ga0496106_0001209 | |||
| 1230 | Ga0496106_0003352 | |||
| 1231 | Ga0496106_0034352 | |||
| 1232 | Ga0496106_0072264 | |||
| 1233 | Ga0496106_0645948 | |||
| 1234 | Ga0496107_0002153 | |||
| 1235 | Ga0496107_0022234 | |||
| 1236 | Ga0496107_0043009 | |||
| 1237 | Ga0496107_0056189 | |||
| 1238 | Ga0496107_0064351 | |||
| 1239 | Ga0496107_0077123 | |||
| 1240 | Ga0496107_0092092 | |||
| 1241 | Ga0496107_0147530 | |||
| 1242 | Ga0496107_0174266 | |||
| 1243 | Ga0496107_0183736 | |||
| 1244 | Ga0496108_0002815 | |||
| 1245 | Ga0496108_0019238 | |||
| 1246 | Ga0496108_0021287 | |||
| 1247 | Ga0496108_0029182 | |||
| 1248 | Ga0496109_0001232 | |||
| 1249 | Ga0496109_0005020 | |||
| 1250 | Ga0496109_0005573 | |||
| 1251 | Ga0496109_0047881 | |||
| 1252 | Ga0496109_0071841 | |||
| 1253 | Ga0496109_0227494 | |||
| 1254 | Ga0496109_0374737 | |||
| 1255 | Ga0496109_0434249 | |||
| 1256 | Ga0496110_0009067 | |||
| 1257 | Ga0496110_0033218 | |||
| 1258 | Ga0496110_0046222 | |||
| 1259 | Ga0496110_0050897 | |||
| 1260 | Ga0496110_0167232 | |||
| 1261 | Ga0496110_0212550 | |||
| 1262 | Ga0496110_0401278 | |||
| 1263 | Ga0496110_0844660 | |||
| 1264 | Ga0496110_0891434 | |||
| 1265 | Ga0496111_0005326 | |||
| 1266 | Ga0496111_0015430 | |||
| 1267 | Ga0496111_0031394 | |||
| 1268 | Ga0496111_0042948 | |||
| 1269 | Ga0496111_0125221 | |||
| 1270 | Ga0496112_0004871 | |||
| 1271 | Ga0496112_0006887 | |||
| 1272 | Ga0496112_0022139 | |||
| 1273 | Ga0496112_0060726 | |||
| 1274 | Ga0496112_0126562 | |||
| 1275 | Ga0496112_0147595 | |||
| 1276 | Ga0496112_0212009 | |||
| 1277 | Ga0496112_0376562 | |||
| 1278 | Ga0496112_0451272 | |||
| 1279 | Ga0496112_0591204 | |||
| 1280 | Ga0496113_0047407 | |||
| 1281 | Ga0496113_0060094 | |||
| 1282 | Ga0496113_0148427 | |||
| 1283 | Ga0496113_0194542 | |||
| 1284 | Ga0496113_0235370 | |||
| 1285 | Ga0496114_0010264 | |||
| 1286 | Ga0496114_0023553 | |||
| 1287 | Ga0496114_0037856 | |||
| 1288 | Ga0496114_0052431 | |||
| 1289 | Ga0496114_0119004 | |||
| 1290 | Ga0496114_0177480 | |||
| 1291 | Ga0496114_0190790 | |||
| 1292 | Ga0496114_0215113 | |||
| 1293 | Ga0496114_1017841 | |||
| 1294 | Ga0496115_0008936 | |||
| 1295 | Ga0496115_0011555 | |||
| 1296 | Ga0496115_0079634 | |||
| 1297 | Ga0496115_0352285 | |||
| 1298 | Ga0496115_0397596 | |||
| 1299 | Ga0501067_0010506 | |||
| 1300 | Ga0501080_0238083 | |||
| 1301 | nmdc:mga0yw44_59693_c1 | |||
| 1302 | nmdc:mga05p37_147843_c1 | |||
| 1303 | nmdc:mga06r32_172321_c1 | |||
| 1304 | nmdc:mga08y16_129259_c1 | |||
| 1305 | nmdc:mga08y16_28704_c1 | |||
| 1306 | nmdc:mga0n895_124533_c1 | |||
| 1307 | nmdc:mga0n895_4355_c1 | |||
| 1308 | nmdc:mga0rr50_17967_c1 | |||
| 1309 | nmdc:mga0rr50_63024_c1 | |||
| 1310 | nmdc:mga08x19_15363_c1 | |||
| 1311 | nmdc:mga0a205_4902_c1 | |||
| 1312 | Ga0495601_0000082 | |||
| 1313 | Ga0495601_0011446 | |||
| 1314 | Ga0495601_0121088 | |||
| 1315 | Ga0495612_0001482 | |||
| 1316 | Ga0495612_0008514 | |||
| 1317 | Ga0495595_0014003 | |||
| 1318 | Ga0495595_0043100 | |||
| 1319 | Ga0495595_0053143 | |||
| 1320 | Ga0495595_0054672 | |||
| 1321 | Ga0495619_0006116 | |||
| 1322 | Ga0495619_0160097 | |||
| 1323 | Ga0495619_0174712 | |||
| 1324 | Ga0495619_0175909 | |||
| 1325 | Ga0500566_0036553 | |||
| 1326 | Ga0500566_0039718 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4kd5-assembly1.cif.gz_C | substrate binding domain of putative molybdenum abc transporter from clostridium difficile | 0.9066 | 35 | 251 |
| 8k8k-assembly1.cif.gz_A | structure of klebsiella pneumonia moda | 0.8933 | 35 | 250 |
| 3k6v-assembly1.cif.gz_A | m. acetivorans molybdate-binding protein (moda) in citrate-bound open form | 0.8916 | 36 | 251 |
| 6nio-assembly1.cif.gz_A | crystal structure of the molybdate transporter periplasmic protein moda from yersinia pestis | 0.8649 | 35 | 250 |
| 4kd5-assembly1.cif.gz_C | substrate binding domain of putative molybdenum abc transporter from clostridium difficile | 0.8577 | 35 | 251 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FVX4_42_108_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9751 | 36 | 92 | 3.40.190.10 |
| 4rxlA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9282 | 35 | 102 | 3.40.190.10 |
| 1sbpA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9015 | 35 | 93 | 3.40.190.10 |
| af_P9WGU3_42_110_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8956 | 38 | 93 | 3.40.190.10 |
| 4kd5D02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8486 | 105 | 207 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0D2JUF4-F1-model_v4 | Molybdenum ABC transporter substrate-binding protein | 0.9534 | 36 | 251 |
GO:0015689
GO:0030288 GO:0030973 GO:0046872 |
| AF-A0A1Q8BKX2-F1-model_v4 | Molybdate ABC transporter substrate-binding protein | 0.9522 | 63 | 252 |
GO:0015689
GO:0030973 |
| AF-A0A848DAH8-F1-model_v4 | Tungstate ABC transporter substrate-binding protein WtpA | 0.9431 | 32 | 253 |
GO:0015689
GO:0030973 GO:1901359 |
| AF-A0A1F5UY20-F1-model_v4 | Molybdate ABC transporter substrate-binding protein | 0.9407 | 30 | 251 |
GO:0015689
GO:0030973 GO:0046872 |
| AF-A0A378ZMV0-F1-model_v4 | deleted | 0.9325 | 83 | 253 |
|