F473494

General Info

Members Datasets Scaffolds Average Seq Length
662 226 1324 101

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0050889|Ga0466963_0050889_707_1060
Length 117
Sequence MADAGCGNVKQEDVRMIARRWHGQVPAAKAEEYLQLTKDVGLADYRRTAGNLAAWCLHRTEGDIVHVETFTLWESEEAIRRFAGEELTKAKYYDFDPDFLLELEPEVLHFDVIEAGS

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
170 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
171 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
180 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
181 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
182 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
183 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
193 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
215 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
216 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
217 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
218 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
223 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
224 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
225 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.98
Rhizosphere 94.56
Stem 0
Stem Tuber 0
Unclassified 8.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0050889 3300044694 Bacteria 2743
2 JGI24741J21665_1043976 3300001915 Unclassified 658
3 JGI24739J22299_10079994 3300001989 Bacteria 1005
4 JGI24737J22298_10055793 3300001990 Bacteria 1194
5 JGI24737J22298_10058896 3300001990 Bacteria 1158
6 JGI24737J22298_10068407 3300001990 Bacteria 1062
7 JGI24743J22301_10086298 3300001991 Bacteria 666
8 JGI24735J21928_10103614 3300002067 Bacteria 817
9 JGI24745J21846_1007959 3300002073 Bacteria 1190
10 JGI24748J21848_1054345 3300002074 Unclassified 527
11 JGI24738J21930_10042067 3300002075 Bacteria 928
12 Ga0065712_10387002 3300005290 Bacteria 746
13 Ga0065712_10392532 3300005290 Bacteria 732
14 Ga0065712_10671758 3300005290 Bacteria 546
15 Ga0065715_10241140 3300005293 Bacteria 1199
16 Ga0065715_10400873 3300005293 Bacteria 882
17 Ga0070658_10009163 3300005327 Bacteria 7956
18 Ga0070658_10023704 3300005327 Bacteria 4922
19 Ga0070658_10468539 3300005327 Bacteria 1086
20 Ga0070658_10679526 3300005327 Unclassified 893
21 Ga0070658_11129073 3300005327 Bacteria 682
22 Ga0070658_11164278 3300005327 Bacteria 670
23 Ga0070676_10127255 3300005328 Bacteria 1607
24 Ga0070676_10358227 3300005328 Bacteria 1005
25 Ga0070676_10501774 3300005328 Unclassified 861
26 Ga0070676_11221310 3300005328 Bacteria 572
27 Ga0070676_11261608 3300005328 Unclassified 563
28 Ga0070683_100315947 3300005329 Bacteria 1486
29 Ga0070683_100342100 3300005329 Bacteria 1424
30 Ga0070683_101553023 3300005329 Unclassified 636
31 Ga0070690_100014038 3300005330 Bacteria 4748
32 Ga0070670_100043484 3300005331 Bacteria 3861
33 Ga0070670_100158702 3300005331 Bacteria 1960
34 Ga0070670_100886115 3300005331 Bacteria 808
35 Ga0070670_100943140 3300005331 Unclassified 783
36 Ga0070677_10002056 3300005333 Bacteria 6407
37 Ga0068869_100048712 3300005334 Bacteria 3066
38 Ga0068869_100060679 3300005334 Bacteria 2772
39 Ga0070666_10127825 3300005335 Bacteria 1764
40 Ga0070666_11515494 3300005335 Unclassified 502
41 Ga0070682_100395735 3300005337 Bacteria 1043
42 Ga0070682_100416743 3300005337 Bacteria 1020
43 Ga0068868_100052653 3300005338 Bacteria 3204
44 Ga0068868_100089457 3300005338 Bacteria 2479
45 Ga0068868_100197744 3300005338 Bacteria 1674
46 Ga0068868_100520257 3300005338 Unclassified 1044
47 Ga0070660_100002916 3300005339 Bacteria 11778
48 Ga0070660_100017493 3300005339 Bacteria 5227
49 Ga0070660_100106658 3300005339 Bacteria 2225
50 Ga0070660_100150706 3300005339 Bacteria 1869
51 Ga0070660_100334053 3300005339 Bacteria 1246
52 Ga0070660_100545607 3300005339 Bacteria 967
53 Ga0070660_100597082 3300005339 Bacteria 923
54 Ga0070660_100682729 3300005339 Bacteria 861
55 Ga0070689_100639866 3300005340 Bacteria 924
56 Ga0070689_100939482 3300005340 Bacteria 767
57 Ga0070689_101682805 3300005340 Bacteria 577
58 Ga0070687_100201490 3300005343 Bacteria 1206
59 Ga0070661_100021154 3300005344 Bacteria 4644
60 Ga0070661_100093619 3300005344 Bacteria 2226
61 Ga0070661_100108287 3300005344 Bacteria 2073
62 Ga0070692_10003963 3300005345 Bacteria 6109
63 Ga0070692_11160465 3300005345 Unclassified 548
64 Ga0070668_100203343 3300005347 Bacteria 1627
65 Ga0070668_102068667 3300005347 Bacteria 525
66 Ga0070669_100329757 3300005353 Unclassified 1234
67 Ga0070669_100582179 3300005353 Bacteria 936
68 Ga0070669_100826050 3300005353 Bacteria 789
69 Ga0070669_101774942 3300005353 Bacteria 538
70 Ga0070675_100014605 3300005354 Bacteria 6192
71 Ga0070675_100048163 3300005354 Bacteria 3493
72 Ga0070675_100072952 3300005354 Bacteria 2849
73 Ga0070675_100188403 3300005354 Bacteria 1786
74 Ga0070675_100427407 3300005354 Bacteria 1185
75 Ga0070675_100429992 3300005354 Bacteria 1182
76 Ga0070671_100168223 3300005355 Bacteria 1854
77 Ga0070671_100204586 3300005355 Bacteria 1674
78 Ga0070671_100466503 3300005355 Bacteria 1084
79 Ga0070671_100756838 3300005355 Bacteria 844
80 Ga0070671_100861551 3300005355 Bacteria 790
81 Ga0070671_101904743 3300005355 Bacteria 529
82 Ga0070674_100218341 3300005356 Bacteria 1482
83 Ga0070674_100828249 3300005356 Unclassified 801
84 Ga0070673_100002933 3300005364 Bacteria 10514
85 Ga0070673_100020139 3300005364 Bacteria 4806
86 Ga0070673_100073609 3300005364 Bacteria 2750
87 Ga0070673_100437340 3300005364 Bacteria 1175
88 Ga0070673_100472652 3300005364 Bacteria 1130
89 Ga0070673_100581336 3300005364 Bacteria 1020
90 Ga0070659_100001498 3300005366 Bacteria 16822
91 Ga0070659_100019042 3300005366 Bacteria 5190
92 Ga0070659_100043016 3300005366 Bacteria 3532
93 Ga0070659_100046754 3300005366 Bacteria 3392
94 Ga0070659_100093000 3300005366 Bacteria 2419
95 Ga0070659_100232210 3300005366 Bacteria 1525
96 Ga0070659_100321447 3300005366 Bacteria 1294
97 Ga0070659_100417855 3300005366 Bacteria 1134
98 Ga0070659_101180176 3300005366 Bacteria 676
99 Ga0070667_100019378 3300005367 Bacteria 5644
100 Ga0070667_101882398 3300005367 Unclassified 563
101 Ga0070701_10758070 3300005438 Bacteria 658
102 Ga0070694_100005190 3300005444 Bacteria 7865
103 Ga0070663_100013864 3300005455 Bacteria 5156
104 Ga0070663_100061153 3300005455 Bacteria 2711
105 Ga0070663_100297138 3300005455 Bacteria 1291
106 Ga0070663_100400029 3300005455 Bacteria 1122
107 Ga0070663_100606131 3300005455 Bacteria 921
108 Ga0070663_100767432 3300005455 Bacteria 824
109 Ga0070678_100014694 3300005456 Bacteria 4950
110 Ga0070678_100146588 3300005456 Bacteria 1896
111 Ga0070678_100158573 3300005456 Bacteria 1831
112 Ga0070678_100299764 3300005456 Bacteria 1365
113 Ga0070662_100007584 3300005457 Bacteria 7041
114 Ga0070662_100036370 3300005457 Bacteria 3482
115 Ga0070662_100062642 3300005457 Bacteria 2718
116 Ga0070662_100099868 3300005457 Bacteria 2195
117 Ga0070662_100239935 3300005457 Bacteria 1453
118 Ga0070662_100355105 3300005457 Bacteria 1202
119 Ga0070662_100495577 3300005457 Bacteria 1018
120 Ga0070681_10646138 3300005458 Bacteria 973
121 Ga0068867_100012857 3300005459 Bacteria 5925
122 Ga0068867_100050584 3300005459 Bacteria 3063
123 Ga0068867_100113370 3300005459 Bacteria 2086
124 Ga0068867_100306036 3300005459 Unclassified 1312
125 Ga0068867_100477374 3300005459 Bacteria 1068
126 Ga0068867_102137844 3300005459 Bacteria 530
127 Ga0068867_102250552 3300005459 Bacteria 518
128 Ga0070679_100337349 3300005530 Bacteria 1456
129 Ga0070684_100009573 3300005535 Bacteria 7634
130 Ga0070684_101539782 3300005535 Unclassified 627
131 Ga0068853_100126824 3300005539 Bacteria 2280
132 Ga0068853_100258700 3300005539 Bacteria 1599
133 Ga0068853_100419687 3300005539 Bacteria 1254
134 Ga0068853_101008436 3300005539 Bacteria 801
135 Ga0070672_100003314 3300005543 Bacteria 10425
136 Ga0070672_100010561 3300005543 Bacteria 6408
137 Ga0070672_100044808 3300005543 Bacteria 3418
138 Ga0070672_100198269 3300005543 Bacteria 1678
139 Ga0070672_100678957 3300005543 Bacteria 901
140 Ga0070672_101591096 3300005543 Bacteria 586
141 Ga0070686_100026056 3300005544 Bacteria 3524
142 Ga0070693_100072667 3300005547 Bacteria 2029
143 Ga0070693_100537645 3300005547 Bacteria 834
144 Ga0070665_100214728 3300005548 Bacteria 1925
145 Ga0070665_101706745 3300005548 Unclassified 637
146 Ga0070704_100368836 3300005549 Bacteria 1217
147 Ga0070704_100887396 3300005549 Bacteria 801
148 Ga0068855_100015361 3300005563 Bacteria 9217
149 Ga0070664_100017369 3300005564 Bacteria 5908
150 Ga0070664_100030332 3300005564 Bacteria 4511
151 Ga0070664_100052344 3300005564 Bacteria 3458
152 Ga0070664_100128864 3300005564 Bacteria 2221
153 Ga0070664_100287435 3300005564 Bacteria 1484
154 Ga0070664_100332594 3300005564 Bacteria 1378
155 Ga0070664_100369937 3300005564 Bacteria 1306
156 Ga0070664_100491010 3300005564 Bacteria 1131
157 Ga0070664_100660678 3300005564 Bacteria 972
158 Ga0068857_100229820 3300005577 Bacteria 1696
159 Ga0068857_100239712 3300005577 Bacteria 1660
160 Ga0068857_100324033 3300005577 Bacteria 1423
161 Ga0068857_100634563 3300005577 Bacteria 1011
162 Ga0068854_100013859 3300005578 Bacteria 5302
163 Ga0068854_100070671 3300005578 Bacteria 2552
164 Ga0068854_100270277 3300005578 Bacteria 1365
165 Ga0068854_100353988 3300005578 Bacteria 1203
166 Ga0068856_100092163 3300005614 Bacteria 3015
167 Ga0068856_100248803 3300005614 Bacteria 1793
168 Ga0068856_102376447 3300005614 Bacteria 538
169 Ga0070702_101116033 3300005615 Bacteria 631
170 Ga0068852_100190221 3300005616 Bacteria 1936
171 Ga0068852_100258336 3300005616 Bacteria 1672
172 Ga0068852_100260957 3300005616 Bacteria 1663
173 Ga0068852_100353012 3300005616 Bacteria 1436
174 Ga0068852_100574521 3300005616 Bacteria 1129
175 Ga0068852_100734233 3300005616 Bacteria 999
176 Ga0068859_100042537 3300005617 Bacteria 4564
177 Ga0068859_100066011 3300005617 Bacteria 3653
178 Ga0068859_100108081 3300005617 Bacteria 2843
179 Ga0068859_100527285 3300005617 Bacteria 1276
180 Ga0068859_101581906 3300005617 Unclassified 724
181 Ga0068864_100021994 3300005618 Bacteria 5345
182 Ga0068864_100710070 3300005618 Bacteria 983
183 Ga0068864_100762110 3300005618 Bacteria 949
184 Ga0068864_101299173 3300005618 Bacteria 728
185 Ga0068866_10106785 3300005718 Bacteria 1554
186 Ga0068861_100039024 3300005719 Bacteria 3542
187 Ga0068861_100421962 3300005719 Bacteria 1189
188 Ga0068861_100873382 3300005719 Bacteria 850
189 Ga0068851_10051936 3300005834 Bacteria 2084
190 Ga0068851_10170739 3300005834 Bacteria 1200
191 Ga0068851_10188648 3300005834 Bacteria 1145
192 Ga0068870_10558323 3300005840 Bacteria 772
193 Ga0068870_10565487 3300005840 Bacteria 768
194 Ga0068870_10669771 3300005840 Bacteria 713
195 Ga0068870_10930649 3300005840 Unclassified 616
196 Ga0068863_100029478 3300005841 Bacteria 5238
197 Ga0068863_100035238 3300005841 Bacteria 4767
198 Ga0068863_100069207 3300005841 Bacteria 3337
199 Ga0068863_100987212 3300005841 Bacteria 844
200 Ga0068863_101967217 3300005841 Bacteria 595
201 Ga0068858_100002681 3300005842 Bacteria 17926
202 Ga0068858_100003085 3300005842 Bacteria 16664
203 Ga0068858_100124532 3300005842 Bacteria 2412
204 Ga0068858_101066798 3300005842 Bacteria 793
205 Ga0068858_102000559 3300005842 Unclassified 573
206 Ga0068860_100020669 3300005843 Bacteria 6377
207 Ga0068860_100192192 3300005843 Bacteria 1975
208 Ga0068860_100199921 3300005843 Bacteria 1936
209 Ga0068860_100315833 3300005843 Bacteria 1533
210 Ga0068860_100980061 3300005843 Bacteria 863
211 Ga0068862_100123481 3300005844 Bacteria 2284
212 Ga0068862_100383981 3300005844 Bacteria 1311
213 Ga0081540_1310992 3300005983 Bacteria 541
214 Ga0097621_100018075 3300006237 Bacteria 5375
215 Ga0097621_100022688 3300006237 Bacteria 4875
216 Ga0097621_101335584 3300006237 Bacteria 678
217 Ga0068871_100006672 3300006358 Bacteria 8186
218 Ga0068871_100020489 3300006358 Bacteria 5067
219 Ga0068865_100177086 3300006881 Bacteria 1640
220 Ga0068865_100319544 3300006881 Bacteria 1248
221 Ga0097620_100042536 3300006931 Bacteria 4564
222 Ga0097620_100066009 3300006931 Bacteria 3653
223 Ga0097620_100108076 3300006931 Bacteria 2843
224 Ga0097620_100527246 3300006931 Bacteria 1276
225 Ga0097620_101581817 3300006931 Unclassified 724
226 Ga0075435_101228635 3300007076 Bacteria 656
227 Ga0105240_10092288 3300009093 Bacteria 3698
228 Ga0105240_10099051 3300009093 Bacteria 3549
229 Ga0105245_10088781 3300009098 Bacteria 2840
230 Ga0105245_10215052 3300009098 Bacteria 1852
231 Ga0105245_11531982 3300009098 Bacteria 718
232 Ga0105247_10635256 3300009101 Bacteria 796
233 Ga0105243_10032446 3300009148 Bacteria 4036
234 Ga0105243_10087596 3300009148 Bacteria 2556
235 Ga0105242_10035055 3300009176 Bacteria 4024
236 Ga0105242_10488859 3300009176 Bacteria 1168
237 Ga0105248_10092890 3300009177 Bacteria 3398
238 Ga0105248_10242948 3300009177 Bacteria 2027
239 Ga0105248_10785751 3300009177 Unclassified 1074
240 Ga0105248_12246542 3300009177 Unclassified 621
241 Ga0105237_10292425 3300009545 Bacteria 1632
242 Ga0105237_10302014 3300009545 Bacteria 1604
243 Ga0105238_10312167 3300009551 Bacteria 1557
244 Ga0105238_10443107 3300009551 Bacteria 1295
245 Ga0105249_10003824 3300009553 Bacteria 12988
246 Ga0105249_10046926 3300009553 Bacteria 3933
247 Ga0105239_10059064 3300010375 Bacteria 4209
248 Ga0105239_10400269 3300010375 Bacteria 1554
249 Ga0105246_10092360 3300011119 Bacteria 2184
250 Ga0105246_10111833 3300011119 Bacteria 2008
251 Ga0105246_10238029 3300011119 Bacteria 1437
252 Ga0157324_1053570 3300012506 Unclassified 532
253 Ga0157373_10072454 3300013100 Bacteria 2432
254 Ga0157373_10431712 3300013100 Bacteria 946
255 Ga0157373_10479078 3300013100 Bacteria 898
256 Ga0157371_10021916 3300013102 Bacteria 4689
257 Ga0157371_10054189 3300013102 Bacteria 2849
258 Ga0157371_10450339 3300013102 Bacteria 946
259 Ga0157371_10534352 3300013102 Bacteria 868
260 Ga0157371_11116356 3300013102 Bacteria 605
261 Ga0157371_11242129 3300013102 Bacteria 575
262 Ga0157370_10173096 3300013104 Bacteria 2006
263 Ga0157369_10032296 3300013105 Bacteria 5759
264 Ga0157374_10002117 3300013296 Bacteria 16704
265 Ga0157374_10864067 3300013296 Bacteria 922
266 Ga0157374_11059263 3300013296 Bacteria 831
267 Ga0157378_10029798 3300013297 Bacteria 4819
268 Ga0157378_10329552 3300013297 Bacteria 1485
269 Ga0157378_12104726 3300013297 Bacteria 615
270 Ga0157378_12228453 3300013297 Bacteria 599
271 Ga0163162_10048011 3300013306 Bacteria 4277
272 Ga0163162_10196687 3300013306 Bacteria 2145
273 Ga0163162_10244378 3300013306 Bacteria 1926
274 Ga0163162_11116655 3300013306 Bacteria 893
275 Ga0157372_10201368 3300013307 Bacteria 2306
276 Ga0157372_10844395 3300013307 Bacteria 1063
277 Ga0157372_11050239 3300013307 Bacteria 943
278 Ga0157375_10002436 3300013308 Bacteria 16100
279 Ga0157375_10132398 3300013308 Bacteria 2614
280 Ga0157375_10632028 3300013308 Bacteria 1228
281 Ga0163163_10030946 3300014325 Bacteria 5161
282 Ga0163163_10077220 3300014325 Bacteria 3326
283 Ga0163163_10617577 3300014325 Bacteria 1147
284 Ga0157380_10361982 3300014326 Bacteria 1361
285 Ga0157380_11479581 3300014326 Bacteria 732
286 Ga0182008_10489633 3300014497 Bacteria 674
287 Ga0157377_10126762 3300014745 Bacteria 1554
288 Ga0157377_10780132 3300014745 Bacteria 702
289 Ga0157379_10172270 3300014968 Bacteria 1954
290 Ga0157379_10198591 3300014968 Bacteria 1813
291 Ga0157376_10074650 3300014969 Bacteria 2891
292 Ga0163161_10532649 3300017792 Bacteria 960
293 Ga0213876_10010995 3300021384 Bacteria 4845
294 Ga0207697_10015712 3300025315 Bacteria 3125
295 Ga0207656_10142766 3300025321 Bacteria 1129
296 Ga0207656_10186177 3300025321 Bacteria 998
297 Ga0207656_10656502 3300025321 Bacteria 536
298 Ga0207656_10669191 3300025321 Unclassified 531
299 Ga0207682_10001680 3300025893 Bacteria 10144
300 Ga0207642_10024259 3300025899 Bacteria 2436
301 Ga0207642_10032357 3300025899 Bacteria 2201
302 Ga0207642_10958961 3300025899 Bacteria 550
303 Ga0207688_10031465 3300025901 Bacteria 2929
304 Ga0207688_10365045 3300025901 Bacteria 891
305 Ga0207688_10387086 3300025901 Unclassified 866
306 Ga0207688_10609673 3300025901 Bacteria 688
307 Ga0207688_10915032 3300025901 Bacteria 555
308 Ga0207680_10009732 3300025903 Bacteria 4781
309 Ga0207680_10034145 3300025903 Bacteria 2908
310 Ga0207680_10332210 3300025903 Bacteria 1065
311 Ga0207680_11151749 3300025903 Unclassified 554
312 Ga0207647_10005416 3300025904 Bacteria 9361
313 Ga0207647_10253440 3300025904 Bacteria 1009
314 Ga0207647_10258765 3300025904 Bacteria 997
315 Ga0207645_10036740 3300025907 Bacteria 3145
316 Ga0207645_10060995 3300025907 Bacteria 2409
317 Ga0207645_10318194 3300025907 Bacteria 1038
318 Ga0207643_10022032 3300025908 Bacteria 3506
319 Ga0207643_10716016 3300025908 Bacteria 647
320 Ga0207705_10010637 3300025909 Bacteria 6683
321 Ga0207705_10025886 3300025909 Bacteria 4187
322 Ga0207705_10082766 3300025909 Bacteria 2341
323 Ga0207705_10133578 3300025909 Bacteria 1848
324 Ga0207705_10422114 3300025909 Bacteria 1033
325 Ga0207705_10461168 3300025909 Bacteria 986
326 Ga0207695_10075868 3300025913 Bacteria 3419
327 Ga0207662_10266190 3300025918 Bacteria 1130
328 Ga0207657_10006863 3300025919 Bacteria 11745
329 Ga0207657_10009429 3300025919 Bacteria 9811
330 Ga0207657_10012931 3300025919 Bacteria 8207
331 Ga0207657_10024630 3300025919 Bacteria 5567
332 Ga0207657_10068378 3300025919 Bacteria 3017
333 Ga0207657_10147318 3300025919 Bacteria 1919
334 Ga0207657_10294529 3300025919 Bacteria 1286
335 Ga0207657_10740669 3300025919 Bacteria 762
336 Ga0207649_10018220 3300025920 Bacteria 3989
337 Ga0207649_10021113 3300025920 Bacteria 3743
338 Ga0207649_10464688 3300025920 Bacteria 957
339 Ga0207681_10082561 3300025923 Bacteria 2272
340 Ga0207681_10203999 3300025923 Bacteria 1520
341 Ga0207681_10411476 3300025923 Bacteria 1094
342 Ga0207681_10460618 3300025923 Bacteria 1036
343 Ga0207694_10081944 3300025924 Bacteria 2535
344 Ga0207694_10259553 3300025924 Bacteria 1423
345 Ga0207694_11775857 3300025924 Bacteria 518
346 Ga0207650_10004449 3300025925 Bacteria 9574
347 Ga0207650_10060875 3300025925 Bacteria 2818
348 Ga0207650_10069798 3300025925 Bacteria 2640
349 Ga0207650_10325477 3300025925 Bacteria 1260
350 Ga0207650_10402751 3300025925 Bacteria 1133
351 Ga0207650_10678004 3300025925 Unclassified 870
352 Ga0207659_10051929 3300025926 Bacteria 2918
353 Ga0207659_10057134 3300025926 Bacteria 2797
354 Ga0207659_10149827 3300025926 Bacteria 1821
355 Ga0207659_10604597 3300025926 Unclassified 935
356 Ga0207659_10686665 3300025926 Bacteria 876
357 Ga0207659_11265849 3300025926 Unclassified 634
358 Ga0207687_10272163 3300025927 Bacteria 1354
359 Ga0207687_10408780 3300025927 Bacteria 1118
360 Ga0207644_10005983 3300025931 Bacteria 7929
361 Ga0207644_10027046 3300025931 Bacteria 3960
362 Ga0207644_10114207 3300025931 Bacteria 2046
363 Ga0207644_10273961 3300025931 Unclassified 1353
364 Ga0207644_10972331 3300025931 Bacteria 712
365 Ga0207690_10001086 3300025932 Bacteria 17355
366 Ga0207690_10044871 3300025932 Bacteria 2916
367 Ga0207690_10142989 3300025932 Bacteria 1765
368 Ga0207690_10171607 3300025932 Bacteria 1625
369 Ga0207690_10187255 3300025932 Bacteria 1563
370 Ga0207690_10248768 3300025932 Bacteria 1372
371 Ga0207690_10377404 3300025932 Bacteria 1126
372 Ga0207690_10666279 3300025932 Bacteria 854
373 Ga0207690_11445260 3300025932 Bacteria 575
374 Ga0207706_10002229 3300025933 Bacteria 18927
375 Ga0207706_10004181 3300025933 Bacteria 13592
376 Ga0207706_10018434 3300025933 Bacteria 6281
377 Ga0207706_10022102 3300025933 Bacteria 5709
378 Ga0207706_10035753 3300025933 Bacteria 4414
379 Ga0207706_10074976 3300025933 Bacteria 2975
380 Ga0207706_10082570 3300025933 Bacteria 2824
381 Ga0207706_10247336 3300025933 Bacteria 1558
382 Ga0207706_10401304 3300025933 Bacteria 1189
383 Ga0207686_10116479 3300025934 Bacteria 1811
384 Ga0207709_10346020 3300025935 Bacteria 1121
385 Ga0207670_10330206 3300025936 Bacteria 1202
386 Ga0207669_10056692 3300025937 Bacteria 2381
387 Ga0207669_10195422 3300025937 Bacteria 1463
388 Ga0207704_10007364 3300025938 Bacteria 5193
389 Ga0207704_10082086 3300025938 Bacteria 2087
390 Ga0207704_10192108 3300025938 Bacteria 1486
391 Ga0207691_10002062 3300025940 Bacteria 19627
392 Ga0207691_10017400 3300025940 Bacteria 6818
393 Ga0207691_10044981 3300025940 Bacteria 4061
394 Ga0207691_10055740 3300025940 Bacteria 3602
395 Ga0207691_10606179 3300025940 Bacteria 927
396 Ga0207711_10012933 3300025941 Bacteria 6932
397 Ga0207711_10028294 3300025941 Bacteria 4715
398 Ga0207711_10073273 3300025941 Plasmid 2976
399 Ga0207711_10165192 3300025941 Bacteria 2006
400 Ga0207711_12137204 3300025941 Unclassified 502
401 Ga0207689_10075384 3300025942 Bacteria 2773
402 Ga0207689_10112523 3300025942 Bacteria 2238
403 Ga0207689_10178442 3300025942 Bacteria 1752
404 Ga0207661_10509803 3300025944 Bacteria 1099
405 Ga0207661_11326418 3300025944 Unclassified 661
406 Ga0207679_10011221 3300025945 Bacteria 5791
407 Ga0207679_10034300 3300025945 Bacteria 3579
408 Ga0207679_10218042 3300025945 Bacteria 1604
409 Ga0207679_10367130 3300025945 Bacteria 1259
410 Ga0207679_10448167 3300025945 Unclassified 1144
411 Ga0207679_10554235 3300025945 Bacteria 1032
412 Ga0207679_10669653 3300025945 Bacteria 940
413 Ga0207679_10748405 3300025945 Bacteria 889
414 Ga0207679_10768163 3300025945 Bacteria 877
415 Ga0207667_10005688 3300025949 Bacteria 15201
416 Ga0207667_10327447 3300025949 Bacteria 1564
417 Ga0207667_10852569 3300025949 Bacteria 905
418 Ga0207651_10006178 3300025960 Bacteria 6234
419 Ga0207651_10014585 3300025960 Bacteria 4543
420 Ga0207651_10962148 3300025960 Bacteria 762
421 Ga0207651_11643427 3300025960 Bacteria 579
422 Ga0207712_10002657 3300025961 Bacteria 11439
423 Ga0207668_10232777 3300025972 Bacteria 1486
424 Ga0207668_12026147 3300025972 Bacteria 518
425 Ga0207640_10060677 3300025981 Bacteria 2501
426 Ga0207640_10092496 3300025981 Bacteria 2098
427 Ga0207640_10443363 3300025981 Bacteria 1068
428 Ga0207640_11226766 3300025981 Bacteria 668
429 Ga0207640_11239365 3300025981 Bacteria 664
430 Ga0207658_10039749 3300025986 Bacteria 3395
431 Ga0207658_10060336 3300025986 Bacteria 2829
432 Ga0207658_11233954 3300025986 Unclassified 684
433 Ga0207677_10011157 3300026023 Bacteria 5110
434 Ga0207677_10045280 3300026023 Bacteria 2937
435 Ga0207677_10048569 3300026023 Bacteria 2858
436 Ga0207677_10396092 3300026023 Bacteria 1170
437 Ga0207703_10058480 3300026035 Bacteria 3147
438 Ga0207703_11622070 3300026035 Bacteria 622
439 Ga0207703_11723898 3300026035 Unclassified 602
440 Ga0207639_10170791 3300026041 Bacteria 1841
441 Ga0207639_10250503 3300026041 Bacteria 1544
442 Ga0207639_10328413 3300026041 Bacteria 1360
443 Ga0207639_10633319 3300026041 Bacteria 988
444 Ga0207678_10017428 3300026067 Bacteria 6309
445 Ga0207678_10028154 3300026067 Bacteria 4907
446 Ga0207678_10052545 3300026067 Bacteria 3515
447 Ga0207678_10097158 3300026067 Bacteria 2517
448 Ga0207678_10606578 3300026067 Bacteria 960
449 Ga0207678_10969618 3300026067 Bacteria 752
450 Ga0207678_11459377 3300026067 Unclassified 604
451 Ga0207702_10407794 3300026078 Bacteria 1312
452 Ga0207702_11335109 3300026078 Bacteria 711
453 Ga0207702_12072863 3300026078 Unclassified 559
454 Ga0207641_10038621 3300026088 Bacteria 3991
455 Ga0207641_10067570 3300026088 Bacteria 3062
456 Ga0207641_10294207 3300026088 Bacteria 1531
457 Ga0207641_10572599 3300026088 Bacteria 1103
458 Ga0207648_10020293 3300026089 Bacteria 5987
459 Ga0207648_10166333 3300026089 Bacteria 1949
460 Ga0207648_10319103 3300026089 Bacteria 1396
461 Ga0207648_10335998 3300026089 Unclassified 1360
462 Ga0207648_10352735 3300026089 Bacteria 1326
463 Ga0207676_10003805 3300026095 Bacteria 10670
464 Ga0207676_10064890 3300026095 Bacteria 2905
465 Ga0207676_10500127 3300026095 Bacteria 1154
466 Ga0207676_10608363 3300026095 Bacteria 1050
467 Ga0207676_10942482 3300026095 Unclassified 848
468 Ga0207676_11079547 3300026095 Bacteria 793
469 Ga0207674_10095784 3300026116 Unclassified 2954
470 Ga0207674_10635544 3300026116 Bacteria 1031
471 Ga0207674_11471274 3300026116 Unclassified 650
472 Ga0207675_100039877 3300026118 Bacteria 4382
473 Ga0207675_100208544 3300026118 Bacteria 1879
474 Ga0207683_10005966 3300026121 Bacteria 10436
475 Ga0207683_10020961 3300026121 Bacteria 5594
476 Ga0207683_10086003 3300026121 Bacteria 2795
477 Ga0207683_10343411 3300026121 Bacteria 1369
478 Ga0207698_10099431 3300026142 Bacteria 2406
479 Ga0207698_10149730 3300026142 Bacteria 2023
480 Ga0207698_10169869 3300026142 Bacteria 1919
481 Ga0207698_10238251 3300026142 Bacteria 1656
482 Ga0207698_10312883 3300026142 Bacteria 1467
483 Ga0207698_10351310 3300026142 Bacteria 1393
484 Ga0207698_10425847 3300026142 Bacteria 1275
485 Ga0207698_10618502 3300026142 Bacteria 1070
486 Ga0209995_1035264 3300027471 Bacteria 841
487 Ga0209974_10001060 3300027876 Bacteria 9750
488 Ga0268266_10677981 3300028379 Bacteria 993
489 Ga0268265_12367888 3300028380 Unclassified 537
490 Ga0268264_10006774 3300028381 Bacteria 9623
491 Ga0268264_10024872 3300028381 Bacteria 4893
492 Ga0268264_10432682 3300028381 Bacteria 1271
493 Ga0268264_10479824 3300028381 Bacteria 1209
494 Ga0268264_10931606 3300028381 Bacteria 873
495 Ga0307408_100010660 3300031548 Bacteria 6062
496 Ga0307408_100012996 3300031548 Bacteria 5520
497 Ga0307408_100111127 3300031548 Bacteria 2105
498 Ga0307408_101170809 3300031548 Bacteria 716
499 Ga0307405_10003505 3300031731 Bacteria 7223
500 Ga0307405_10036280 3300031731 Bacteria 2952
501 Ga0307413_10003909 3300031824 Bacteria 6376
502 Ga0307413_10073668 3300031824 Bacteria 2159
503 Ga0307410_10027841 3300031852 Bacteria 3576
504 Ga0307410_10046836 3300031852 Bacteria 2886
505 Ga0307410_10318208 3300031852 Bacteria 1233
506 Ga0307410_10580645 3300031852 Bacteria 932
507 Ga0307410_10833065 3300031852 Bacteria 786
508 Ga0307410_12133469 3300031852 Bacteria 501
509 Ga0307406_10037367 3300031901 Bacteria 2998
510 Ga0307406_10671648 3300031901 Bacteria 862
511 Ga0307407_10026142 3300031903 Bacteria 3087
512 Ga0307407_10030445 3300031903 Bacteria 2911
513 Ga0307407_10230174 3300031903 Bacteria 1258
514 Ga0307407_10361585 3300031903 Bacteria 1031
515 Ga0307412_10046940 3300031911 Bacteria 2833
516 Ga0307409_100002640 3300031995 Bacteria 9434
517 Ga0307409_100057832 3300031995 Bacteria 3007
518 Ga0307409_101395956 3300031995 Bacteria 727
519 Ga0307409_102083614 3300031995 Bacteria 597
520 Ga0307416_100021053 3300032002 Bacteria 4671
521 Ga0307416_100896721 3300032002 Bacteria 986
522 Ga0307416_101257771 3300032002 Bacteria 846
523 Ga0307416_101605826 3300032002 Bacteria 755
524 Ga0307414_10003427 3300032004 Bacteria 8464
525 Ga0307414_10117150 3300032004 Bacteria 2040
526 Ga0307414_10294780 3300032004 Bacteria 1369
527 Ga0307414_10671033 3300032004 Bacteria 936
528 Ga0307414_11287786 3300032004 Bacteria 678
529 Ga0307411_10002240 3300032005 Bacteria 8441
530 Ga0307411_10055966 3300032005 Bacteria 2597
531 Ga0307411_10485178 3300032005 Bacteria 1041
532 Ga0307411_11241354 3300032005 Bacteria 677
533 Ga0307415_100874111 3300032126 Unclassified 826
534 Ga0307415_101055388 3300032126 Bacteria 758
535 Ga0373952_0039760 3300035092 Bacteria 1082
536 Ga0373942_0058236 3300035207 Bacteria 1101
537 Ga0373961_0180480 3300035241 Bacteria 735
538 Ga0395899_0007351 3300037312 Bacteria 8518
539 Ga0395899_0018628 3300037312 Bacteria 5275
540 Ga0395899_0058865 3300037312 Bacteria 2833
541 Ga0395899_0103711 3300037312 Bacteria 2051
542 Ga0395899_0130768 3300037312 Bacteria 1792
543 Ga0395899_0168079 3300037312 Bacteria 1546
544 Ga0395899_0419713 3300037312 Unclassified 882
545 Ga0395899_0498307 3300037312 Bacteria 790
546 Ga0395899_0610990 3300037312 Bacteria 693
547 Ga0395900_0020975 3300037418 Bacteria 6677
548 Ga0395900_0021802 3300037418 Bacteria 6549
549 Ga0395900_0105544 3300037418 Bacteria 2894
550 Ga0395900_0123371 3300037418 Bacteria 2657
551 Ga0395900_0223744 3300037418 Bacteria 1895
552 Ga0395900_0289246 3300037418 Bacteria 1628
553 Ga0395900_0295660 3300037418 Bacteria 1607
554 Ga0395900_0375155 3300037418 Bacteria 1391
555 Ga0395900_1031851 3300037418 Bacteria 741
556 Ga0395900_1829517 3300037418 Bacteria 518
557 Ga0395898_0019110 3300037466 Bacteria 6975
558 Ga0395898_0115946 3300037466 Bacteria 2566
559 Ga0395898_0497674 3300037466 Bacteria 1159
560 Ga0395898_0518563 3300037466 Bacteria 1133
561 Ga0395898_0559885 3300037466 Bacteria 1085
562 Ga0395898_1193171 3300037466 Bacteria 692
563 Ga0395898_1462462 3300037466 Bacteria 610
564 Ga0395905_0001939 3300037471 Bacteria 23712
565 Ga0395905_0016080 3300037471 Bacteria 7112
566 Ga0395905_0017903 3300037471 Bacteria 6731
567 Ga0395905_0119314 3300037471 Bacteria 2479
568 Ga0395905_0207939 3300037471 Bacteria 1834
569 Ga0395905_0268024 3300037471 Bacteria 1593
570 Ga0395905_0289243 3300037471 Bacteria 1525
571 Ga0395905_0559919 3300037471 Bacteria 1044
572 Ga0395905_0590429 3300037471 Bacteria 1012
573 Ga0395905_0696009 3300037471 Bacteria 918
574 Ga0395905_1027844 3300037471 Bacteria 727
575 Ga0395901_0012531 3300038443 Bacteria 8603
576 Ga0395901_0075293 3300038443 Bacteria 3521
577 Ga0395901_0207769 3300038443 Bacteria 2050
578 Ga0395901_0274891 3300038443 Bacteria 1751
579 Ga0395901_0301537 3300038443 Bacteria 1661
580 Ga0395901_0414870 3300038443 Bacteria 1381
581 Ga0395901_0419595 3300038443 Bacteria 1372
582 Ga0395901_0533170 3300038443 Unclassified 1191
583 Ga0395901_1326408 3300038443 Bacteria 680
584 Ga0395901_1494685 3300038443 Bacteria 631
585 Ga0395901_2135754 3300038443 Bacteria 505
586 Ga0436365_1623269 3300039437 Bacteria 2080
587 Ga0436363_0462432 3300039450 Bacteria 2853
588 Ga0439448_0011852 3300042005 Bacteria 2600
589 Ga0439448_0130156 3300042005 Unclassified 867
590 Ga0439432_102503 3300042006 Bacteria 855
591 Ga0439455_0073507 3300042012 Bacteria 921
592 Ga0450910_105767 3300042147 Bacteria 508
593 Ga0439458_0009882 3300042157 Bacteria 2124
594 Ga0466966_0125930 3300044684 Bacteria 1571
595 Ga0466963_0038085 3300044694 Bacteria 3144
596 Ga0466963_0113484 3300044694 Bacteria 1861
597 Ga0466964_0036678 3300044706 Bacteria 1967
598 Ga0466957_0033756 3300044842 Bacteria 3070
599 Ga0466957_0517462 3300044842 Bacteria 829
600 Ga0466958_0362351 3300045836 Bacteria 934
601 Ga0466967_0017463 3300045976 Bacteria 5698
602 Ga0466967_0270150 3300045976 Bacteria 1629
603 Ga0495663_0299472 3300046525 Bacteria 579
604 Ga0495668_0220114 3300046616 Bacteria 1039
605 Ga0495669_0004179 3300046684 Bacteria 5939
606 Ga0495669_0018537 3300046684 Bacteria 2993
607 Ga0495669_0138991 3300046684 Bacteria 1146
608 Ga0495677_0117707 3300047445 Bacteria 1012
609 Ga0495685_107679 3300047447 Bacteria 918
610 Ga0495685_107821 3300047447 Bacteria 918
611 Ga0496100_0059686 3300048903 Bacteria 2507
612 Ga0496100_0085527 3300048903 Bacteria 2140
613 Ga0496100_0550204 3300048903 Bacteria 893
614 Ga0496101_0003562 3300048904 Bacteria 9716
615 Ga0496101_0100431 3300048904 Bacteria 2165
616 Ga0496101_0424252 3300048904 Unclassified 1048
617 Ga0496102_0347235 3300048905 Bacteria 1397
618 Ga0496104_0282781 3300048907 Bacteria 1572
619 Ga0496105_0543041 3300048908 Unclassified 908
620 Ga0496106_0022172 3300048909 Bacteria 4716
621 Ga0496107_0017575 3300048910 Bacteria 5030
622 Ga0496107_0610142 3300048910 Unclassified 806
623 Ga0496107_0724327 3300048910 Bacteria 731
624 Ga0496108_0043483 3300048911 Bacteria 3752
625 Ga0496108_0071248 3300048911 Bacteria 2932
626 Ga0496109_0015529 3300048912 Bacteria 6638
627 Ga0496109_0561099 3300048912 Unclassified 1077
628 Ga0496109_0671430 3300048912 Bacteria 973
629 Ga0496109_0953108 3300048912 Bacteria 796
630 Ga0496110_0029445 3300048913 Bacteria 4725
631 Ga0496110_0163075 3300048913 Bacteria 2021
632 Ga0496110_0394658 3300048913 Bacteria 1261
633 Ga0496110_1416738 3300048913 Bacteria 604
634 Ga0496111_0018439 3300048914 Bacteria 4836
635 Ga0496112_0019187 3300048915 Bacteria 6448
636 Ga0496112_0264743 3300048915 Bacteria 1668
637 Ga0496112_0284377 3300048915 Bacteria 1600
638 Ga0496112_1370531 3300048915 Bacteria 622
639 Ga0496113_0017133 3300048916 Bacteria 5022
640 Ga0496113_0108365 3300048916 Bacteria 2159
641 Ga0496114_0071047 3300048917 Bacteria 2925
642 Ga0496114_0102279 3300048917 Bacteria 2448
643 Ga0496115_0427179 3300048918 Unclassified 1073
644 Ga0501298_144791 3300049521 Bacteria 577
645 Ga0501068_0799210 3300049584 Bacteria 619
646 Ga0501070_0084790 3300049586 Bacteria 2623
647 Ga0501073_0348334 3300049589 Bacteria 1023
648 Ga0501074_0183515 3300049590 Bacteria 1492
649 Ga0501206_015328 3300049653 Bacteria 1060
650 Ga0501209_068083 3300049656 Bacteria 1008
651 Ga0501224_004660 3300049664 Bacteria 1951
652 Ga0501235_062349 3300049669 Bacteria 874
653 Ga0501236_054053 3300049670 Unclassified 697
654 Ga0501249_037134 3300049679 Bacteria 1099
655 Ga0501225_0060725 3300049705 Bacteria 1063
656 Ga0501080_0749935 3300049742 Bacteria 859
657 Ga0501080_0838014 3300049742 Bacteria 805
658 Ga0501262_014956 3300049759 Bacteria 1015
659 Ga0501263_011926 3300049760 Bacteria 1084
660 Ga0501268_034865 3300049765 Bacteria 926
661 Ga0501273_011007 3300049770 Bacteria 1120
662 Ga0530510_0390775 3300061734 Unclassified 1048
663 Ga0466963_0050889
664 JGI24741J21665_1043976
665 JGI24739J22299_10079994
666 JGI24737J22298_10055793
667 JGI24737J22298_10058896
668 JGI24737J22298_10068407
669 JGI24743J22301_10086298
670 JGI24735J21928_10103614
671 JGI24745J21846_1007959
672 JGI24748J21848_1054345
673 JGI24738J21930_10042067
674 Ga0065712_10387002
675 Ga0065712_10392532
676 Ga0065712_10671758
677 Ga0065715_10241140
678 Ga0065715_10400873
679 Ga0070658_10009163
680 Ga0070658_10023704
681 Ga0070658_10468539
682 Ga0070658_10679526
683 Ga0070658_11129073
684 Ga0070658_11164278
685 Ga0070676_10127255
686 Ga0070676_10358227
687 Ga0070676_10501774
688 Ga0070676_11221310
689 Ga0070676_11261608
690 Ga0070683_100315947
691 Ga0070683_100342100
692 Ga0070683_101553023
693 Ga0070690_100014038
694 Ga0070670_100043484
695 Ga0070670_100158702
696 Ga0070670_100886115
697 Ga0070670_100943140
698 Ga0070677_10002056
699 Ga0068869_100048712
700 Ga0068869_100060679
701 Ga0070666_10127825
702 Ga0070666_11515494
703 Ga0070682_100395735
704 Ga0070682_100416743
705 Ga0068868_100052653
706 Ga0068868_100089457
707 Ga0068868_100197744
708 Ga0068868_100520257
709 Ga0070660_100002916
710 Ga0070660_100017493
711 Ga0070660_100106658
712 Ga0070660_100150706
713 Ga0070660_100334053
714 Ga0070660_100545607
715 Ga0070660_100597082
716 Ga0070660_100682729
717 Ga0070689_100639866
718 Ga0070689_100939482
719 Ga0070689_101682805
720 Ga0070687_100201490
721 Ga0070661_100021154
722 Ga0070661_100093619
723 Ga0070661_100108287
724 Ga0070692_10003963
725 Ga0070692_11160465
726 Ga0070668_100203343
727 Ga0070668_102068667
728 Ga0070669_100329757
729 Ga0070669_100582179
730 Ga0070669_100826050
731 Ga0070669_101774942
732 Ga0070675_100014605
733 Ga0070675_100048163
734 Ga0070675_100072952
735 Ga0070675_100188403
736 Ga0070675_100427407
737 Ga0070675_100429992
738 Ga0070671_100168223
739 Ga0070671_100204586
740 Ga0070671_100466503
741 Ga0070671_100756838
742 Ga0070671_100861551
743 Ga0070671_101904743
744 Ga0070674_100218341
745 Ga0070674_100828249
746 Ga0070673_100002933
747 Ga0070673_100020139
748 Ga0070673_100073609
749 Ga0070673_100437340
750 Ga0070673_100472652
751 Ga0070673_100581336
752 Ga0070659_100001498
753 Ga0070659_100019042
754 Ga0070659_100043016
755 Ga0070659_100046754
756 Ga0070659_100093000
757 Ga0070659_100232210
758 Ga0070659_100321447
759 Ga0070659_100417855
760 Ga0070659_101180176
761 Ga0070667_100019378
762 Ga0070667_101882398
763 Ga0070701_10758070
764 Ga0070694_100005190
765 Ga0070663_100013864
766 Ga0070663_100061153
767 Ga0070663_100297138
768 Ga0070663_100400029
769 Ga0070663_100606131
770 Ga0070663_100767432
771 Ga0070678_100014694
772 Ga0070678_100146588
773 Ga0070678_100158573
774 Ga0070678_100299764
775 Ga0070662_100007584
776 Ga0070662_100036370
777 Ga0070662_100062642
778 Ga0070662_100099868
779 Ga0070662_100239935
780 Ga0070662_100355105
781 Ga0070662_100495577
782 Ga0070681_10646138
783 Ga0068867_100012857
784 Ga0068867_100050584
785 Ga0068867_100113370
786 Ga0068867_100306036
787 Ga0068867_100477374
788 Ga0068867_102137844
789 Ga0068867_102250552
790 Ga0070679_100337349
791 Ga0070684_100009573
792 Ga0070684_101539782
793 Ga0068853_100126824
794 Ga0068853_100258700
795 Ga0068853_100419687
796 Ga0068853_101008436
797 Ga0070672_100003314
798 Ga0070672_100010561
799 Ga0070672_100044808
800 Ga0070672_100198269
801 Ga0070672_100678957
802 Ga0070672_101591096
803 Ga0070686_100026056
804 Ga0070693_100072667
805 Ga0070693_100537645
806 Ga0070665_100214728
807 Ga0070665_101706745
808 Ga0070704_100368836
809 Ga0070704_100887396
810 Ga0068855_100015361
811 Ga0070664_100017369
812 Ga0070664_100030332
813 Ga0070664_100052344
814 Ga0070664_100128864
815 Ga0070664_100287435
816 Ga0070664_100332594
817 Ga0070664_100369937
818 Ga0070664_100491010
819 Ga0070664_100660678
820 Ga0068857_100229820
821 Ga0068857_100239712
822 Ga0068857_100324033
823 Ga0068857_100634563
824 Ga0068854_100013859
825 Ga0068854_100070671
826 Ga0068854_100270277
827 Ga0068854_100353988
828 Ga0068856_100092163
829 Ga0068856_100248803
830 Ga0068856_102376447
831 Ga0070702_101116033
832 Ga0068852_100190221
833 Ga0068852_100258336
834 Ga0068852_100260957
835 Ga0068852_100353012
836 Ga0068852_100574521
837 Ga0068852_100734233
838 Ga0068859_100042537
839 Ga0068859_100066011
840 Ga0068859_100108081
841 Ga0068859_100527285
842 Ga0068859_101581906
843 Ga0068864_100021994
844 Ga0068864_100710070
845 Ga0068864_100762110
846 Ga0068864_101299173
847 Ga0068866_10106785
848 Ga0068861_100039024
849 Ga0068861_100421962
850 Ga0068861_100873382
851 Ga0068851_10051936
852 Ga0068851_10170739
853 Ga0068851_10188648
854 Ga0068870_10558323
855 Ga0068870_10565487
856 Ga0068870_10669771
857 Ga0068870_10930649
858 Ga0068863_100029478
859 Ga0068863_100035238
860 Ga0068863_100069207
861 Ga0068863_100987212
862 Ga0068863_101967217
863 Ga0068858_100002681
864 Ga0068858_100003085
865 Ga0068858_100124532
866 Ga0068858_101066798
867 Ga0068858_102000559
868 Ga0068860_100020669
869 Ga0068860_100192192
870 Ga0068860_100199921
871 Ga0068860_100315833
872 Ga0068860_100980061
873 Ga0068862_100123481
874 Ga0068862_100383981
875 Ga0081540_1310992
876 Ga0097621_100018075
877 Ga0097621_100022688
878 Ga0097621_101335584
879 Ga0068871_100006672
880 Ga0068871_100020489
881 Ga0068865_100177086
882 Ga0068865_100319544
883 Ga0097620_100042536
884 Ga0097620_100066009
885 Ga0097620_100108076
886 Ga0097620_100527246
887 Ga0097620_101581817
888 Ga0075435_101228635
889 Ga0105240_10092288
890 Ga0105240_10099051
891 Ga0105245_10088781
892 Ga0105245_10215052
893 Ga0105245_11531982
894 Ga0105247_10635256
895 Ga0105243_10032446
896 Ga0105243_10087596
897 Ga0105242_10035055
898 Ga0105242_10488859
899 Ga0105248_10092890
900 Ga0105248_10242948
901 Ga0105248_10785751
902 Ga0105248_12246542
903 Ga0105237_10292425
904 Ga0105237_10302014
905 Ga0105238_10312167
906 Ga0105238_10443107
907 Ga0105249_10003824
908 Ga0105249_10046926
909 Ga0105239_10059064
910 Ga0105239_10400269
911 Ga0105246_10092360
912 Ga0105246_10111833
913 Ga0105246_10238029
914 Ga0157324_1053570
915 Ga0157373_10072454
916 Ga0157373_10431712
917 Ga0157373_10479078
918 Ga0157371_10021916
919 Ga0157371_10054189
920 Ga0157371_10450339
921 Ga0157371_10534352
922 Ga0157371_11116356
923 Ga0157371_11242129
924 Ga0157370_10173096
925 Ga0157369_10032296
926 Ga0157374_10002117
927 Ga0157374_10864067
928 Ga0157374_11059263
929 Ga0157378_10029798
930 Ga0157378_10329552
931 Ga0157378_12104726
932 Ga0157378_12228453
933 Ga0163162_10048011
934 Ga0163162_10196687
935 Ga0163162_10244378
936 Ga0163162_11116655
937 Ga0157372_10201368
938 Ga0157372_10844395
939 Ga0157372_11050239
940 Ga0157375_10002436
941 Ga0157375_10132398
942 Ga0157375_10632028
943 Ga0163163_10030946
944 Ga0163163_10077220
945 Ga0163163_10617577
946 Ga0157380_10361982
947 Ga0157380_11479581
948 Ga0182008_10489633
949 Ga0157377_10126762
950 Ga0157377_10780132
951 Ga0157379_10172270
952 Ga0157379_10198591
953 Ga0157376_10074650
954 Ga0163161_10532649
955 Ga0213876_10010995
956 Ga0207697_10015712
957 Ga0207656_10142766
958 Ga0207656_10186177
959 Ga0207656_10656502
960 Ga0207656_10669191
961 Ga0207682_10001680
962 Ga0207642_10024259
963 Ga0207642_10032357
964 Ga0207642_10958961
965 Ga0207688_10031465
966 Ga0207688_10365045
967 Ga0207688_10387086
968 Ga0207688_10609673
969 Ga0207688_10915032
970 Ga0207680_10009732
971 Ga0207680_10034145
972 Ga0207680_10332210
973 Ga0207680_11151749
974 Ga0207647_10005416
975 Ga0207647_10253440
976 Ga0207647_10258765
977 Ga0207645_10036740
978 Ga0207645_10060995
979 Ga0207645_10318194
980 Ga0207643_10022032
981 Ga0207643_10716016
982 Ga0207705_10010637
983 Ga0207705_10025886
984 Ga0207705_10082766
985 Ga0207705_10133578
986 Ga0207705_10422114
987 Ga0207705_10461168
988 Ga0207695_10075868
989 Ga0207662_10266190
990 Ga0207657_10006863
991 Ga0207657_10009429
992 Ga0207657_10012931
993 Ga0207657_10024630
994 Ga0207657_10068378
995 Ga0207657_10147318
996 Ga0207657_10294529
997 Ga0207657_10740669
998 Ga0207649_10018220
999 Ga0207649_10021113
1000 Ga0207649_10464688
1001 Ga0207681_10082561
1002 Ga0207681_10203999
1003 Ga0207681_10411476
1004 Ga0207681_10460618
1005 Ga0207694_10081944
1006 Ga0207694_10259553
1007 Ga0207694_11775857
1008 Ga0207650_10004449
1009 Ga0207650_10060875
1010 Ga0207650_10069798
1011 Ga0207650_10325477
1012 Ga0207650_10402751
1013 Ga0207650_10678004
1014 Ga0207659_10051929
1015 Ga0207659_10057134
1016 Ga0207659_10149827
1017 Ga0207659_10604597
1018 Ga0207659_10686665
1019 Ga0207659_11265849
1020 Ga0207687_10272163
1021 Ga0207687_10408780
1022 Ga0207644_10005983
1023 Ga0207644_10027046
1024 Ga0207644_10114207
1025 Ga0207644_10273961
1026 Ga0207644_10972331
1027 Ga0207690_10001086
1028 Ga0207690_10044871
1029 Ga0207690_10142989
1030 Ga0207690_10171607
1031 Ga0207690_10187255
1032 Ga0207690_10248768
1033 Ga0207690_10377404
1034 Ga0207690_10666279
1035 Ga0207690_11445260
1036 Ga0207706_10002229
1037 Ga0207706_10004181
1038 Ga0207706_10018434
1039 Ga0207706_10022102
1040 Ga0207706_10035753
1041 Ga0207706_10074976
1042 Ga0207706_10082570
1043 Ga0207706_10247336
1044 Ga0207706_10401304
1045 Ga0207686_10116479
1046 Ga0207709_10346020
1047 Ga0207670_10330206
1048 Ga0207669_10056692
1049 Ga0207669_10195422
1050 Ga0207704_10007364
1051 Ga0207704_10082086
1052 Ga0207704_10192108
1053 Ga0207691_10002062
1054 Ga0207691_10017400
1055 Ga0207691_10044981
1056 Ga0207691_10055740
1057 Ga0207691_10606179
1058 Ga0207711_10012933
1059 Ga0207711_10028294
1060 Ga0207711_10073273
1061 Ga0207711_10165192
1062 Ga0207711_12137204
1063 Ga0207689_10075384
1064 Ga0207689_10112523
1065 Ga0207689_10178442
1066 Ga0207661_10509803
1067 Ga0207661_11326418
1068 Ga0207679_10011221
1069 Ga0207679_10034300
1070 Ga0207679_10218042
1071 Ga0207679_10367130
1072 Ga0207679_10448167
1073 Ga0207679_10554235
1074 Ga0207679_10669653
1075 Ga0207679_10748405
1076 Ga0207679_10768163
1077 Ga0207667_10005688
1078 Ga0207667_10327447
1079 Ga0207667_10852569
1080 Ga0207651_10006178
1081 Ga0207651_10014585
1082 Ga0207651_10962148
1083 Ga0207651_11643427
1084 Ga0207712_10002657
1085 Ga0207668_10232777
1086 Ga0207668_12026147
1087 Ga0207640_10060677
1088 Ga0207640_10092496
1089 Ga0207640_10443363
1090 Ga0207640_11226766
1091 Ga0207640_11239365
1092 Ga0207658_10039749
1093 Ga0207658_10060336
1094 Ga0207658_11233954
1095 Ga0207677_10011157
1096 Ga0207677_10045280
1097 Ga0207677_10048569
1098 Ga0207677_10396092
1099 Ga0207703_10058480
1100 Ga0207703_11622070
1101 Ga0207703_11723898
1102 Ga0207639_10170791
1103 Ga0207639_10250503
1104 Ga0207639_10328413
1105 Ga0207639_10633319
1106 Ga0207678_10017428
1107 Ga0207678_10028154
1108 Ga0207678_10052545
1109 Ga0207678_10097158
1110 Ga0207678_10606578
1111 Ga0207678_10969618
1112 Ga0207678_11459377
1113 Ga0207702_10407794
1114 Ga0207702_11335109
1115 Ga0207702_12072863
1116 Ga0207641_10038621
1117 Ga0207641_10067570
1118 Ga0207641_10294207
1119 Ga0207641_10572599
1120 Ga0207648_10020293
1121 Ga0207648_10166333
1122 Ga0207648_10319103
1123 Ga0207648_10335998
1124 Ga0207648_10352735
1125 Ga0207676_10003805
1126 Ga0207676_10064890
1127 Ga0207676_10500127
1128 Ga0207676_10608363
1129 Ga0207676_10942482
1130 Ga0207676_11079547
1131 Ga0207674_10095784
1132 Ga0207674_10635544
1133 Ga0207674_11471274
1134 Ga0207675_100039877
1135 Ga0207675_100208544
1136 Ga0207683_10005966
1137 Ga0207683_10020961
1138 Ga0207683_10086003
1139 Ga0207683_10343411
1140 Ga0207698_10099431
1141 Ga0207698_10149730
1142 Ga0207698_10169869
1143 Ga0207698_10238251
1144 Ga0207698_10312883
1145 Ga0207698_10351310
1146 Ga0207698_10425847
1147 Ga0207698_10618502
1148 Ga0209995_1035264
1149 Ga0209974_10001060
1150 Ga0268266_10677981
1151 Ga0268265_12367888
1152 Ga0268264_10006774
1153 Ga0268264_10024872
1154 Ga0268264_10432682
1155 Ga0268264_10479824
1156 Ga0268264_10931606
1157 Ga0307408_100010660
1158 Ga0307408_100012996
1159 Ga0307408_100111127
1160 Ga0307408_101170809
1161 Ga0307405_10003505
1162 Ga0307405_10036280
1163 Ga0307413_10003909
1164 Ga0307413_10073668
1165 Ga0307410_10027841
1166 Ga0307410_10046836
1167 Ga0307410_10318208
1168 Ga0307410_10580645
1169 Ga0307410_10833065
1170 Ga0307410_12133469
1171 Ga0307406_10037367
1172 Ga0307406_10671648
1173 Ga0307407_10026142
1174 Ga0307407_10030445
1175 Ga0307407_10230174
1176 Ga0307407_10361585
1177 Ga0307412_10046940
1178 Ga0307409_100002640
1179 Ga0307409_100057832
1180 Ga0307409_101395956
1181 Ga0307409_102083614
1182 Ga0307416_100021053
1183 Ga0307416_100896721
1184 Ga0307416_101257771
1185 Ga0307416_101605826
1186 Ga0307414_10003427
1187 Ga0307414_10117150
1188 Ga0307414_10294780
1189 Ga0307414_10671033
1190 Ga0307414_11287786
1191 Ga0307411_10002240
1192 Ga0307411_10055966
1193 Ga0307411_10485178
1194 Ga0307411_11241354
1195 Ga0307415_100874111
1196 Ga0307415_101055388
1197 Ga0373952_0039760
1198 Ga0373942_0058236
1199 Ga0373961_0180480
1200 Ga0395899_0007351
1201 Ga0395899_0018628
1202 Ga0395899_0058865
1203 Ga0395899_0103711
1204 Ga0395899_0130768
1205 Ga0395899_0168079
1206 Ga0395899_0419713
1207 Ga0395899_0498307
1208 Ga0395899_0610990
1209 Ga0395900_0020975
1210 Ga0395900_0021802
1211 Ga0395900_0105544
1212 Ga0395900_0123371
1213 Ga0395900_0223744
1214 Ga0395900_0289246
1215 Ga0395900_0295660
1216 Ga0395900_0375155
1217 Ga0395900_1031851
1218 Ga0395900_1829517
1219 Ga0395898_0019110
1220 Ga0395898_0115946
1221 Ga0395898_0497674
1222 Ga0395898_0518563
1223 Ga0395898_0559885
1224 Ga0395898_1193171
1225 Ga0395898_1462462
1226 Ga0395905_0001939
1227 Ga0395905_0016080
1228 Ga0395905_0017903
1229 Ga0395905_0119314
1230 Ga0395905_0207939
1231 Ga0395905_0268024
1232 Ga0395905_0289243
1233 Ga0395905_0559919
1234 Ga0395905_0590429
1235 Ga0395905_0696009
1236 Ga0395905_1027844
1237 Ga0395901_0012531
1238 Ga0395901_0075293
1239 Ga0395901_0207769
1240 Ga0395901_0274891
1241 Ga0395901_0301537
1242 Ga0395901_0414870
1243 Ga0395901_0419595
1244 Ga0395901_0533170
1245 Ga0395901_1326408
1246 Ga0395901_1494685
1247 Ga0395901_2135754
1248 Ga0436365_1623269
1249 Ga0436363_0462432
1250 Ga0439448_0011852
1251 Ga0439448_0130156
1252 Ga0439432_102503
1253 Ga0439455_0073507
1254 Ga0450910_105767
1255 Ga0439458_0009882
1256 Ga0466966_0125930
1257 Ga0466963_0038085
1258 Ga0466963_0113484
1259 Ga0466964_0036678
1260 Ga0466957_0033756
1261 Ga0466957_0517462
1262 Ga0466958_0362351
1263 Ga0466967_0017463
1264 Ga0466967_0270150
1265 Ga0495663_0299472
1266 Ga0495668_0220114
1267 Ga0495669_0004179
1268 Ga0495669_0018537
1269 Ga0495669_0138991
1270 Ga0495677_0117707
1271 Ga0495685_107679
1272 Ga0495685_107821
1273 Ga0496100_0059686
1274 Ga0496100_0085527
1275 Ga0496100_0550204
1276 Ga0496101_0003562
1277 Ga0496101_0100431
1278 Ga0496101_0424252
1279 Ga0496102_0347235
1280 Ga0496104_0282781
1281 Ga0496105_0543041
1282 Ga0496106_0022172
1283 Ga0496107_0017575
1284 Ga0496107_0610142
1285 Ga0496107_0724327
1286 Ga0496108_0043483
1287 Ga0496108_0071248
1288 Ga0496109_0015529
1289 Ga0496109_0561099
1290 Ga0496109_0671430
1291 Ga0496109_0953108
1292 Ga0496110_0029445
1293 Ga0496110_0163075
1294 Ga0496110_0394658
1295 Ga0496110_1416738
1296 Ga0496111_0018439
1297 Ga0496112_0019187
1298 Ga0496112_0264743
1299 Ga0496112_0284377
1300 Ga0496112_1370531
1301 Ga0496113_0017133
1302 Ga0496113_0108365
1303 Ga0496114_0071047
1304 Ga0496114_0102279
1305 Ga0496115_0427179
1306 Ga0501298_144791
1307 Ga0501068_0799210
1308 Ga0501070_0084790
1309 Ga0501073_0348334
1310 Ga0501074_0183515
1311 Ga0501206_015328
1312 Ga0501209_068083
1313 Ga0501224_004660
1314 Ga0501235_062349
1315 Ga0501236_054053
1316 Ga0501249_037134
1317 Ga0501225_0060725
1318 Ga0501080_0749935
1319 Ga0501080_0838014
1320 Ga0501262_014956
1321 Ga0501263_011926
1322 Ga0501268_034865
1323 Ga0501273_011007
1324 Ga0530510_0390775

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uid-assembly1.cif.gz_A crystal structure of protein ms6760 from mycobacterium smegmatis 0.8244 41 67
8ecp-assembly1.cif.gz_B r16a pa0709 with bme modifications 0.8123 1 72
2jdj-assembly1.cif.gz_A crystal structure of hapk from hahella chejuensis 0.8008 1 68
2pgc-assembly1.cif.gz_C crystal structure of a a marine metagenome protein (jcvi_pep_1096685590403) from uncultured marine organism at 2.53 a resolution 0.7986 2 63
3mcs-assembly1.cif.gz_A crystal structure of putative monooxygenase (fn1347) from fusobacterium nucleatum subsp. nucleatum atcc 25586 at 2.55 a resolution 0.7872 2 72
ID Description Score Start End Superfamily
af_C6KTA2_1_145_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8487 2 72 3.30.70.100
3mcsA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8017 2 72 3.30.70.100
af_Q7KUM9_71_169_3.30.1140.40 Alpha Beta;2-Layer Sandwich;Ribosomal protein S3 C-terminal domain;Tctex-1 0.7852 38 56 3.30.1140.40
1xbwA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7779 2 72 3.30.70.100
2fb0A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.757 2 72 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7W9T3H9-F1-model_v4 DNA primase 0.9747 1 57
AF-A0A4Q5ZJH6-F1-model_v4 deleted 0.9701 1 70
AF-A0A534N9Z6-F1-model_v4 ABM domain-containing protein 0.9656 3 69
AF-A0A5E5U5J9-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9655 1 58 GO:0004497
AF-A0A1G8E9R0-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9649 1 63

Map