F473329

General Info

Members Datasets Scaffolds Average Seq Length
660 276 1321 144

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10376695|Ga0105248_103766952
Length 154
Sequence MSERREVHMAETRSQSFENHGQYRPEYHIVVFFILLANFLWAGYQLFQGLTGGAVVAFLMSVALIVMFFSVRVQILTVQDRVIRLEMRQRFRSVLAADLANRASSLPLRQIIALRFASDEELPSLVSEVVSGQVTAPKEIKQKVRDWQADHLRA

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
185 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
188 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
189 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
190 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
193 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
207 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
225 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
226 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
227 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
232 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
242 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
243 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
263 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
275 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.12
Nodule 0
Rhizoplane 3.18
Rhizosphere 94.24
Stem 0
Stem Tuber 0
Unclassified 22.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10376695 3300009177 Bacteria 1598
2 rootH1_10076471 3300003316 Bacteria 7886
3 rootH1_10076471 3300003323 Bacteria 4360
4 Ga0065704_10109235 3300005289 Bacteria 2008
5 Ga0065712_10791296 3300005290 Unclassified 515
6 Ga0065715_10266221 3300005293 Bacteria 1121
7 Ga0065715_10382998 3300005293 Bacteria 905
8 Ga0065715_10513686 3300005293 Bacteria 769
9 Ga0065715_10622608 3300005293 Bacteria 694
10 Ga0070658_10948661 3300005327 Bacteria 748
11 Ga0070676_10264070 3300005328 Bacteria 1154
12 Ga0070676_10449532 3300005328 Bacteria 906
13 Ga0070683_100316938 3300005329 Bacteria 1484
14 Ga0070690_100314059 3300005330 Bacteria 1127
15 Ga0070690_100382182 3300005330 Bacteria 1030
16 Ga0070690_100643807 3300005330 Bacteria 809
17 Ga0070670_100009375 3300005331 Bacteria 8356
18 Ga0070670_100014551 3300005331 Bacteria 6755
19 Ga0070670_100047394 3300005331 Bacteria 3698
20 Ga0070670_100163400 3300005331 Bacteria 1930
21 Ga0070670_100467902 3300005331 Bacteria 1118
22 Ga0070670_100531684 3300005331 Bacteria 1048
23 Ga0070670_100562322 3300005331 Bacteria 1018
24 Ga0070677_10066906 3300005333 Bacteria 1499
25 Ga0070677_10088607 3300005333 Bacteria 1341
26 Ga0068869_100054687 3300005334 Bacteria 2907
27 Ga0068869_100077034 3300005334 Bacteria 2480
28 Ga0068869_100574364 3300005334 Bacteria 950
29 Ga0068869_100884767 3300005334 Bacteria 772
30 Ga0070666_10315140 3300005335 Bacteria 1115
31 Ga0070666_10408260 3300005335 Unclassified 977
32 Ga0070666_10581630 3300005335 Bacteria 816
33 Ga0070680_100100391 3300005336 Bacteria 2402
34 Ga0070680_100192659 3300005336 Bacteria 1718
35 Ga0070680_100887199 3300005336 Bacteria 769
36 Ga0068868_100014509 3300005338 Bacteria 5808
37 Ga0068868_100219258 3300005338 Bacteria 1592
38 Ga0068868_100231602 3300005338 Bacteria 1550
39 Ga0068868_100431206 3300005338 Bacteria 1143
40 Ga0068868_101621920 3300005338 Unclassified 608
41 Ga0070689_100003333 3300005340 Bacteria 10671
42 Ga0070689_100562615 3300005340 Bacteria 984
43 Ga0070689_100594899 3300005340 Bacteria 958
44 Ga0070689_100600633 3300005340 Unclassified 953
45 Ga0070691_10025029 3300005341 Bacteria 2778
46 Ga0070691_10189877 3300005341 Unclassified 1074
47 Ga0070691_10541967 3300005341 Bacteria 679
48 Ga0070687_100034188 3300005343 Bacteria 2515
49 Ga0070661_100204768 3300005344 Bacteria 1509
50 Ga0070692_10053084 3300005345 Unclassified 2113
51 Ga0070668_100006903 3300005347 Bacteria 8416
52 Ga0070668_100115454 3300005347 Bacteria 2140
53 Ga0070668_100862997 3300005347 Bacteria 807
54 Ga0070669_100005999 3300005353 Bacteria 8764
55 Ga0070669_100009468 3300005353 Bacteria 6938
56 Ga0070669_100085548 3300005353 Bacteria 2354
57 Ga0070669_100346644 3300005353 Bacteria 1205
58 Ga0070675_100004565 3300005354 Bacteria 10568
59 Ga0070675_100186100 3300005354 Unclassified 1797
60 Ga0070675_100197198 3300005354 Bacteria 1746
61 Ga0070675_100444907 3300005354 Bacteria 1161
62 Ga0070671_100063375 3300005355 Bacteria 3078
63 Ga0070671_100124237 3300005355 Bacteria 2172
64 Ga0070671_100303478 3300005355 Bacteria 1360
65 Ga0070671_100326498 3300005355 Bacteria 1308
66 Ga0070671_100731449 3300005355 Bacteria 859
67 Ga0070674_100079871 3300005356 Bacteria 2334
68 Ga0070674_100624990 3300005356 Bacteria 913
69 Ga0070674_100782503 3300005356 Bacteria 822
70 Ga0070673_100027570 3300005364 Bacteria 4212
71 Ga0070673_100052628 3300005364 Bacteria 3195
72 Ga0070673_100102851 3300005364 Bacteria 2356
73 Ga0070673_100632236 3300005364 Bacteria 978
74 Ga0070673_100863396 3300005364 Archaea 838
75 Ga0070673_101049826 3300005364 Bacteria 760
76 Ga0070688_100036177 3300005365 Unclassified 3002
77 Ga0070688_100331297 3300005365 Unclassified 1109
78 Ga0070688_101605933 3300005365 Bacteria 531
79 Ga0070659_100765813 3300005366 Unclassified 838
80 Ga0070667_100014018 3300005367 Bacteria 6626
81 Ga0070667_100059796 3300005367 Bacteria 3224
82 Ga0070667_100924853 3300005367 Bacteria 812
83 Ga0070667_100954696 3300005367 Unclassified 799
84 Ga0070667_101036043 3300005367 Unclassified 766
85 Ga0070709_10020457 3300005434 Bacteria 3839
86 Ga0070709_10138767 3300005434 Bacteria 1668
87 Ga0070713_100028665 3300005436 Bacteria 4398
88 Ga0070701_10002357 3300005438 Bacteria 7254
89 Ga0070701_10158003 3300005438 Unclassified 1311
90 Ga0070701_10290527 3300005438 Unclassified 1001
91 Ga0070701_10514434 3300005438 Unclassified 779
92 Ga0070711_101069735 3300005439 Archaea 694
93 Ga0070705_100000037 3300005440 Bacteria 66783
94 Ga0070705_101339951 3300005440 Bacteria 595
95 Ga0070700_100051603 3300005441 Bacteria 2561
96 Ga0070700_100069990 3300005441 Bacteria 2236
97 Ga0070700_100245856 3300005441 Bacteria 1281
98 Ga0070700_100570034 3300005441 Bacteria 882
99 Ga0070700_101129841 3300005441 Unclassified 651
100 Ga0070694_100005480 3300005444 Bacteria 7688
101 Ga0070694_100135736 3300005444 Bacteria 1783
102 Ga0070694_100150397 3300005444 Bacteria 1700
103 Ga0070694_100228084 3300005444 Bacteria 1400
104 Ga0070694_100376059 3300005444 Unclassified 1107
105 Ga0070694_100462243 3300005444 Bacteria 1004
106 Ga0070694_100532433 3300005444 Unclassified 939
107 Ga0070694_100602804 3300005444 Bacteria 885
108 Ga0070708_100042068 3300005445 Bacteria 4008
109 Ga0070708_101149493 3300005445 Unclassified 727
110 Ga0070663_100889066 3300005455 Bacteria 769
111 Ga0070678_100028655 3300005456 Bacteria 3801
112 Ga0070678_100090163 3300005456 Bacteria 2349
113 Ga0070678_101864115 3300005456 Unclassified 567
114 Ga0070662_100041354 3300005457 Bacteria 3288
115 Ga0070662_100206567 3300005457 Bacteria 1561
116 Ga0070662_100623348 3300005457 Bacteria 908
117 Ga0070681_10027374 3300005458 Bacteria 5732
118 Ga0068867_100000265 3300005459 Bacteria 34503
119 Ga0068867_100130170 3300005459 Bacteria 1954
120 Ga0070685_10249553 3300005466 Bacteria 1175
121 Ga0070685_10844433 3300005466 Bacteria 678
122 Ga0070685_11048592 3300005466 Bacteria 614
123 Ga0070706_100003738 3300005467 Bacteria 14874
124 Ga0070706_100269592 3300005467 Bacteria 1589
125 Ga0070706_100605121 3300005467 Bacteria 1018
126 Ga0070707_100001201 3300005468 Bacteria 25483
127 Ga0070707_100688457 3300005468 Bacteria 985
128 Ga0070707_101029950 3300005468 Unclassified 789
129 Ga0070707_101263492 3300005468 Bacteria 705
130 Ga0070698_100020353 3300005471 Bacteria 6954
131 Ga0070698_100718544 3300005471 Bacteria 942
132 Ga0070699_100181207 3300005518 Bacteria 1869
133 Ga0070699_100437039 3300005518 Bacteria 1186
134 Ga0070699_102041868 3300005518 Bacteria 524
135 Ga0070679_100020171 3300005530 Bacteria 6496
136 Ga0070679_101653619 3300005530 Unclassified 588
137 Ga0070684_100055686 3300005535 Bacteria 3449
138 Ga0070684_101600719 3300005535 Unclassified 614
139 Ga0070697_100025013 3300005536 Bacteria 4758
140 Ga0070697_100035381 3300005536 Unclassified 4028
141 Ga0070697_100233130 3300005536 Unclassified 1570
142 Ga0070697_100491683 3300005536 Unclassified 1072
143 Ga0068853_100475661 3300005539 Bacteria 1177
144 Ga0070672_100056393 3300005543 Bacteria 3081
145 Ga0070672_100078985 3300005543 Bacteria 2633
146 Ga0070672_100098450 3300005543 Unclassified 2369
147 Ga0070672_100118866 3300005543 Bacteria 2161
148 Ga0070672_100156607 3300005543 Unclassified 1887
149 Ga0070672_100277346 3300005543 Bacteria 1416
150 Ga0070686_100798685 3300005544 Unclassified 760
151 Ga0070695_100001493 3300005545 Bacteria 12980
152 Ga0070695_100142118 3300005545 Unclassified 1666
153 Ga0070695_100186564 3300005545 Bacteria 1473
154 Ga0070695_100957812 3300005545 Unclassified 694
155 Ga0070695_101592368 3300005545 Bacteria 545
156 Ga0070696_100000139 3300005546 Bacteria 39687
157 Ga0070693_100719677 3300005547 Bacteria 733
158 Ga0070665_100002281 3300005548 Bacteria 21328
159 Ga0070665_100157101 3300005548 Bacteria 2276
160 Ga0070665_101790414 3300005548 Unclassified 621
161 Ga0070704_100058662 3300005549 Unclassified 2742
162 Ga0070704_100236602 3300005549 Bacteria 1493
163 Ga0070704_100725711 3300005549 Bacteria 883
164 Ga0070704_101252564 3300005549 Bacteria 678
165 Ga0068855_101144913 3300005563 Bacteria 811
166 Ga0070664_100011848 3300005564 Bacteria 7076
167 Ga0070664_100338092 3300005564 Bacteria 1367
168 Ga0070664_100898856 3300005564 Bacteria 830
169 Ga0068857_100030919 3300005577 Bacteria 4731
170 Ga0068857_100442222 3300005577 Unclassified 1215
171 Ga0068854_100048700 3300005578 Bacteria 3024
172 Ga0070702_100001352 3300005615 Bacteria 9992
173 Ga0070702_100014861 3300005615 Bacteria 3961
174 Ga0070702_100080529 3300005615 Bacteria 1949
175 Ga0068852_100212705 3300005616 Bacteria 1835
176 Ga0068852_100395631 3300005616 Unclassified 1358
177 Ga0068852_100626788 3300005616 Bacteria 1081
178 Ga0068852_100752774 3300005616 Bacteria 986
179 Ga0068859_100008136 3300005617 Bacteria 10632
180 Ga0068859_100061047 3300005617 Bacteria 3799
181 Ga0068859_100139918 3300005617 Bacteria 2494
182 Ga0068859_100149513 3300005617 Bacteria 2411
183 Ga0068859_100266103 3300005617 Bacteria 1806
184 Ga0068859_100282822 3300005617 Unclassified 1751
185 Ga0068859_100586155 3300005617 Bacteria 1208
186 Ga0068859_100853168 3300005617 Bacteria 997
187 Ga0068859_101110656 3300005617 Unclassified 870
188 Ga0068859_101203199 3300005617 Archaea 834
189 Ga0068864_100024466 3300005618 Bacteria 5081
190 Ga0068864_100139734 3300005618 Bacteria 2184
191 Ga0068864_100220586 3300005618 Bacteria 1749
192 Ga0068864_100224395 3300005618 Bacteria 1735
193 Ga0068864_100411615 3300005618 Unclassified 1287
194 Ga0068866_10014712 3300005718 Bacteria 3461
195 Ga0068866_10816868 3300005718 Archaea 649
196 Ga0068861_100003999 3300005719 Bacteria 9872
197 Ga0068861_100575608 3300005719 Bacteria 1030
198 Ga0068861_100595739 3300005719 Unclassified 1014
199 Ga0068851_10073785 3300005834 Bacteria 1770
200 Ga0068851_10632961 3300005834 Bacteria 653
201 Ga0068870_10002276 3300005840 Bacteria 7974
202 Ga0068870_10021401 3300005840 Bacteria 3163
203 Ga0068870_10116139 3300005840 Bacteria 1535
204 Ga0068863_100008012 3300005841 Bacteria 10322
205 Ga0068863_100065528 3300005841 Bacteria 3437
206 Ga0068863_100137664 3300005841 Bacteria 2333
207 Ga0068863_100330393 3300005841 Bacteria 1482
208 Ga0068863_100378544 3300005841 Bacteria 1382
209 Ga0068863_101073862 3300005841 Unclassified 809
210 Ga0068858_100017955 3300005842 Bacteria 6624
211 Ga0068858_100044696 3300005842 Bacteria 4105
212 Ga0068858_100109092 3300005842 Bacteria 2584
213 Ga0068858_100562876 3300005842 Bacteria 1104
214 Ga0068860_100027062 3300005843 Bacteria 5525
215 Ga0068860_100156293 3300005843 Bacteria 2198
216 Ga0068860_100177629 3300005843 Bacteria 2058
217 Ga0068860_100582643 3300005843 Bacteria 1123
218 Ga0068860_102144439 3300005843 Unclassified 580
219 Ga0068862_100047227 3300005844 Bacteria 3674
220 Ga0068862_100279952 3300005844 Unclassified 1528
221 Ga0068862_100368737 3300005844 Bacteria 1336
222 Ga0068862_101915203 3300005844 Bacteria 603
223 Ga0081455_10049151 3300005937 Bacteria 3638
224 Ga0081455_11025349 3300005937 Unclassified 510
225 Ga0075365_10579676 3300006038 Bacteria 793
226 Ga0075368_10136287 3300006042 Bacteria 1022
227 Ga0075363_100460400 3300006048 Bacteria 752
228 Ga0075364_10021461 3300006051 Bacteria 4070
229 Ga0075432_10236886 3300006058 Unclassified 736
230 Ga0070715_10865485 3300006163 Unclassified 554
231 Ga0070716_100143342 3300006173 Unclassified 1527
232 Ga0075367_10049319 3300006178 Bacteria 2481
233 Ga0075369_10210019 3300006186 Bacteria 900
234 Ga0097621_100064160 3300006237 Bacteria 3020
235 Ga0097621_100148642 3300006237 Bacteria 2008
236 Ga0097621_100208888 3300006237 Bacteria 1698
237 Ga0097621_101183110 3300006237 Archaea 720
238 Ga0075370_10305278 3300006353 Bacteria 947
239 Ga0068871_100436581 3300006358 Bacteria 1171
240 Ga0068871_100455679 3300006358 Bacteria 1147
241 Ga0068871_100559085 3300006358 Unclassified 1037
242 Ga0068871_100562861 3300006358 Unclassified 1033
243 Ga0068871_100831364 3300006358 Unclassified 853
244 Ga0075428_100015340 3300006844 Bacteria 8497
245 Ga0075428_101279264 3300006844 Unclassified 772
246 Ga0075433_10010141 3300006852 Bacteria 7553
247 Ga0075433_10072163 3300006852 Bacteria 3035
248 Ga0075433_10137458 3300006852 Unclassified 2172
249 Ga0075433_10562128 3300006852 Bacteria 1002
250 Ga0075434_100010589 3300006871 Bacteria 8653
251 Ga0075434_100116584 3300006871 Bacteria 2684
252 Ga0075434_100120821 3300006871 Bacteria 2635
253 Ga0075434_100209203 3300006871 Unclassified 1971
254 Ga0075434_100876875 3300006871 Unclassified 912
255 Ga0075429_100096236 3300006880 Bacteria 2582
256 Ga0068865_100129755 3300006881 Bacteria 1887
257 Ga0068865_100273617 3300006881 Bacteria 1342
258 Ga0068865_100529034 3300006881 Bacteria 987
259 Ga0075436_100092788 3300006914 Bacteria 2099
260 Ga0075436_101343189 3300006914 Unclassified 541
261 Ga0097620_100008136 3300006931 Bacteria 10632
262 Ga0097620_100061048 3300006931 Bacteria 3799
263 Ga0097620_100139921 3300006931 Bacteria 2494
264 Ga0097620_100149501 3300006931 Bacteria 2411
265 Ga0097620_100266113 3300006931 Bacteria 1806
266 Ga0097620_100282827 3300006931 Unclassified 1751
267 Ga0097620_100586157 3300006931 Bacteria 1208
268 Ga0097620_100853201 3300006931 Bacteria 997
269 Ga0097620_101055297 3300006931 Unclassified 893
270 Ga0097620_101110545 3300006931 Unclassified 870
271 Ga0097620_101203189 3300006931 Archaea 834
272 Ga0075435_100003148 3300007076 Bacteria 11155
273 Ga0075435_100246914 3300007076 Unclassified 1519
274 Ga0099795_10212859 3300007788 Unclassified 820
275 Ga0099795_10266669 3300007788 Unclassified 743
276 Ga0105240_10039765 3300009093 Bacteria 6020
277 Ga0105240_10886558 3300009093 Bacteria 961
278 Ga0111539_10038271 3300009094 Bacteria 5786
279 Ga0111539_10076896 3300009094 Bacteria 3930
280 Ga0111539_10098220 3300009094 Bacteria 3440
281 Ga0111539_10290994 3300009094 Bacteria 1901
282 Ga0111539_10795095 3300009094 Bacteria 1101
283 Ga0111539_11292240 3300009094 Bacteria 847
284 Ga0105245_10021070 3300009098 Bacteria 5718
285 Ga0105245_10087577 3300009098 Bacteria 2858
286 Ga0105245_10105160 3300009098 Bacteria 2618
287 Ga0105247_10011072 3300009101 Bacteria 5443
288 Ga0114129_10152136 3300009147 Unclassified 3166
289 Ga0114129_10560789 3300009147 Bacteria 1484
290 Ga0114129_11499005 3300009147 Unclassified 829
291 Ga0114129_11670967 3300009147 Unclassified 778
292 Ga0114129_12337654 3300009147 Unclassified 641
293 Ga0105243_10392677 3300009148 Unclassified 1286
294 Ga0105243_10480418 3300009148 Bacteria 1172
295 Ga0105243_11808069 3300009148 Archaea 642
296 Ga0105241_10443791 3300009174 Bacteria 1147
297 Ga0105241_11351626 3300009174 Bacteria 680
298 Ga0105242_10040109 3300009176 Bacteria 3772
299 Ga0105242_10081955 3300009176 Bacteria 2699
300 Ga0105242_10873901 3300009176 Bacteria 897
301 Ga0105248_10012713 3300009177 Bacteria 9288
302 Ga0105248_10016697 3300009177 Bacteria 8081
303 Ga0105248_10147607 3300009177 Unclassified 2654
304 Ga0105248_10343732 3300009177 Archaea 1680
305 Ga0105248_10749130 3300009177 Bacteria 1102
306 Ga0105248_12788511 3300009177 Unclassified 557
307 Ga0105238_10630599 3300009551 Bacteria 1081
308 Ga0105238_11405115 3300009551 Bacteria 725
309 Ga0105249_10000182 3300009553 Bacteria 73467
310 Ga0105249_10013317 3300009553 Bacteria 7262
311 Ga0105249_11282879 3300009553 Bacteria 804
312 Ga0099796_10567216 3300010159 Bacteria 511
313 Ga0105239_12204528 3300010375 Bacteria 641
314 Ga0105246_10133502 3300011119 Bacteria 1857
315 Ga0105246_10140078 3300011119 Bacteria 1818
316 Ga0105246_10154402 3300011119 Bacteria 1742
317 Ga0105246_10528273 3300011119 Bacteria 1007
318 Ga0157369_10073719 3300013105 Bacteria 3662
319 Ga0157374_10005772 3300013296 Bacteria 10447
320 Ga0157374_10524731 3300013296 Unclassified 1190
321 Ga0157374_11114785 3300013296 Bacteria 810
322 Ga0157378_10481020 3300013297 Unclassified 1237
323 Ga0157378_10578753 3300013297 Unclassified 1132
324 Ga0157378_10940107 3300013297 Bacteria 897
325 Ga0157378_11714476 3300013297 Unclassified 675
326 Ga0157378_12152645 3300013297 Unclassified 609
327 Ga0163162_10091980 3300013306 Bacteria 3116
328 Ga0163162_10300998 3300013306 Bacteria 1736
329 Ga0163162_10358670 3300013306 Unclassified 1591
330 Ga0157375_10236291 3300013308 Bacteria 1987
331 Ga0157375_10655377 3300013308 Unclassified 1206
332 Ga0157375_11624837 3300013308 Bacteria 764
333 Ga0157375_11708351 3300013308 Bacteria 745
334 Ga0157375_12154389 3300013308 Bacteria 664
335 Ga0163163_10008708 3300014325 Bacteria 9025
336 Ga0163163_10226472 3300014325 Bacteria 1919
337 Ga0163163_10519543 3300014325 Bacteria 1253
338 Ga0163163_11144980 3300014325 Unclassified 841
339 Ga0163163_11410326 3300014325 Bacteria 758
340 Ga0163163_12373316 3300014325 Bacteria 589
341 Ga0157380_10237373 3300014326 Bacteria 1641
342 Ga0157380_10296274 3300014326 Bacteria 1488
343 Ga0157380_10410777 3300014326 Bacteria 1287
344 Ga0157380_10816630 3300014326 Bacteria 951
345 Ga0157377_10260035 3300014745 Bacteria 1129
346 Ga0157377_10789689 3300014745 Bacteria 699
347 Ga0157379_10040715 3300014968 Bacteria 4148
348 Ga0157379_10041656 3300014968 Bacteria 4099
349 Ga0157379_10071635 3300014968 Bacteria 3100
350 Ga0157379_11753238 3300014968 Bacteria 609
351 Ga0157376_10018282 3300014969 Bacteria 5369
352 Ga0157376_10028229 3300014969 Bacteria 4458
353 Ga0157376_10036669 3300014969 Bacteria 3974
354 Ga0157376_10093640 3300014969 Bacteria 2609
355 Ga0157376_10172439 3300014969 Unclassified 1971
356 Ga0157376_10433947 3300014969 Bacteria 1277
357 Ga0207666_1009081 3300025271 Bacteria 1338
358 Ga0207697_10030192 3300025315 Bacteria 2218
359 Ga0207656_10054451 3300025321 Bacteria 1739
360 Ga0207653_10054460 3300025885 Bacteria 1338
361 Ga0207682_10073963 3300025893 Bacteria 1448
362 Ga0207642_10039001 3300025899 Bacteria 2060
363 Ga0207710_10013426 3300025900 Bacteria 3446
364 Ga0207688_10377824 3300025901 Bacteria 876
365 Ga0207680_10051906 3300025903 Bacteria 2454
366 Ga0207680_10156834 3300025903 Bacteria 1523
367 Ga0207647_10388961 3300025904 Bacteria 787
368 Ga0207647_10434019 3300025904 Unclassified 737
369 Ga0207685_10466500 3300025905 Unclassified 659
370 Ga0207699_10044655 3300025906 Unclassified 2581
371 Ga0207645_10086341 3300025907 Bacteria 2016
372 Ga0207645_10404308 3300025907 Bacteria 919
373 Ga0207643_10005644 3300025908 Bacteria 6690
374 Ga0207643_10027486 3300025908 Unclassified 3154
375 Ga0207643_10199487 3300025908 Bacteria 1218
376 Ga0207684_10100443 3300025910 Bacteria 2472
377 Ga0207654_10333357 3300025911 Bacteria 1040
378 Ga0207654_10541324 3300025911 Bacteria 826
379 Ga0207707_10002331 3300025912 Bacteria 17099
380 Ga0207695_10098513 3300025913 Bacteria 2922
381 Ga0207660_10078893 3300025917 Bacteria 2414
382 Ga0207660_10129911 3300025917 Bacteria 1916
383 Ga0207662_10006037 3300025918 Bacteria 6511
384 Ga0207662_10131960 3300025918 Bacteria 1576
385 Ga0207662_10784737 3300025918 Bacteria 671
386 Ga0207649_10229968 3300025920 Bacteria 1325
387 Ga0207649_10677644 3300025920 Bacteria 798
388 Ga0207652_10177492 3300025921 Unclassified 1913
389 Ga0207646_10000005 3300025922 Bacteria 523896
390 Ga0207646_10213937 3300025922 Bacteria 1741
391 Ga0207646_10649260 3300025922 Bacteria 945
392 Ga0207681_10002833 3300025923 Bacteria 10975
393 Ga0207681_10181784 3300025923 Bacteria 1602
394 Ga0207681_10414341 3300025923 Bacteria 1090
395 Ga0207694_11136540 3300025924 Bacteria 661
396 Ga0207650_10037170 3300025925 Bacteria 3547
397 Ga0207650_10071265 3300025925 Bacteria 2614
398 Ga0207650_10116418 3300025925 Bacteria 2075
399 Ga0207650_10392811 3300025925 Bacteria 1147
400 Ga0207650_10476642 3300025925 Bacteria 1041
401 Ga0207659_10004564 3300025926 Bacteria 8374
402 Ga0207659_10009311 3300025926 Bacteria 6132
403 Ga0207659_10075213 3300025926 Bacteria 2477
404 Ga0207659_10140147 3300025926 Bacteria 1876
405 Ga0207659_10211235 3300025926 Unclassified 1555
406 Ga0207659_10214879 3300025926 Bacteria 1543
407 Ga0207687_10028425 3300025927 Bacteria 3756
408 Ga0207687_10431668 3300025927 Unclassified 1089
409 Ga0207644_10044383 3300025931 Bacteria 3158
410 Ga0207644_10147934 3300025931 Bacteria 1815
411 Ga0207644_10774055 3300025931 Bacteria 802
412 Ga0207644_10911801 3300025931 Unclassified 737
413 Ga0207706_10080619 3300025933 Unclassified 2862
414 Ga0207706_10670085 3300025933 Bacteria 888
415 Ga0207686_10065762 3300025934 Bacteria 2313
416 Ga0207686_10515169 3300025934 Unclassified 930
417 Ga0207686_10605263 3300025934 Bacteria 863
418 Ga0207709_10077526 3300025935 Bacteria 2131
419 Ga0207709_10279372 3300025935 Unclassified 1233
420 Ga0207670_10005144 3300025936 Bacteria 7149
421 Ga0207670_10043284 3300025936 Bacteria 2972
422 Ga0207670_10684135 3300025936 Unclassified 848
423 Ga0207669_10108544 3300025937 Bacteria 1854
424 Ga0207669_10126398 3300025937 Bacteria 1747
425 Ga0207669_10559842 3300025937 Unclassified 924
426 Ga0207669_11042614 3300025937 Unclassified 689
427 Ga0207665_10052202 3300025939 Unclassified 2754
428 Ga0207691_10063783 3300025940 Bacteria 3340
429 Ga0207691_10090278 3300025940 Unclassified 2747
430 Ga0207691_10146651 3300025940 Bacteria 2077
431 Ga0207691_10227586 3300025940 Unclassified 1615
432 Ga0207691_10785184 3300025940 Bacteria 801
433 Ga0207691_11251229 3300025940 Bacteria 614
434 Ga0207711_10016981 3300025941 Bacteria 6045
435 Ga0207711_10019080 3300025941 Bacteria 5705
436 Ga0207711_10697282 3300025941 Bacteria 947
437 Ga0207711_11684745 3300025941 Unclassified 577
438 Ga0207689_10029115 3300025942 Bacteria 4615
439 Ga0207689_10089714 3300025942 Bacteria 2525
440 Ga0207689_10256063 3300025942 Bacteria 1448
441 Ga0207689_11368388 3300025942 Bacteria 594
442 Ga0207661_10227638 3300025944 Bacteria 1650
443 Ga0207679_10136904 3300025945 Bacteria 1973
444 Ga0207679_10927422 3300025945 Bacteria 797
445 Ga0207651_10030586 3300025960 Archaea 3431
446 Ga0207651_10088252 3300025960 Bacteria 2260
447 Ga0207651_10107092 3300025960 Unclassified 2089
448 Ga0207651_10922076 3300025960 Unclassified 778
449 Ga0207651_10931858 3300025960 Bacteria 774
450 Ga0207712_10000063 3300025961 Bacteria 133704
451 Ga0207712_10613650 3300025961 Bacteria 942
452 Ga0207668_10001620 3300025972 Bacteria 13148
453 Ga0207668_10197839 3300025972 Bacteria 1598
454 Ga0207640_10219179 3300025981 Bacteria 1455
455 Ga0207658_10134519 3300025986 Bacteria 1991
456 Ga0207658_10767350 3300025986 Unclassified 874
457 Ga0207677_10018548 3300026023 Bacteria 4178
458 Ga0207677_10215836 3300026023 Bacteria 1535
459 Ga0207677_10263549 3300026023 Bacteria 1406
460 Ga0207677_10360007 3300026023 Bacteria 1222
461 Ga0207703_10004498 3300026035 Bacteria 11442
462 Ga0207703_10023908 3300026035 Bacteria 4805
463 Ga0207703_10134964 3300026035 Bacteria 2135
464 Ga0207703_10170408 3300026035 Bacteria 1914
465 Ga0207703_10688354 3300026035 Bacteria 972
466 Ga0207639_10298134 3300026041 Bacteria 1424
467 Ga0207708_10020209 3300026075 Bacteria 5022
468 Ga0207708_10036795 3300026075 Bacteria 3728
469 Ga0207708_10049016 3300026075 Bacteria 3216
470 Ga0207708_10381391 3300026075 Bacteria 1162
471 Ga0207702_12225006 3300026078 Bacteria 537
472 Ga0207641_10045110 3300026088 Unclassified 3710
473 Ga0207641_10048860 3300026088 Bacteria 3573
474 Ga0207641_10091025 3300026088 Bacteria 2669
475 Ga0207641_10092906 3300026088 Unclassified 2643
476 Ga0207641_10282042 3300026088 Unclassified 1563
477 Ga0207641_11063194 3300026088 Unclassified 807
478 Ga0207641_11763458 3300026088 Bacteria 621
479 Ga0207648_10000844 3300026089 Bacteria 34567
480 Ga0207648_10081967 3300026089 Bacteria 2813
481 Ga0207648_10284180 3300026089 Bacteria 1480
482 Ga0207648_10383397 3300026089 Bacteria 1271
483 Ga0207676_10058395 3300026095 Bacteria 3043
484 Ga0207676_10072530 3300026095 Bacteria 2768
485 Ga0207676_10132112 3300026095 Bacteria 2124
486 Ga0207676_10198270 3300026095 Unclassified 1772
487 Ga0207676_10280606 3300026095 Unclassified 1512
488 Ga0207674_10009268 3300026116 Bacteria 11279
489 Ga0207674_10119086 3300026116 Bacteria 2609
490 Ga0207674_10981151 3300026116 Bacteria 814
491 Ga0207674_11827751 3300026116 Bacteria 574
492 Ga0207675_100001335 3300026118 Bacteria 24751
493 Ga0207675_100113852 3300026118 Bacteria 2554
494 Ga0207675_100218887 3300026118 Bacteria 1834
495 Ga0207675_100861803 3300026118 Unclassified 921
496 Ga0207683_10047044 3300026121 Bacteria 3778
497 Ga0207683_10083670 3300026121 Bacteria 2836
498 Ga0207698_10272137 3300026142 Bacteria 1562
499 Ga0209588_1010128 3300027671 Unclassified 2829
500 Ga0209813_10136239 3300027866 Bacteria 868
501 Ga0207428_10056271 3300027907 Bacteria 3126
502 Ga0207428_10271485 3300027907 Bacteria 1260
503 Ga0207428_11008650 3300027907 Unclassified 585
504 Ga0268266_10009932 3300028379 Bacteria 8358
505 Ga0268266_10261848 3300028379 Bacteria 1603
506 Ga0268266_11289845 3300028379 Unclassified 706
507 Ga0268265_10006637 3300028380 Bacteria 7830
508 Ga0268265_10346621 3300028380 Unclassified 1354
509 Ga0268265_11665896 3300028380 Bacteria 643
510 Ga0268264_10112212 3300028381 Unclassified 2390
511 Ga0268264_10533758 3300028381 Bacteria 1149
512 Ga0268264_10871876 3300028381 Unclassified 902
513 Ga0268264_10912349 3300028381 Bacteria 882
514 Ga0268264_10917398 3300028381 Bacteria 880
515 Ga0265338_10837648 3300028800 Unclassified 629
516 Ga0316181_1222148 3300030744 Bacteria 2209
517 Ga0265760_10025103 3300031090 Bacteria 1739
518 Ga0307414_10266110 3300032004 Unclassified 1433
519 Ga0373949_0056869 3300035090 Bacteria 998
520 Ga0373951_0077844 3300035091 Bacteria 854
521 Ga0373952_0250388 3300035092 Unclassified 536
522 Ga0373932_0035450 3300035112 Bacteria 1411
523 Ga0373936_0229540 3300035113 Unclassified 825
524 Ga0373939_0242188 3300035114 Bacteria 699
525 Ga0373941_0012238 3300035115 Bacteria 2239
526 Ga0373954_0267417 3300035118 Bacteria 842
527 Ga0373954_0284684 3300035118 Unclassified 815
528 Ga0373956_0014364 3300035119 Bacteria 3308
529 Ga0373956_0026411 3300035119 Bacteria 2515
530 Ga0373957_0434288 3300035120 Unclassified 567
531 Ga0373943_0579272 3300035170 Bacteria 660
532 Ga0373955_0069612 3300035172 Unclassified 1964
533 Ga0373955_0099850 3300035172 Bacteria 1664
534 Ga0373955_0870082 3300035172 Unclassified 554
535 Ga0373961_0089640 3300035241 Bacteria 980
536 Ga0373931_0233620 3300035691 Bacteria 1112
537 Ga0373931_0671456 3300035691 Bacteria 682
538 Ga0373935_0068728 3300035692 Unclassified 2280
539 Ga0373935_0217476 3300035692 Bacteria 1326
540 Ga0373935_1449759 3300035692 Unclassified 513
541 Ga0373927_0455479 3300035695 Unclassified 845
542 Ga0373927_0621610 3300035695 Bacteria 714
543 Ga0373933_0108697 3300035724 Bacteria 1728
544 Ga0373937_0119345 3300036401 Bacteria 2457
545 Ga0373937_0172060 3300036401 Bacteria 2032
546 Ga0373925_0133519 3300037068 Bacteria 1937
547 Ga0373925_0458778 3300037068 Bacteria 1044
548 Ga0451807_1483177 3300041486 Bacteria 738
549 Ga0451851_0572458 3300041507 Bacteria 592
550 Ga0451853_3616473 3300041512 Bacteria 1024
551 Ga0439435_0029068 3300042436 Bacteria 1490
552 Ga0451577_0001736 3300042876 Bacteria 28096
553 Ga0451577_0030092 3300042876 Bacteria 4906
554 Ga0451577_0961838 3300042876 Unclassified 768
555 Ga0451577_0992767 3300042876 Unclassified 754
556 Ga0451577_1651333 3300042876 Unclassified 564
557 Ga0453683_0004523 3300044673 Bacteria 9847
558 Ga0453683_0040415 3300044673 Bacteria 2928
559 Ga0453684_0001021 3300044712 Bacteria 89961
560 Ga0453684_0088609 3300044712 Bacteria 3831
561 Ga0453684_0206297 3300044712 Bacteria 2287
562 Ga0453684_1041784 3300044712 Unclassified 868
563 Ga0453684_2278021 3300044712 Unclassified 539
564 Ga0451576_0087303 3300045051 Bacteria 3244
565 Ga0451576_0101461 3300045051 Bacteria 2993
566 Ga0451576_0325012 3300045051 Bacteria 1610
567 Ga0466967_1035044 3300045976 Bacteria 818
568 Ga0495603_0006905 3300046455 Bacteria 6813
569 Ga0495580_0059640 3300046472 Bacteria 2682
570 Ga0495580_0755189 3300046472 Archaea 633
571 Ga0495582_0338614 3300046473 Unclassified 866
572 Ga0495639_0247178 3300046475 Unclassified 881
573 Ga0495662_0043266 3300046476 Bacteria 2174
574 Ga0495594_0023874 3300046499 Unclassified 3280
575 Ga0495607_0473772 3300046501 Unclassified 559
576 Ga0495608_0024536 3300046511 Unclassified 4121
577 Ga0495630_1108629 3300046517 Bacteria 600
578 Ga0495630_1233074 3300046517 Unclassified 565
579 Ga0495663_0097205 3300046525 Bacteria 966
580 Ga0495663_0153885 3300046525 Bacteria 786
581 Ga0495642_0057380 3300046528 Unclassified 1610
582 Ga0495642_0100233 3300046528 Bacteria 1232
583 Ga0495640_0326446 3300046533 Unclassified 950
584 Ga0495621_0212581 3300046539 Bacteria 781
585 Ga0495645_0031447 3300046543 Bacteria 3868
586 Ga0495645_0736936 3300046543 Unclassified 596
587 Ga0495633_0421100 3300046558 Bacteria 604
588 Ga0495667_0605302 3300046559 Bacteria 682
589 Ga0495611_0253885 3300046648 Bacteria 815
590 Ga0495659_0002267 3300046664 Bacteria 6239
591 Ga0495659_0034483 3300046664 Bacteria 1780
592 Ga0495659_0074444 3300046664 Bacteria 1277
593 Ga0495659_0335553 3300046664 Unclassified 644
594 Ga0495588_0005306 3300046674 Bacteria 5730
595 Ga0495657_0053302 3300046675 Unclassified 2707
596 Ga0495599_0259922 3300046678 Bacteria 1055
597 Ga0495647_0002231 3300046681 Bacteria 6070
598 Ga0495658_0103481 3300046683 Unclassified 1703
599 Ga0495658_0319597 3300046683 Bacteria 984
600 Ga0495658_0678133 3300046683 Bacteria 660
601 Ga0495669_0007901 3300046684 Bacteria 4466
602 Ga0495613_0115078 3300046689 Bacteria 1936
603 Ga0495624_0831148 3300046690 Unclassified 545
604 Ga0495670_0044274 3300046691 Bacteria 2222
605 Ga0495600_0132661 3300046809 Bacteria 1619
606 Ga0495636_0043461 3300047318 Unclassified 1869
607 Ga0495636_0057754 3300047318 Bacteria 1635
608 Ga0495674_0858532 3300047319 Bacteria 703
609 Ga0495685_134363 3300047447 Unclassified 808
610 Ga0495684_0009675 3300047471 Bacteria 7433
611 Ga0496100_0253325 3300048903 Bacteria 1303
612 Ga0496102_0624138 3300048905 Bacteria 1001
613 Ga0496104_0179552 3300048907 Bacteria 2027
614 Ga0496104_0276825 3300048907 Bacteria 1591
615 Ga0496104_0636252 3300048907 Unclassified 976
616 Ga0496104_1176686 3300048907 Bacteria 670
617 Ga0496105_1147989 3300048908 Bacteria 574
618 Ga0496106_0395936 3300048909 Bacteria 1110
619 Ga0496106_1079208 3300048909 Unclassified 630
620 Ga0496108_0296490 3300048911 Unclassified 1408
621 Ga0496109_1533391 3300048912 Unclassified 601
622 Ga0496109_1846267 3300048912 Unclassified 537
623 Ga0496110_0657457 3300048913 Bacteria 948
624 Ga0496111_0809733 3300048914 Bacteria 678
625 Ga0496112_0012702 3300048915 Bacteria 7745
626 Ga0496112_1054240 3300048915 Unclassified 732
627 Ga0496112_1242032 3300048915 Bacteria 661
628 Ga0496113_0012726 3300048916 Bacteria 5666
629 Ga0496113_0498141 3300048916 Unclassified 978
630 Ga0496114_0057539 3300048917 Bacteria 3246
631 Ga0501039_1543135 3300049575 Bacteria 510
632 Ga0501072_0303396 3300049588 Archaea 1269
633 Ga0501076_0962294 3300049592 Bacteria 703
634 Ga0501081_1408374 3300049743 Unclassified 529
635 Ga0501241_002671 3300049758 Bacteria 3432
636 nmdc:mga00v17_576177_c1 3300050491 Bacteria 727
637 nmdc:mga06z11_930370_c1 3300050494 Bacteria 530
638 nmdc:mga06z11_97271_c1 3300050494 Bacteria 1609
639 nmdc:mga04h51_132875_c1 3300050495 Bacteria 938
640 nmdc:mga07m45_531293_c1 3300050496 Bacteria 681
641 nmdc:mga05p37_151491_c2 3300050507 Bacteria 1484
642 nmdc:mga05p37_2000542_c1 3300050507 Bacteria 548
643 nmdc:mga05p37_2703_c1 3300050507 Bacteria 20615
644 nmdc:mga08y16_174979_c1 3300050511 Bacteria 2229
645 nmdc:mga08y16_889174_c1 3300050511 Bacteria 878
646 nmdc:mga0n895_1547270_c1 3300050512 Unclassified 629
647 nmdc:mga0n895_1704806_c1 3300050512 Bacteria 593
648 nmdc:mga0n895_20877_c1 3300050512 Bacteria 6118
649 nmdc:mga0n895_625324_c1 3300050512 Bacteria 1077
650 nmdc:mga0rr50_283386_c1 3300050513 Bacteria 1383
651 nmdc:mga0rr50_8733_c1 3300050513 Bacteria 6322
652 nmdc:mga08x19_1094867_c1 3300050514 Unclassified 565
653 nmdc:mga08x19_21010_c1 3300050514 Bacteria 4027
654 nmdc:mga0a205_22081_c1 3300050515 Bacteria 6023
655 nmdc:mga0a205_37742_c1 3300050515 Bacteria 4646
656 nmdc:mga0a205_435073_c1 3300050515 Bacteria 1173
657 nmdc:mga0a205_6451_c1 3300050515 Bacteria 10607
658 nmdc:mga0sz30_432419_c1 3300050516 Bacteria 590
659 Ga0495595_0025258 3300053084 Bacteria 2632
660 Ga0495595_0361961 3300053084 Bacteria 733
661 Ga0495619_0473554 3300053085 Bacteria 862
662 Ga0105248_10376695
663 rootH1_10076471
664 Ga0065704_10109235
665 Ga0065712_10791296
666 Ga0065715_10266221
667 Ga0065715_10382998
668 Ga0065715_10513686
669 Ga0065715_10622608
670 Ga0070658_10948661
671 Ga0070676_10264070
672 Ga0070676_10449532
673 Ga0070683_100316938
674 Ga0070690_100314059
675 Ga0070690_100382182
676 Ga0070690_100643807
677 Ga0070670_100009375
678 Ga0070670_100014551
679 Ga0070670_100047394
680 Ga0070670_100163400
681 Ga0070670_100467902
682 Ga0070670_100531684
683 Ga0070670_100562322
684 Ga0070677_10066906
685 Ga0070677_10088607
686 Ga0068869_100054687
687 Ga0068869_100077034
688 Ga0068869_100574364
689 Ga0068869_100884767
690 Ga0070666_10315140
691 Ga0070666_10408260
692 Ga0070666_10581630
693 Ga0070680_100100391
694 Ga0070680_100192659
695 Ga0070680_100887199
696 Ga0068868_100014509
697 Ga0068868_100219258
698 Ga0068868_100231602
699 Ga0068868_100431206
700 Ga0068868_101621920
701 Ga0070689_100003333
702 Ga0070689_100562615
703 Ga0070689_100594899
704 Ga0070689_100600633
705 Ga0070691_10025029
706 Ga0070691_10189877
707 Ga0070691_10541967
708 Ga0070687_100034188
709 Ga0070661_100204768
710 Ga0070692_10053084
711 Ga0070668_100006903
712 Ga0070668_100115454
713 Ga0070668_100862997
714 Ga0070669_100005999
715 Ga0070669_100009468
716 Ga0070669_100085548
717 Ga0070669_100346644
718 Ga0070675_100004565
719 Ga0070675_100186100
720 Ga0070675_100197198
721 Ga0070675_100444907
722 Ga0070671_100063375
723 Ga0070671_100124237
724 Ga0070671_100303478
725 Ga0070671_100326498
726 Ga0070671_100731449
727 Ga0070674_100079871
728 Ga0070674_100624990
729 Ga0070674_100782503
730 Ga0070673_100027570
731 Ga0070673_100052628
732 Ga0070673_100102851
733 Ga0070673_100632236
734 Ga0070673_100863396
735 Ga0070673_101049826
736 Ga0070688_100036177
737 Ga0070688_100331297
738 Ga0070688_101605933
739 Ga0070659_100765813
740 Ga0070667_100014018
741 Ga0070667_100059796
742 Ga0070667_100924853
743 Ga0070667_100954696
744 Ga0070667_101036043
745 Ga0070709_10020457
746 Ga0070709_10138767
747 Ga0070713_100028665
748 Ga0070701_10002357
749 Ga0070701_10158003
750 Ga0070701_10290527
751 Ga0070701_10514434
752 Ga0070711_101069735
753 Ga0070705_100000037
754 Ga0070705_101339951
755 Ga0070700_100051603
756 Ga0070700_100069990
757 Ga0070700_100245856
758 Ga0070700_100570034
759 Ga0070700_101129841
760 Ga0070694_100005480
761 Ga0070694_100135736
762 Ga0070694_100150397
763 Ga0070694_100228084
764 Ga0070694_100376059
765 Ga0070694_100462243
766 Ga0070694_100532433
767 Ga0070694_100602804
768 Ga0070708_100042068
769 Ga0070708_101149493
770 Ga0070663_100889066
771 Ga0070678_100028655
772 Ga0070678_100090163
773 Ga0070678_101864115
774 Ga0070662_100041354
775 Ga0070662_100206567
776 Ga0070662_100623348
777 Ga0070681_10027374
778 Ga0068867_100000265
779 Ga0068867_100130170
780 Ga0070685_10249553
781 Ga0070685_10844433
782 Ga0070685_11048592
783 Ga0070706_100003738
784 Ga0070706_100269592
785 Ga0070706_100605121
786 Ga0070707_100001201
787 Ga0070707_100688457
788 Ga0070707_101029950
789 Ga0070707_101263492
790 Ga0070698_100020353
791 Ga0070698_100718544
792 Ga0070699_100181207
793 Ga0070699_100437039
794 Ga0070699_102041868
795 Ga0070679_100020171
796 Ga0070679_101653619
797 Ga0070684_100055686
798 Ga0070684_101600719
799 Ga0070697_100025013
800 Ga0070697_100035381
801 Ga0070697_100233130
802 Ga0070697_100491683
803 Ga0068853_100475661
804 Ga0070672_100056393
805 Ga0070672_100078985
806 Ga0070672_100098450
807 Ga0070672_100118866
808 Ga0070672_100156607
809 Ga0070672_100277346
810 Ga0070686_100798685
811 Ga0070695_100001493
812 Ga0070695_100142118
813 Ga0070695_100186564
814 Ga0070695_100957812
815 Ga0070695_101592368
816 Ga0070696_100000139
817 Ga0070693_100719677
818 Ga0070665_100002281
819 Ga0070665_100157101
820 Ga0070665_101790414
821 Ga0070704_100058662
822 Ga0070704_100236602
823 Ga0070704_100725711
824 Ga0070704_101252564
825 Ga0068855_101144913
826 Ga0070664_100011848
827 Ga0070664_100338092
828 Ga0070664_100898856
829 Ga0068857_100030919
830 Ga0068857_100442222
831 Ga0068854_100048700
832 Ga0070702_100001352
833 Ga0070702_100014861
834 Ga0070702_100080529
835 Ga0068852_100212705
836 Ga0068852_100395631
837 Ga0068852_100626788
838 Ga0068852_100752774
839 Ga0068859_100008136
840 Ga0068859_100061047
841 Ga0068859_100139918
842 Ga0068859_100149513
843 Ga0068859_100266103
844 Ga0068859_100282822
845 Ga0068859_100586155
846 Ga0068859_100853168
847 Ga0068859_101110656
848 Ga0068859_101203199
849 Ga0068864_100024466
850 Ga0068864_100139734
851 Ga0068864_100220586
852 Ga0068864_100224395
853 Ga0068864_100411615
854 Ga0068866_10014712
855 Ga0068866_10816868
856 Ga0068861_100003999
857 Ga0068861_100575608
858 Ga0068861_100595739
859 Ga0068851_10073785
860 Ga0068851_10632961
861 Ga0068870_10002276
862 Ga0068870_10021401
863 Ga0068870_10116139
864 Ga0068863_100008012
865 Ga0068863_100065528
866 Ga0068863_100137664
867 Ga0068863_100330393
868 Ga0068863_100378544
869 Ga0068863_101073862
870 Ga0068858_100017955
871 Ga0068858_100044696
872 Ga0068858_100109092
873 Ga0068858_100562876
874 Ga0068860_100027062
875 Ga0068860_100156293
876 Ga0068860_100177629
877 Ga0068860_100582643
878 Ga0068860_102144439
879 Ga0068862_100047227
880 Ga0068862_100279952
881 Ga0068862_100368737
882 Ga0068862_101915203
883 Ga0081455_10049151
884 Ga0081455_11025349
885 Ga0075365_10579676
886 Ga0075368_10136287
887 Ga0075363_100460400
888 Ga0075364_10021461
889 Ga0075432_10236886
890 Ga0070715_10865485
891 Ga0070716_100143342
892 Ga0075367_10049319
893 Ga0075369_10210019
894 Ga0097621_100064160
895 Ga0097621_100148642
896 Ga0097621_100208888
897 Ga0097621_101183110
898 Ga0075370_10305278
899 Ga0068871_100436581
900 Ga0068871_100455679
901 Ga0068871_100559085
902 Ga0068871_100562861
903 Ga0068871_100831364
904 Ga0075428_100015340
905 Ga0075428_101279264
906 Ga0075433_10010141
907 Ga0075433_10072163
908 Ga0075433_10137458
909 Ga0075433_10562128
910 Ga0075434_100010589
911 Ga0075434_100116584
912 Ga0075434_100120821
913 Ga0075434_100209203
914 Ga0075434_100876875
915 Ga0075429_100096236
916 Ga0068865_100129755
917 Ga0068865_100273617
918 Ga0068865_100529034
919 Ga0075436_100092788
920 Ga0075436_101343189
921 Ga0097620_100008136
922 Ga0097620_100061048
923 Ga0097620_100139921
924 Ga0097620_100149501
925 Ga0097620_100266113
926 Ga0097620_100282827
927 Ga0097620_100586157
928 Ga0097620_100853201
929 Ga0097620_101055297
930 Ga0097620_101110545
931 Ga0097620_101203189
932 Ga0075435_100003148
933 Ga0075435_100246914
934 Ga0099795_10212859
935 Ga0099795_10266669
936 Ga0105240_10039765
937 Ga0105240_10886558
938 Ga0111539_10038271
939 Ga0111539_10076896
940 Ga0111539_10098220
941 Ga0111539_10290994
942 Ga0111539_10795095
943 Ga0111539_11292240
944 Ga0105245_10021070
945 Ga0105245_10087577
946 Ga0105245_10105160
947 Ga0105247_10011072
948 Ga0114129_10152136
949 Ga0114129_10560789
950 Ga0114129_11499005
951 Ga0114129_11670967
952 Ga0114129_12337654
953 Ga0105243_10392677
954 Ga0105243_10480418
955 Ga0105243_11808069
956 Ga0105241_10443791
957 Ga0105241_11351626
958 Ga0105242_10040109
959 Ga0105242_10081955
960 Ga0105242_10873901
961 Ga0105248_10012713
962 Ga0105248_10016697
963 Ga0105248_10147607
964 Ga0105248_10343732
965 Ga0105248_10749130
966 Ga0105248_12788511
967 Ga0105238_10630599
968 Ga0105238_11405115
969 Ga0105249_10000182
970 Ga0105249_10013317
971 Ga0105249_11282879
972 Ga0099796_10567216
973 Ga0105239_12204528
974 Ga0105246_10133502
975 Ga0105246_10140078
976 Ga0105246_10154402
977 Ga0105246_10528273
978 Ga0157369_10073719
979 Ga0157374_10005772
980 Ga0157374_10524731
981 Ga0157374_11114785
982 Ga0157378_10481020
983 Ga0157378_10578753
984 Ga0157378_10940107
985 Ga0157378_11714476
986 Ga0157378_12152645
987 Ga0163162_10091980
988 Ga0163162_10300998
989 Ga0163162_10358670
990 Ga0157375_10236291
991 Ga0157375_10655377
992 Ga0157375_11624837
993 Ga0157375_11708351
994 Ga0157375_12154389
995 Ga0163163_10008708
996 Ga0163163_10226472
997 Ga0163163_10519543
998 Ga0163163_11144980
999 Ga0163163_11410326
1000 Ga0163163_12373316
1001 Ga0157380_10237373
1002 Ga0157380_10296274
1003 Ga0157380_10410777
1004 Ga0157380_10816630
1005 Ga0157377_10260035
1006 Ga0157377_10789689
1007 Ga0157379_10040715
1008 Ga0157379_10041656
1009 Ga0157379_10071635
1010 Ga0157379_11753238
1011 Ga0157376_10018282
1012 Ga0157376_10028229
1013 Ga0157376_10036669
1014 Ga0157376_10093640
1015 Ga0157376_10172439
1016 Ga0157376_10433947
1017 Ga0207666_1009081
1018 Ga0207697_10030192
1019 Ga0207656_10054451
1020 Ga0207653_10054460
1021 Ga0207682_10073963
1022 Ga0207642_10039001
1023 Ga0207710_10013426
1024 Ga0207688_10377824
1025 Ga0207680_10051906
1026 Ga0207680_10156834
1027 Ga0207647_10388961
1028 Ga0207647_10434019
1029 Ga0207685_10466500
1030 Ga0207699_10044655
1031 Ga0207645_10086341
1032 Ga0207645_10404308
1033 Ga0207643_10005644
1034 Ga0207643_10027486
1035 Ga0207643_10199487
1036 Ga0207684_10100443
1037 Ga0207654_10333357
1038 Ga0207654_10541324
1039 Ga0207707_10002331
1040 Ga0207695_10098513
1041 Ga0207660_10078893
1042 Ga0207660_10129911
1043 Ga0207662_10006037
1044 Ga0207662_10131960
1045 Ga0207662_10784737
1046 Ga0207649_10229968
1047 Ga0207649_10677644
1048 Ga0207652_10177492
1049 Ga0207646_10000005
1050 Ga0207646_10213937
1051 Ga0207646_10649260
1052 Ga0207681_10002833
1053 Ga0207681_10181784
1054 Ga0207681_10414341
1055 Ga0207694_11136540
1056 Ga0207650_10037170
1057 Ga0207650_10071265
1058 Ga0207650_10116418
1059 Ga0207650_10392811
1060 Ga0207650_10476642
1061 Ga0207659_10004564
1062 Ga0207659_10009311
1063 Ga0207659_10075213
1064 Ga0207659_10140147
1065 Ga0207659_10211235
1066 Ga0207659_10214879
1067 Ga0207687_10028425
1068 Ga0207687_10431668
1069 Ga0207644_10044383
1070 Ga0207644_10147934
1071 Ga0207644_10774055
1072 Ga0207644_10911801
1073 Ga0207706_10080619
1074 Ga0207706_10670085
1075 Ga0207686_10065762
1076 Ga0207686_10515169
1077 Ga0207686_10605263
1078 Ga0207709_10077526
1079 Ga0207709_10279372
1080 Ga0207670_10005144
1081 Ga0207670_10043284
1082 Ga0207670_10684135
1083 Ga0207669_10108544
1084 Ga0207669_10126398
1085 Ga0207669_10559842
1086 Ga0207669_11042614
1087 Ga0207665_10052202
1088 Ga0207691_10063783
1089 Ga0207691_10090278
1090 Ga0207691_10146651
1091 Ga0207691_10227586
1092 Ga0207691_10785184
1093 Ga0207691_11251229
1094 Ga0207711_10016981
1095 Ga0207711_10019080
1096 Ga0207711_10697282
1097 Ga0207711_11684745
1098 Ga0207689_10029115
1099 Ga0207689_10089714
1100 Ga0207689_10256063
1101 Ga0207689_11368388
1102 Ga0207661_10227638
1103 Ga0207679_10136904
1104 Ga0207679_10927422
1105 Ga0207651_10030586
1106 Ga0207651_10088252
1107 Ga0207651_10107092
1108 Ga0207651_10922076
1109 Ga0207651_10931858
1110 Ga0207712_10000063
1111 Ga0207712_10613650
1112 Ga0207668_10001620
1113 Ga0207668_10197839
1114 Ga0207640_10219179
1115 Ga0207658_10134519
1116 Ga0207658_10767350
1117 Ga0207677_10018548
1118 Ga0207677_10215836
1119 Ga0207677_10263549
1120 Ga0207677_10360007
1121 Ga0207703_10004498
1122 Ga0207703_10023908
1123 Ga0207703_10134964
1124 Ga0207703_10170408
1125 Ga0207703_10688354
1126 Ga0207639_10298134
1127 Ga0207708_10020209
1128 Ga0207708_10036795
1129 Ga0207708_10049016
1130 Ga0207708_10381391
1131 Ga0207702_12225006
1132 Ga0207641_10045110
1133 Ga0207641_10048860
1134 Ga0207641_10091025
1135 Ga0207641_10092906
1136 Ga0207641_10282042
1137 Ga0207641_11063194
1138 Ga0207641_11763458
1139 Ga0207648_10000844
1140 Ga0207648_10081967
1141 Ga0207648_10284180
1142 Ga0207648_10383397
1143 Ga0207676_10058395
1144 Ga0207676_10072530
1145 Ga0207676_10132112
1146 Ga0207676_10198270
1147 Ga0207676_10280606
1148 Ga0207674_10009268
1149 Ga0207674_10119086
1150 Ga0207674_10981151
1151 Ga0207674_11827751
1152 Ga0207675_100001335
1153 Ga0207675_100113852
1154 Ga0207675_100218887
1155 Ga0207675_100861803
1156 Ga0207683_10047044
1157 Ga0207683_10083670
1158 Ga0207698_10272137
1159 Ga0209588_1010128
1160 Ga0209813_10136239
1161 Ga0207428_10056271
1162 Ga0207428_10271485
1163 Ga0207428_11008650
1164 Ga0268266_10009932
1165 Ga0268266_10261848
1166 Ga0268266_11289845
1167 Ga0268265_10006637
1168 Ga0268265_10346621
1169 Ga0268265_11665896
1170 Ga0268264_10112212
1171 Ga0268264_10533758
1172 Ga0268264_10871876
1173 Ga0268264_10912349
1174 Ga0268264_10917398
1175 Ga0265338_10837648
1176 Ga0316181_1222148
1177 Ga0265760_10025103
1178 Ga0307414_10266110
1179 Ga0373949_0056869
1180 Ga0373951_0077844
1181 Ga0373952_0250388
1182 Ga0373932_0035450
1183 Ga0373936_0229540
1184 Ga0373939_0242188
1185 Ga0373941_0012238
1186 Ga0373954_0267417
1187 Ga0373954_0284684
1188 Ga0373956_0014364
1189 Ga0373956_0026411
1190 Ga0373957_0434288
1191 Ga0373943_0579272
1192 Ga0373955_0069612
1193 Ga0373955_0099850
1194 Ga0373955_0870082
1195 Ga0373961_0089640
1196 Ga0373931_0233620
1197 Ga0373931_0671456
1198 Ga0373935_0068728
1199 Ga0373935_0217476
1200 Ga0373935_1449759
1201 Ga0373927_0455479
1202 Ga0373927_0621610
1203 Ga0373933_0108697
1204 Ga0373937_0119345
1205 Ga0373937_0172060
1206 Ga0373925_0133519
1207 Ga0373925_0458778
1208 Ga0451807_1483177
1209 Ga0451851_0572458
1210 Ga0451853_3616473
1211 Ga0439435_0029068
1212 Ga0451577_0001736
1213 Ga0451577_0030092
1214 Ga0451577_0961838
1215 Ga0451577_0992767
1216 Ga0451577_1651333
1217 Ga0453683_0004523
1218 Ga0453683_0040415
1219 Ga0453684_0001021
1220 Ga0453684_0088609
1221 Ga0453684_0206297
1222 Ga0453684_1041784
1223 Ga0453684_2278021
1224 Ga0451576_0087303
1225 Ga0451576_0101461
1226 Ga0451576_0325012
1227 Ga0466967_1035044
1228 Ga0495603_0006905
1229 Ga0495580_0059640
1230 Ga0495580_0755189
1231 Ga0495582_0338614
1232 Ga0495639_0247178
1233 Ga0495662_0043266
1234 Ga0495594_0023874
1235 Ga0495607_0473772
1236 Ga0495608_0024536
1237 Ga0495630_1108629
1238 Ga0495630_1233074
1239 Ga0495663_0097205
1240 Ga0495663_0153885
1241 Ga0495642_0057380
1242 Ga0495642_0100233
1243 Ga0495640_0326446
1244 Ga0495621_0212581
1245 Ga0495645_0031447
1246 Ga0495645_0736936
1247 Ga0495633_0421100
1248 Ga0495667_0605302
1249 Ga0495611_0253885
1250 Ga0495659_0002267
1251 Ga0495659_0034483
1252 Ga0495659_0074444
1253 Ga0495659_0335553
1254 Ga0495588_0005306
1255 Ga0495657_0053302
1256 Ga0495599_0259922
1257 Ga0495647_0002231
1258 Ga0495658_0103481
1259 Ga0495658_0319597
1260 Ga0495658_0678133
1261 Ga0495669_0007901
1262 Ga0495613_0115078
1263 Ga0495624_0831148
1264 Ga0495670_0044274
1265 Ga0495600_0132661
1266 Ga0495636_0043461
1267 Ga0495636_0057754
1268 Ga0495674_0858532
1269 Ga0495685_134363
1270 Ga0495684_0009675
1271 Ga0496100_0253325
1272 Ga0496102_0624138
1273 Ga0496104_0179552
1274 Ga0496104_0276825
1275 Ga0496104_0636252
1276 Ga0496104_1176686
1277 Ga0496105_1147989
1278 Ga0496106_0395936
1279 Ga0496106_1079208
1280 Ga0496108_0296490
1281 Ga0496109_1533391
1282 Ga0496109_1846267
1283 Ga0496110_0657457
1284 Ga0496111_0809733
1285 Ga0496112_0012702
1286 Ga0496112_1054240
1287 Ga0496112_1242032
1288 Ga0496113_0012726
1289 Ga0496113_0498141
1290 Ga0496114_0057539
1291 Ga0501039_1543135
1292 Ga0501072_0303396
1293 Ga0501076_0962294
1294 Ga0501081_1408374
1295 Ga0501241_002671
1296 nmdc:mga00v17_576177_c1
1297 nmdc:mga06z11_930370_c1
1298 nmdc:mga06z11_97271_c1
1299 nmdc:mga04h51_132875_c1
1300 nmdc:mga07m45_531293_c1
1301 nmdc:mga05p37_151491_c2
1302 nmdc:mga05p37_2000542_c1
1303 nmdc:mga05p37_2703_c1
1304 nmdc:mga08y16_174979_c1
1305 nmdc:mga08y16_889174_c1
1306 nmdc:mga0n895_1547270_c1
1307 nmdc:mga0n895_1704806_c1
1308 nmdc:mga0n895_20877_c1
1309 nmdc:mga0n895_625324_c1
1310 nmdc:mga0rr50_283386_c1
1311 nmdc:mga0rr50_8733_c1
1312 nmdc:mga08x19_1094867_c1
1313 nmdc:mga08x19_21010_c1
1314 nmdc:mga0a205_22081_c1
1315 nmdc:mga0a205_37742_c1
1316 nmdc:mga0a205_435073_c1
1317 nmdc:mga0a205_6451_c1
1318 nmdc:mga0sz30_432419_c1
1319 Ga0495595_0025258
1320 Ga0495595_0361961
1321 Ga0495619_0473554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20136

DUF6526

Family of unknown function (DUF6526)

9

154

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tmh-assembly1.cif.gz_K cryo-em structure of toxoplasma gondii mitochondrial atp synthase dimer, oscp/f1/c-ring model 0.8887 18 60
1xvl-assembly3.cif.gz_C the three-dimensional structure of mntc from synechocystis 6803 0.8005 18 64
6sdk-assembly1.cif.gz_B crystal structure of bacterial parb dimer bound to cdp 0.7475 80 133
7nfu-assembly2.cif.gz_B crystal structure of c-terminally truncated geobacillus thermoleovorans nucleoid occlusion protein noc 0.7296 67 131
6kkm-assembly1.cif.gz_G-2 crystal structure of rbcl-raf1 complex from anabaena sp. pcc 7120 0.7222 69 131
ID Description Score Start End Superfamily
5jg7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8841 18 64 3.40.50.1980
af_Q2G118_97_208_1.10.10.2830 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.805 95 131 1.10.10.2830
1vz0D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.7259 79 129 1.10.10.2830
af_B4FTT4_81_159_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.58 17 69 1.10.287.70
4v1gB00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.5201 9 64 1.20.20.10
ID Description Score Start End GO Terms
AF-A0A4V2A2Y4-F1-model_v4 Uncharacterized protein 0.9751 60 143
AF-A0A519Z5M5-F1-model_v4 Uncharacterized protein 0.9572 59 143
AF-A0A223V3F7-F1-model_v4 Uncharacterized protein 0.956 64 143
AF-A0A4V2A2Y4-F1-model_v4 Uncharacterized protein 0.9529 60 143
AF-A0A0E9MYA1-F1-model_v4 Uncharacterized protein 0.9496 43 143

Map