F473300

General Info

Members Datasets Scaffolds Average Seq Length
660 252 1320 218

Family's Representative Sequence

Representative Sequence 3300002075|JGI24738J21930_10004878|JGI24738J21930_100048784
Length 230
Sequence VAREAVSCYISPMTILAPRANLNDQVYATLRERILTRDPGPGAKLSLHELAAXLGVSRSPVHHALTRLVSEGLLSVKARRGYFVTPVTSQALLEGYEVRLALELHAADVAVDTASDEQVTDLRRRHIATVEAISXEEWDAANASFHEAQVDLAGNKLLSRFYRELSINLMMQVIRGGRVERHEHLVTEHEAIVSGFETRDRAVARAAITRHVESGRRIALEAVERAGGAL

Samples

Sample ID Description Type Environment
1 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
156 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
162 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
163 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
164 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
165 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
166 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
167 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
168 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
169 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
170 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
171 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
172 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
173 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
174 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
175 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
176 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
177 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
178 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
183 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
184 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
185 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
186 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 5.3
Rhizosphere 93.94
Stem 0
Stem Tuber 0
Unclassified 6.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10004878 3300002075 Bacteria 3256
2 JGI25406J46586_10035795 3300003203 Bacteria 1809
3 Ga0070658_10020296 3300005327 Bacteria 5324
4 Ga0070676_10067812 3300005328 Bacteria 2134
5 Ga0070683_100010806 3300005329 Bacteria 7857
6 Ga0070683_100221932 3300005329 Bacteria 1796
7 Ga0070683_100349040 3300005329 Bacteria 1409
8 Ga0070683_100395924 3300005329 Bacteria 1317
9 Ga0070677_10031200 3300005333 Bacteria 2035
10 Ga0070666_10586246 3300005335 Bacteria 813
11 Ga0070680_100025551 3300005336 Bacteria 4721
12 Ga0070680_100169506 3300005336 Bacteria 1836
13 Ga0070682_100003551 3300005337 Bacteria 8630
14 Ga0070682_100051165 3300005337 Bacteria 2581
15 Ga0070682_100076438 3300005337 Bacteria 2155
16 Ga0070682_100098769 3300005337 Bacteria 1924
17 Ga0068868_100536992 3300005338 Bacteria 1029
18 Ga0070660_100021121 3300005339 Bacteria 4796
19 Ga0070689_100017072 3300005340 Bacteria 5324
20 Ga0070691_10001184 3300005341 Bacteria 10931
21 Ga0070691_10081428 3300005341 Bacteria 1586
22 Ga0070687_100038390 3300005343 Bacteria 2400
23 Ga0070661_100074664 3300005344 Bacteria 2497
24 Ga0070661_100588036 3300005344 Unclassified 899
25 Ga0070661_100751711 3300005344 Bacteria 797
26 Ga0070692_10098980 3300005345 Bacteria 1596
27 Ga0070692_10153890 3300005345 Unclassified 1312
28 Ga0070675_100041952 3300005354 Bacteria 3738
29 Ga0070675_100346548 3300005354 Bacteria 1317
30 Ga0070674_100135323 3300005356 Bacteria 1842
31 Ga0070674_100322722 3300005356 Bacteria 1238
32 Ga0070673_100496039 3300005364 Unclassified 1104
33 Ga0070688_100043759 3300005365 Bacteria 2760
34 Ga0070688_100332783 3300005365 Bacteria 1107
35 Ga0070659_100004790 3300005366 Bacteria 9673
36 Ga0070659_100165323 3300005366 Bacteria 1810
37 Ga0070701_10011639 3300005438 Bacteria 3942
38 Ga0070705_100149592 3300005440 Bacteria 1547
39 Ga0070700_100106870 3300005441 Bacteria 1853
40 Ga0070694_100418630 3300005444 Unclassified 1052
41 Ga0070708_100213855 3300005445 Bacteria 1807
42 Ga0070708_100562798 3300005445 Bacteria 1075
43 Ga0070678_100166224 3300005456 Bacteria 1792
44 Ga0070678_100587572 3300005456 Bacteria 993
45 Ga0070662_100078895 3300005457 Bacteria 2447
46 Ga0070681_10063717 3300005458 Bacteria 3658
47 Ga0070681_10080587 3300005458 Bacteria 3211
48 Ga0068867_100225710 3300005459 Bacteria 1511
49 Ga0068867_100285828 3300005459 Bacteria 1354
50 Ga0070685_10028696 3300005466 Bacteria 3086
51 Ga0070706_100993424 3300005467 Bacteria 774
52 Ga0070698_100187221 3300005471 Bacteria 2008
53 Ga0070699_100052843 3300005518 Bacteria 3515
54 Ga0070699_100305519 3300005518 Bacteria 1427
55 Ga0070679_100052410 3300005530 Bacteria 4064
56 Ga0070679_100432292 3300005530 Bacteria 1261
57 Ga0070684_100074588 3300005535 Bacteria 2990
58 Ga0070684_100099106 3300005535 Bacteria 2600
59 Ga0070684_100163262 3300005535 Bacteria 2021
60 Ga0070684_100656600 3300005535 Bacteria 976
61 Ga0070684_100874760 3300005535 Bacteria 841
62 Ga0068853_100032064 3300005539 Bacteria 4449
63 Ga0068853_100422867 3300005539 Bacteria 1249
64 Ga0070672_100277957 3300005543 Bacteria 1415
65 Ga0070672_100557238 3300005543 Bacteria 995
66 Ga0070686_100285544 3300005544 Bacteria 1219
67 Ga0070693_100099679 3300005547 Bacteria 1767
68 Ga0070665_100093217 3300005548 Bacteria 3016
69 Ga0070704_100063726 3300005549 Bacteria 2646
70 Ga0070704_100098994 3300005549 Bacteria 2192
71 Ga0070664_100130694 3300005564 Unclassified 2205
72 Ga0070664_100264686 3300005564 Bacteria 1547
73 Ga0070664_100405587 3300005564 Bacteria 1247
74 Ga0068857_100114534 3300005577 Bacteria 2425
75 Ga0068857_100145822 3300005577 Bacteria 2142
76 Ga0068854_100024362 3300005578 Bacteria 4143
77 Ga0068854_100073483 3300005578 Bacteria 2506
78 Ga0068854_100141080 3300005578 Bacteria 1849
79 Ga0068854_100270124 3300005578 Bacteria 1365
80 Ga0068856_100301741 3300005614 Bacteria 1619
81 Ga0070702_100006499 3300005615 Bacteria 5540
82 Ga0070702_100006838 3300005615 Bacteria 5426
83 Ga0068852_100002729 3300005616 Bacteria 12211
84 Ga0068852_100549500 3300005616 Bacteria 1155
85 Ga0068859_100033807 3300005617 Bacteria 5133
86 Ga0068859_100974025 3300005617 Bacteria 931
87 Ga0068861_100346461 3300005719 Bacteria 1301
88 Ga0068851_10009412 3300005834 Bacteria 4543
89 Ga0068870_10005881 3300005840 Bacteria 5387
90 Ga0068870_10037588 3300005840 Bacteria 2496
91 Ga0068870_10074876 3300005840 Bacteria 1856
92 Ga0068863_100020946 3300005841 Bacteria 6244
93 Ga0068863_100226317 3300005841 Unclassified 1803
94 Ga0068858_100027009 3300005842 Bacteria 5332
95 Ga0068860_100172147 3300005843 Bacteria 2091
96 Ga0068860_100234522 3300005843 Bacteria 1784
97 Ga0068862_100272783 3300005844 Bacteria 1548
98 Ga0081455_10017529 3300005937 Bacteria 6861
99 Ga0081455_10134333 3300005937 Bacteria 1930
100 Ga0081455_10180983 3300005937 Bacteria 1596
101 Ga0081455_10252859 3300005937 Bacteria 1288
102 Ga0081539_10006369 3300005985 Bacteria 11359
103 Ga0075364_10428151 3300006051 Bacteria 904
104 Ga0075432_10014112 3300006058 Bacteria 2720
105 Ga0075367_10215011 3300006178 Bacteria 1202
106 Ga0097621_100087668 3300006237 Bacteria 2599
107 Ga0068871_100104875 3300006358 Bacteria 2371
108 Ga0068871_100559442 3300006358 Bacteria 1037
109 Ga0075428_100031741 3300006844 Bacteria 5835
110 Ga0075428_100143111 3300006844 Bacteria 2599
111 Ga0075428_100198138 3300006844 Bacteria 2172
112 Ga0075430_100034498 3300006846 Bacteria 4294
113 Ga0075431_100102283 3300006847 Bacteria 2957
114 Ga0075431_100310615 3300006847 Bacteria 1591
115 Ga0075433_10137758 3300006852 Bacteria 2169
116 Ga0075433_10236638 3300006852 Bacteria 1621
117 Ga0075433_10265993 3300006852 Bacteria 1520
118 Ga0075433_10374598 3300006852 Bacteria 1257
119 Ga0075434_100733000 3300006871 Bacteria 1005
120 Ga0075429_100049911 3300006880 Bacteria 3640
121 Ga0075429_100053133 3300006880 Bacteria 3525
122 Ga0075429_100336623 3300006880 Bacteria 1321
123 Ga0068865_100066771 3300006881 Bacteria 2538
124 Ga0068865_100086537 3300006881 Bacteria 2262
125 Ga0068865_100170614 3300006881 Bacteria 1667
126 Ga0068865_100298754 3300006881 Bacteria 1288
127 Ga0075436_100018683 3300006914 Bacteria 4745
128 Ga0097620_100033805 3300006931 Bacteria 5133
129 Ga0097620_100974217 3300006931 Bacteria 931
130 Ga0111539_10016729 3300009094 Bacteria 9088
131 Ga0111539_10026695 3300009094 Bacteria 7057
132 Ga0111539_10437282 3300009094 Bacteria 1523
133 Ga0111539_11111433 3300009094 Bacteria 918
134 Ga0105245_10082250 3300009098 Bacteria 2946
135 Ga0105245_10183917 3300009098 Bacteria 1998
136 Ga0105245_10266119 3300009098 Bacteria 1670
137 Ga0105247_10313687 3300009101 Bacteria 1092
138 Ga0114129_10016628 3300009147 Bacteria 10477
139 Ga0114129_10251482 3300009147 Bacteria 2372
140 Ga0114129_10309027 3300009147 Bacteria 2105
141 Ga0114129_10569440 3300009147 Bacteria 1471
142 Ga0105243_10010878 3300009148 Bacteria 6884
143 Ga0105243_10019884 3300009148 Bacteria 5093
144 Ga0105243_10035385 3300009148 Bacteria 3871
145 Ga0105243_10168419 3300009148 Bacteria 1895
146 Ga0105243_10237624 3300009148 Bacteria 1620
147 Ga0105241_10090193 3300009174 Bacteria 2417
148 Ga0105242_10041185 3300009176 Bacteria 3725
149 Ga0105242_10119140 3300009176 Bacteria 2262
150 Ga0105242_10983310 3300009176 Unclassified 850
151 Ga0105248_10243054 3300009177 Bacteria 2026
152 Ga0105248_10696690 3300009177 Bacteria 1146
153 Ga0105237_10534875 3300009545 Bacteria 1179
154 Ga0105238_10056633 3300009551 Bacteria 3932
155 Ga0105249_10071606 3300009553 Bacteria 3203
156 Ga0105249_10766978 3300009553 Unclassified 1027
157 Ga0105239_10087701 3300010375 Bacteria 3430
158 Ga0105239_10206708 3300010375 Bacteria 2200
159 Ga0105246_10161852 3300011119 Bacteria 1705
160 Ga0105246_10181732 3300011119 Unclassified 1620
161 Ga0105246_10207634 3300011119 Bacteria 1527
162 Ga0105246_10234917 3300011119 Bacteria 1446
163 Ga0105246_10292098 3300011119 Bacteria 1312
164 Ga0105246_10368420 3300011119 Bacteria 1183
165 Ga0105246_10610556 3300011119 Bacteria 944
166 Ga0105246_10654858 3300011119 Unclassified 915
167 Ga0157371_10018177 3300013102 Bacteria 5206
168 Ga0157371_10098404 3300013102 Bacteria 2074
169 Ga0157369_10236196 3300013105 Bacteria 1910
170 Ga0157374_10267946 3300013296 Bacteria 1684
171 Ga0163162_10068235 3300013306 Bacteria 3607
172 Ga0157372_10015689 3300013307 Bacteria 8124
173 Ga0157372_10106559 3300013307 Bacteria 3206
174 Ga0157372_10395367 3300013307 Bacteria 1611
175 Ga0157372_11416316 3300013307 Bacteria 801
176 Ga0157375_10059062 3300013308 Bacteria 3797
177 Ga0157375_10551011 3300013308 Bacteria 1315
178 Ga0163163_10235048 3300014325 Bacteria 1882
179 Ga0163163_10795243 3300014325 Bacteria 1009
180 Ga0157380_10027642 3300014326 Bacteria 4315
181 Ga0157380_10250498 3300014326 Bacteria 1603
182 Ga0157380_10260966 3300014326 Unclassified 1574
183 Ga0157380_10749262 3300014326 Bacteria 988
184 Ga0157377_10001619 3300014745 Bacteria 9818
185 Ga0157377_10013898 3300014745 Bacteria 4085
186 Ga0157377_10098622 3300014745 Bacteria 1737
187 Ga0157377_10127607 3300014745 Bacteria 1549
188 Ga0157377_10144776 3300014745 Bacteria 1464
189 Ga0157377_10327457 3300014745 Bacteria 1020
190 Ga0157379_10012042 3300014968 Bacteria 7557
191 Ga0157379_10065994 3300014968 Bacteria 3235
192 Ga0157376_10147692 3300014969 Bacteria 2116
193 Ga0157376_10391470 3300014969 Bacteria 1341
194 Ga0163161_10158325 3300017792 Bacteria 1725
195 Ga0163161_10357551 3300017792 Bacteria 1162
196 Ga0163161_10731064 3300017792 Bacteria 826
197 Ga0206356_10619810 3300020070 Bacteria 937
198 Ga0224712_10061860 3300022467 Bacteria 1494
199 Ga0207653_10151671 3300025885 Unclassified 853
200 Ga0207682_10043194 3300025893 Bacteria 1844
201 Ga0207688_10004673 3300025901 Bacteria 7463
202 Ga0207688_10025237 3300025901 Bacteria 3263
203 Ga0207688_10085097 3300025901 Bacteria 1811
204 Ga0207645_10082943 3300025907 Bacteria 2055
205 Ga0207643_10143180 3300025908 Bacteria 1429
206 Ga0207705_10341686 3300025909 Bacteria 1152
207 Ga0207684_10539132 3300025910 Bacteria 999
208 Ga0207654_10045805 3300025911 Bacteria 2491
209 Ga0207707_10209715 3300025912 Bacteria 1697
210 Ga0207660_10054412 3300025917 Bacteria 2856
211 Ga0207660_10130660 3300025917 Bacteria 1911
212 Ga0207662_10356788 3300025918 Bacteria 983
213 Ga0207657_10008194 3300025919 Bacteria 10648
214 Ga0207657_10078670 3300025919 Bacteria 2776
215 Ga0207649_10032335 3300025920 Bacteria 3118
216 Ga0207649_10052952 3300025920 Bacteria 2520
217 Ga0207652_10224380 3300025921 Bacteria 1693
218 Ga0207652_10431279 3300025921 Bacteria 1188
219 Ga0207681_10173750 3300025923 Bacteria 1635
220 Ga0207650_10019951 3300025925 Bacteria 4719
221 Ga0207650_10067936 3300025925 Bacteria 2676
222 Ga0207659_10007680 3300025926 Bacteria 6653
223 Ga0207659_10028465 3300025926 Bacteria 3798
224 Ga0207687_10079402 3300025927 Bacteria 2366
225 Ga0207687_10114127 3300025927 Unclassified 2010
226 Ga0207687_10281813 3300025927 Bacteria 1332
227 Ga0207690_10034834 3300025932 Bacteria 3247
228 Ga0207690_10529191 3300025932 Unclassified 956
229 Ga0207706_10059369 3300025933 Bacteria 3368
230 Ga0207706_10059783 3300025933 Bacteria 3356
231 Ga0207706_10387748 3300025933 Bacteria 1212
232 Ga0207686_10014049 3300025934 Bacteria 4447
233 Ga0207709_10033670 3300025935 Bacteria 3012
234 Ga0207709_10355723 3300025935 Bacteria 1107
235 Ga0207709_10374706 3300025935 Bacteria 1081
236 Ga0207670_10046961 3300025936 Bacteria 2872
237 Ga0207669_10125304 3300025937 Unclassified 1753
238 Ga0207704_10141814 3300025938 Bacteria 1682
239 Ga0207704_10357218 3300025938 Bacteria 1139
240 Ga0207691_10036874 3300025940 Bacteria 4529
241 Ga0207691_10039916 3300025940 Bacteria 4341
242 Ga0207711_10100442 3300025941 Bacteria 2559
243 Ga0207689_10031514 3300025942 Bacteria 4413
244 Ga0207689_10239489 3300025942 Bacteria 1500
245 Ga0207661_10019376 3300025944 Bacteria 5072
246 Ga0207661_10118924 3300025944 Bacteria 2247
247 Ga0207661_10183494 3300025944 Bacteria 1830
248 Ga0207661_10449804 3300025944 Bacteria 1173
249 Ga0207679_10022903 3300025945 Bacteria 4261
250 Ga0207679_10111935 3300025945 Bacteria 2156
251 Ga0207651_10843673 3300025960 Bacteria 814
252 Ga0207668_10668306 3300025972 Bacteria 911
253 Ga0207640_10009620 3300025981 Bacteria 5419
254 Ga0207640_10287561 3300025981 Bacteria 1294
255 Ga0207658_10383170 3300025986 Bacteria 1232
256 Ga0207677_10109458 3300026023 Bacteria 2054
257 Ga0207677_10124811 3300026023 Bacteria 1943
258 Ga0207677_10435254 3300026023 Bacteria 1120
259 Ga0207677_10595508 3300026023 Bacteria 970
260 Ga0207703_10529504 3300026035 Bacteria 1109
261 Ga0207639_10114078 3300026041 Bacteria 2208
262 Ga0207639_10337911 3300026041 Bacteria 1342
263 Ga0207678_10149407 3300026067 Bacteria 1995
264 Ga0207678_10177068 3300026067 Bacteria 1821
265 Ga0207678_10357190 3300026067 Bacteria 1261
266 Ga0207708_10030221 3300026075 Bacteria 4108
267 Ga0207708_10124855 3300026075 Bacteria 2008
268 Ga0207708_10512415 3300026075 Unclassified 1007
269 Ga0207702_10093017 3300026078 Bacteria 2644
270 Ga0207702_10344518 3300026078 Bacteria 1424
271 Ga0207641_10420412 3300026088 Bacteria 1287
272 Ga0207641_10702885 3300026088 Bacteria 996
273 Ga0207648_10013335 3300026089 Bacteria 7653
274 Ga0207648_10043300 3300026089 Bacteria 3952
275 Ga0207648_10253266 3300026089 Unclassified 1570
276 Ga0207648_10264428 3300026089 Bacteria 1535
277 Ga0207648_10284569 3300026089 Bacteria 1479
278 Ga0207676_10039555 3300026095 Bacteria 3608
279 Ga0207674_10063058 3300026116 Bacteria 3742
280 Ga0207674_10164008 3300026116 Bacteria 2176
281 Ga0207675_100093758 3300026118 Bacteria 2824
282 Ga0207675_100420497 3300026118 Unclassified 1320
283 Ga0207675_100645049 3300026118 Bacteria 1065
284 Ga0207683_10017642 3300026121 Bacteria 6085
285 Ga0207683_10060770 3300026121 Bacteria 3322
286 Ga0207683_10088560 3300026121 Bacteria 2754
287 Ga0207683_10101842 3300026121 Bacteria 2564
288 Ga0207683_10715337 3300026121 Bacteria 929
289 Ga0207698_10019214 3300026142 Bacteria 4673
290 Ga0207698_10271452 3300026142 Bacteria 1564
291 Ga0207698_10386309 3300026142 Bacteria 1333
292 Ga0207698_10522068 3300026142 Bacteria 1159
293 Ga0207428_10009174 3300027907 Bacteria 8888
294 Ga0207428_10015782 3300027907 Bacteria 6518
295 Ga0207428_10051632 3300027907 Bacteria 3286
296 Ga0207428_10130303 3300027907 Bacteria 1925
297 Ga0268265_10392826 3300028380 Bacteria 1280
298 Ga0307408_100155576 3300031548 Bacteria 1810
299 Ga0307413_10351487 3300031824 Bacteria 1138
300 Ga0307406_10628544 3300031901 Unclassified 889
301 Ga0307409_100093669 3300031995 Bacteria 2469
302 Ga0307416_100378744 3300032002 Archaea 1444
303 Ga0307415_100136688 3300032126 Unclassified 1865
304 Ga0373942_0019523 3300035207 Bacteria 1693
305 Ga0373962_0008175 3300035242 Bacteria 2571
306 Ga0373962_0033937 3300035242 Bacteria 1411
307 Ga0373931_0364399 3300035691 Bacteria 907
308 Ga0395900_0098422 3300037418 Bacteria 3005
309 Ga0395898_0475963 3300037466 Bacteria 1188
310 Ga0395901_0004367 3300038443 Bacteria 14260
311 Ga0439436_0026675 3300041404 Bacteria 1693
312 Ga0439439_0000575 3300041406 Bacteria 6416
313 Ga0451798_0937553 3300041458 Bacteria 1089
314 Ga0451853_2954668 3300041512 Bacteria 1107
315 Ga0439433_0018740 3300041999 Bacteria 1541
316 Ga0439442_018559 3300042002 Bacteria 1438
317 Ga0439445_0066601 3300042004 Bacteria 992
318 Ga0439449_0077256 3300042007 Bacteria 1228
319 Ga0439457_040352 3300042014 Bacteria 1040
320 Ga0439462_0005622 3300042015 Bacteria 3095
321 Ga0439463_079597 3300042016 Bacteria 842
322 Ga0450920_017093 3300042122 Bacteria 1385
323 Ga0450906_030573 3300042145 Bacteria 952
324 Ga0439446_0000832 3300042156 Bacteria 6590
325 Ga0439446_0007119 3300042156 Bacteria 2934
326 Ga0439446_0076530 3300042156 Bacteria 1030
327 Ga0450908_010949 3300042184 Bacteria 1667
328 Ga0439434_0007170 3300042435 Bacteria 3264
329 Ga0439434_0011940 3300042435 Bacteria 2567
330 Ga0439459_0058840 3300042438 Bacteria 863
331 Ga0450918_006012 3300042531 Unclassified 2171
332 Ga0495603_0018393 3300046455 Bacteria 4228
333 Ga0495641_0106849 3300046461 Bacteria 1249
334 Ga0495651_0399530 3300046462 Unclassified 898
335 Ga0495605_0106960 3300046474 Bacteria 1280
336 Ga0495584_0122043 3300046491 Bacteria 1320
337 Ga0495596_0033470 3300046500 Bacteria 2045
338 Ga0495644_0063197 3300046523 Bacteria 1391
339 Ga0495644_0135021 3300046523 Bacteria 941
340 Ga0495663_0190098 3300046525 Bacteria 714
341 Ga0495667_0217177 3300046559 Unclassified 1221
342 Ga0495634_0144340 3300046642 Bacteria 1509
343 Ga0495670_0156350 3300046691 Bacteria 1197
344 Ga0495589_0151816 3300046794 Bacteria 1106
345 Ga0495600_0187518 3300046809 Bacteria 1331
346 Ga0495674_0117666 3300047319 Bacteria 2248
347 Ga0496100_0235862 3300048903 Bacteria 1348
348 Ga0496100_0650332 3300048903 Bacteria 821
349 Ga0496101_0264616 3300048904 Bacteria 1342
350 Ga0496101_0821529 3300048904 Bacteria 733
351 Ga0496101_0906263 3300048904 Bacteria 694
352 Ga0496103_0253774 3300048906 Bacteria 1132
353 Ga0496104_0098299 3300048907 Bacteria 2802
354 Ga0496104_0175237 3300048907 Bacteria 2055
355 Ga0496104_0204351 3300048907 Bacteria 1887
356 Ga0496105_0366616 3300048908 Bacteria 1148
357 Ga0496105_0575407 3300048908 Bacteria 877
358 Ga0496106_0239662 3300048909 Unclassified 1449
359 Ga0496106_0319991 3300048909 Bacteria 1245
360 Ga0496107_0171904 3300048910 Bacteria 1608
361 Ga0496107_0235755 3300048910 Bacteria 1362
362 Ga0496107_0749389 3300048910 Bacteria 717
363 Ga0496108_0222591 3300048911 Unclassified 1640
364 Ga0496108_0299224 3300048911 Bacteria 1401
365 Ga0496108_0608698 3300048911 Bacteria 952
366 Ga0496109_0014515 3300048912 Bacteria 6852
367 Ga0496109_0227297 3300048912 Bacteria 1755
368 Ga0496110_0001012 3300048913 Bacteria 19807
369 Ga0496110_0040698 3300048913 Bacteria 4051
370 Ga0496110_0049155 3300048913 Bacteria 3698
371 Ga0496110_0091556 3300048913 Bacteria 2720
372 Ga0496111_0016754 3300048914 Bacteria 5055
373 Ga0496111_0107527 3300048914 Bacteria 2054
374 Ga0496111_0241533 3300048914 Bacteria 1341
375 Ga0496111_0290862 3300048914 Bacteria 1211
376 Ga0496112_0052526 3300048915 Bacteria 4000
377 Ga0496112_0358369 3300048915 Bacteria 1401
378 Ga0496113_0250372 3300048916 Bacteria 1414
379 Ga0496114_0031231 3300048917 Bacteria 4382
380 Ga0496115_0483637 3300048918 Bacteria 997
381 Ga0501031_0000606 3300049568 Bacteria 21133
382 Ga0501031_0007909 3300049568 Bacteria 6920
383 Ga0501031_0035463 3300049568 Bacteria 3253
384 Ga0501031_0042082 3300049568 Bacteria 2982
385 Ga0501031_0087817 3300049568 Bacteria 2027
386 Ga0501031_0134000 3300049568 Bacteria 1618
387 Ga0501031_0258020 3300049568 Bacteria 1133
388 Ga0501032_0025958 3300049569 Bacteria 4035
389 Ga0501032_0033124 3300049569 Bacteria 3542
390 Ga0501032_0405092 3300049569 Bacteria 876
391 Ga0501033_0006070 3300049570 Bacteria 9474
392 Ga0501033_0008450 3300049570 Bacteria 7974
393 Ga0501033_0058623 3300049570 Bacteria 2844
394 Ga0501033_0103002 3300049570 Bacteria 2082
395 Ga0501033_0231941 3300049570 Bacteria 1311
396 Ga0501033_0487070 3300049570 Bacteria 854
397 Ga0501034_0336113 3300049571 Bacteria 1441
398 Ga0501036_0001341 3300049572 Bacteria 18917
399 Ga0501036_0006649 3300049572 Bacteria 9397
400 Ga0501036_0012707 3300049572 Bacteria 6986
401 Ga0501036_0055348 3300049572 Bacteria 3360
402 Ga0501036_0078331 3300049572 Bacteria 2795
403 Ga0501036_0102127 3300049572 Bacteria 2426
404 Ga0501036_0137938 3300049572 Bacteria 2058
405 Ga0501036_0159180 3300049572 Bacteria 1904
406 Ga0501036_0251229 3300049572 Unclassified 1482
407 Ga0501036_0510416 3300049572 Bacteria 1000
408 Ga0501036_0920035 3300049572 Unclassified 717
409 Ga0501037_0014381 3300049573 Bacteria 5825
410 Ga0501037_0055252 3300049573 Bacteria 2903
411 Ga0501037_0064551 3300049573 Bacteria 2668
412 Ga0501037_0175796 3300049573 Bacteria 1521
413 Ga0501037_0374388 3300049573 Bacteria 980
414 Ga0501037_0469333 3300049573 Unclassified 857
415 Ga0501038_0015192 3300049574 Bacteria 7002
416 Ga0501038_0025799 3300049574 Bacteria 5236
417 Ga0501038_0047611 3300049574 Bacteria 3713
418 Ga0501038_0214532 3300049574 Unclassified 1538
419 Ga0501038_0380352 3300049574 Bacteria 1095
420 Ga0501038_0439390 3300049574 Bacteria 1005
421 Ga0501038_0459201 3300049574 Bacteria 978
422 Ga0501039_0001267 3300049575 Bacteria 18469
423 Ga0501039_0023011 3300049575 Bacteria 4779
424 Ga0501039_0205437 3300049575 Bacteria 1549
425 Ga0501039_0206711 3300049575 Bacteria 1543
426 Ga0501040_0004638 3300049576 Bacteria 8918
427 Ga0501040_0009087 3300049576 Bacteria 6468
428 Ga0501040_0010745 3300049576 Bacteria 5986
429 Ga0501040_0017926 3300049576 Bacteria 4700
430 Ga0501040_0018997 3300049576 Bacteria 4568
431 Ga0501040_0019001 3300049576 Bacteria 4568
432 Ga0501040_0028378 3300049576 Bacteria 3772
433 Ga0501040_0054816 3300049576 Bacteria 2733
434 Ga0501040_0163336 3300049576 Bacteria 1575
435 Ga0501040_0383719 3300049576 Unclassified 1008
436 Ga0501041_0001640 3300049577 Bacteria 12508
437 Ga0501041_0003389 3300049577 Bacteria 9171
438 Ga0501041_0009927 3300049577 Bacteria 5607
439 Ga0501041_0032552 3300049577 Bacteria 3151
440 Ga0501041_0032878 3300049577 Unclassified 3135
441 Ga0501041_0052888 3300049577 Bacteria 2476
442 Ga0501041_0057781 3300049577 Bacteria 2373
443 Ga0501041_0460464 3300049577 Unclassified 808
444 Ga0501042_0004166 3300049578 Bacteria 9194
445 Ga0501042_0023793 3300049578 Bacteria 4290
446 Ga0501042_0047137 3300049578 Bacteria 3072
447 Ga0501042_0063627 3300049578 Bacteria 2636
448 Ga0501042_0071819 3300049578 Bacteria 2476
449 Ga0501042_0117208 3300049578 Bacteria 1917
450 Ga0501042_0217416 3300049578 Bacteria 1378
451 Ga0501042_0222912 3300049578 Bacteria 1360
452 Ga0501042_0502631 3300049578 Bacteria 880
453 Ga0501043_0010486 3300049579 Bacteria 7257
454 Ga0501043_0018367 3300049579 Bacteria 5483
455 Ga0501043_0026438 3300049579 Bacteria 4553
456 Ga0501043_0090925 3300049579 Bacteria 2400
457 Ga0501043_0177584 3300049579 Bacteria 1660
458 Ga0501043_0224792 3300049579 Bacteria 1451
459 Ga0501043_0413215 3300049579 Bacteria 1018
460 Ga0501046_0000122 3300049580 Bacteria 82617
461 Ga0501046_0008606 3300049580 Bacteria 8878
462 Ga0501046_0084135 3300049580 Bacteria 2454
463 Ga0501046_0172965 3300049580 Bacteria 1619
464 Ga0501046_0286577 3300049580 Unclassified 1205
465 Ga0501048_0004582 3300049582 Bacteria 10521
466 Ga0501048_0013844 3300049582 Bacteria 5983
467 Ga0501048_0034167 3300049582 Bacteria 3671
468 Ga0501048_0036409 3300049582 Bacteria 3537
469 Ga0501048_0048466 3300049582 Bacteria 3030
470 Ga0501048_0075289 3300049582 Bacteria 2381
471 Ga0501048_0075431 3300049582 Bacteria 2379
472 Ga0501048_0197481 3300049582 Bacteria 1426
473 Ga0501048_0286900 3300049582 Bacteria 1170
474 Ga0501048_0402135 3300049582 Bacteria 979
475 Ga0501067_0024495 3300049583 Bacteria 3347
476 Ga0501067_0033696 3300049583 Bacteria 2841
477 Ga0501067_0075672 3300049583 Unclassified 1865
478 Ga0501067_0110739 3300049583 Bacteria 1526
479 Ga0501068_0012575 3300049584 Bacteria 4802
480 Ga0501068_0042233 3300049584 Bacteria 2742
481 Ga0501068_0043349 3300049584 Bacteria 2706
482 Ga0501068_0076200 3300049584 Bacteria 2052
483 Ga0501068_0091688 3300049584 Bacteria 1875
484 Ga0501068_0197333 3300049584 Bacteria 1276
485 Ga0501068_0291290 3300049584 Bacteria 1044
486 Ga0501069_0026501 3300049585 Bacteria 3174
487 Ga0501069_0035471 3300049585 Bacteria 2749
488 Ga0501069_0040851 3300049585 Bacteria 2563
489 Ga0501069_0058046 3300049585 Bacteria 2158
490 Ga0501069_0117340 3300049585 Bacteria 1518
491 Ga0501069_0182773 3300049585 Bacteria 1212
492 Ga0501070_0005391 3300049586 Bacteria 10906
493 Ga0501070_0015181 3300049586 Bacteria 6483
494 Ga0501070_0025665 3300049586 Bacteria 4943
495 Ga0501070_0037359 3300049586 Bacteria 4055
496 Ga0501070_0108998 3300049586 Bacteria 2288
497 Ga0501070_0322079 3300049586 Unclassified 1257
498 Ga0501071_0001256 3300049587 Bacteria 14371
499 Ga0501071_0027643 3300049587 Bacteria 3992
500 Ga0501071_0029364 3300049587 Bacteria 3880
501 Ga0501071_0035200 3300049587 Bacteria 3566
502 Ga0501071_0047647 3300049587 Bacteria 3079
503 Ga0501071_0054999 3300049587 Bacteria 2872
504 Ga0501071_0067747 3300049587 Bacteria 2596
505 Ga0501071_0091792 3300049587 Bacteria 2231
506 Ga0501071_0161420 3300049587 Unclassified 1675
507 Ga0501071_0251953 3300049587 Bacteria 1333
508 Ga0501071_0379874 3300049587 Bacteria 1077
509 Ga0501072_0003792 3300049588 Bacteria 11410
510 Ga0501072_0009346 3300049588 Bacteria 7452
511 Ga0501072_0012610 3300049588 Bacteria 6461
512 Ga0501072_0022310 3300049588 Bacteria 4911
513 Ga0501072_0034426 3300049588 Bacteria 3970
514 Ga0501072_0087875 3300049588 Bacteria 2466
515 Ga0501072_0088211 3300049588 Bacteria 2461
516 Ga0501072_0132704 3300049588 Bacteria 1985
517 Ga0501072_0238376 3300049588 Bacteria 1448
518 Ga0501072_0247274 3300049588 Bacteria 1420
519 Ga0501072_0297278 3300049588 Bacteria 1283
520 Ga0501073_0008113 3300049589 Bacteria 7790
521 Ga0501073_0114426 3300049589 Bacteria 1870
522 Ga0501074_0014859 3300049590 Bacteria 5661
523 Ga0501074_0022359 3300049590 Bacteria 4593
524 Ga0501074_0105595 3300049590 Bacteria 2016
525 Ga0501074_0107354 3300049590 Bacteria 1999
526 Ga0501074_0132415 3300049590 Bacteria 1783
527 Ga0501074_0138161 3300049590 Bacteria 1743
528 Ga0501074_0178660 3300049590 Unclassified 1514
529 Ga0501074_0276565 3300049590 Bacteria 1194
530 Ga0501074_0414177 3300049590 Bacteria 956
531 Ga0501075_0004358 3300049591 Bacteria 9570
532 Ga0501075_0006497 3300049591 Bacteria 8051
533 Ga0501075_0009552 3300049591 Bacteria 6790
534 Ga0501075_0017824 3300049591 Bacteria 5129
535 Ga0501075_0024853 3300049591 Bacteria 4397
536 Ga0501075_0031794 3300049591 Bacteria 3920
537 Ga0501075_0035874 3300049591 Bacteria 3699
538 Ga0501075_0037435 3300049591 Bacteria 3625
539 Ga0501075_0105444 3300049591 Bacteria 2142
540 Ga0501075_0256194 3300049591 Bacteria 1333
541 Ga0501075_0257349 3300049591 Bacteria 1330
542 Ga0501075_0389379 3300049591 Bacteria 1062
543 Ga0501076_0002557 3300049592 Bacteria 12515
544 Ga0501076_0019245 3300049592 Bacteria 5215
545 Ga0501076_0031889 3300049592 Bacteria 4112
546 Ga0501076_0048610 3300049592 Bacteria 3352
547 Ga0501076_0053670 3300049592 Bacteria 3194
548 Ga0501076_0060351 3300049592 Bacteria 3017
549 Ga0501076_0130191 3300049592 Bacteria 2040
550 Ga0501076_0146017 3300049592 Bacteria 1923
551 Ga0501076_0172378 3300049592 Bacteria 1764
552 Ga0501076_0223629 3300049592 Unclassified 1538
553 Ga0501076_0371424 3300049592 Bacteria 1175
554 Ga0501076_0497280 3300049592 Bacteria 1005
555 Ga0501077_0002372 3300049593 Bacteria 11310
556 Ga0501077_0006113 3300049593 Bacteria 7352
557 Ga0501077_0014636 3300049593 Bacteria 4931
558 Ga0501077_0018438 3300049593 Bacteria 4416
559 Ga0501077_0020432 3300049593 Bacteria 4192
560 Ga0501077_0024546 3300049593 Bacteria 3829
561 Ga0501077_0026466 3300049593 Bacteria 3681
562 Ga0501077_0105461 3300049593 Bacteria 1786
563 Ga0501077_0249834 3300049593 Bacteria 1128
564 Ga0501077_0251812 3300049593 Bacteria 1123
565 Ga0501077_0271418 3300049593 Bacteria 1079
566 Ga0501079_0003376 3300049741 Bacteria 11711
567 Ga0501079_0011749 3300049741 Bacteria 6688
568 Ga0501079_0014336 3300049741 Bacteria 6043
569 Ga0501079_0014569 3300049741 Bacteria 5997
570 Ga0501079_0022803 3300049741 Bacteria 4805
571 Ga0501079_0043908 3300049741 Bacteria 3450
572 Ga0501079_0126780 3300049741 Bacteria 1986
573 Ga0501079_0305451 3300049741 Unclassified 1245
574 Ga0501079_0520266 3300049741 Unclassified 935
575 Ga0501079_0718339 3300049741 Bacteria 786
576 Ga0501080_0001820 3300049742 Bacteria 18281
577 Ga0501080_0018503 3300049742 Bacteria 6444
578 Ga0501080_0033905 3300049742 Bacteria 4766
579 Ga0501080_0077938 3300049742 Bacteria 3082
580 Ga0501080_0095701 3300049742 Unclassified 2757
581 Ga0501080_0203397 3300049742 Bacteria 1817
582 Ga0501081_0026060 3300049743 Bacteria 3939
583 Ga0501081_0043957 3300049743 Bacteria 3065
584 Ga0501081_0044839 3300049743 Unclassified 3036
585 Ga0501081_0051971 3300049743 Bacteria 2826
586 Ga0501081_0064426 3300049743 Bacteria 2545
587 Ga0501081_0162934 3300049743 Bacteria 1607
588 Ga0501081_0179853 3300049743 Bacteria 1530
589 Ga0501081_0212744 3300049743 Unclassified 1404
590 Ga0501081_0553134 3300049743 Bacteria 860
591 Ga0501083_0001412 3300049744 Bacteria 16364
592 Ga0501083_0009056 3300049744 Bacteria 7031
593 Ga0501083_0039260 3300049744 Bacteria 3215
594 Ga0501083_0056496 3300049744 Bacteria 2630
595 Ga0501083_0218050 3300049744 Bacteria 1243
596 Ga0501083_0231143 3300049744 Bacteria 1204
597 Ga0501035_0015492 3300049822 Bacteria 7033
598 Ga0501035_0048322 3300049822 Bacteria 3816
599 Ga0501035_0065121 3300049822 Bacteria 3237
600 Ga0501035_0119193 3300049822 Bacteria 2308
601 Ga0501035_0278049 3300049822 Bacteria 1416
602 Ga0501035_0300042 3300049822 Bacteria 1354
603 Ga0501035_0369229 3300049822 Bacteria 1198
604 Ga0501044_0008263 3300049823 Bacteria 11414
605 Ga0501044_0042191 3300049823 Bacteria 4747
606 Ga0501044_0077387 3300049823 Bacteria 3374
607 Ga0501045_0003659 3300049824 Bacteria 10570
608 Ga0501045_0008863 3300049824 Bacteria 7023
609 Ga0501045_0014960 3300049824 Bacteria 5506
610 Ga0501045_0024498 3300049824 Bacteria 4333
611 Ga0501045_0161245 3300049824 Bacteria 1669
612 Ga0501045_0194509 3300049824 Bacteria 1511
613 nmdc:mga0yw44_258940_c1 3300050492 Unclassified 1159
614 nmdc:mga0yw44_274059_c1 3300050492 Bacteria 1127
615 nmdc:mga05p37_120271_c1 3300050507 Bacteria 3226
616 nmdc:mga05p37_62787_c1 3300050507 Bacteria 4572
617 nmdc:mga05p37_8097_c1 3300050507 Bacteria 12423
618 nmdc:mga05p37_984270_c1 3300050507 Bacteria 898
619 nmdc:mga09592_6854_c1 3300050508 Bacteria 9274
620 nmdc:mga06r32_81072_c1 3300050510 Bacteria 3160
621 nmdc:mga08y16_123837_c1 3300050511 Bacteria 2690
622 nmdc:mga08y16_21674_c1 3300050511 Bacteria 6783
623 nmdc:mga08y16_42813_c1 3300050511 Bacteria 4742
624 nmdc:mga08y16_62074_c1 3300050511 Bacteria 3903
625 nmdc:mga0n895_453610_c1 3300050512 Bacteria 1294
626 nmdc:mga0n895_52742_c1 3300050512 Bacteria 3993
627 nmdc:mga0n895_632370_c1 3300050512 Bacteria 1070
628 nmdc:mga0rr50_887482_c1 3300050513 Bacteria 760
629 nmdc:mga08x19_109315_c1 3300050514 Bacteria 1843
630 nmdc:mga0a205_221043_c1 3300050515 Bacteria 1779
631 nmdc:mga0a205_31476_c1 3300050515 Bacteria 5082
632 nmdc:mga0a205_417643_c1 3300050515 Bacteria 1204
633 nmdc:mga0a205_60127_c1 3300050515 Bacteria 3670
634 Ga0495612_0042904 3300053078 Bacteria 1847
635 Ga0501084_0009851 3300054114 Bacteria 7897
636 Ga0501084_0014778 3300054114 Bacteria 6473
637 Ga0501084_0037668 3300054114 Bacteria 4041
638 Ga0501084_0065694 3300054114 Bacteria 3036
639 Ga0501084_0111464 3300054114 Bacteria 2299
640 Ga0501084_0390790 3300054114 Bacteria 1175
641 Ga0501084_0474364 3300054114 Bacteria 1058
642 Ga0501082_0003561 3300060353 Bacteria 13596
643 Ga0501082_0004532 3300060353 Bacteria 12128
644 Ga0501082_0021034 3300060353 Bacteria 5627
645 Ga0501082_0025354 3300060353 Bacteria 5110
646 Ga0501082_0040343 3300060353 Bacteria 4027
647 Ga0501082_0056851 3300060353 Bacteria 3370
648 Ga0501082_0071864 3300060353 Bacteria 2980
649 Ga0501082_0185009 3300060353 Bacteria 1812
650 Ga0501082_0188425 3300060353 Bacteria 1795
651 Ga0501082_0300010 3300060353 Unclassified 1399
652 Ga0501082_0479662 3300060353 Bacteria 1087
653 Ga0530510_0014204 3300061734 Bacteria 5613
654 Ga0530510_0040064 3300061734 Bacteria 3381
655 Ga0530510_0048882 3300061734 Bacteria 3056
656 Ga0530510_0051003 3300061734 Unclassified 2989
657 Ga0530510_0056942 3300061734 Bacteria 2825
658 Ga0530510_0101445 3300061734 Bacteria 2104
659 Ga0530510_0169817 3300061734 Bacteria 1615
660 Ga0530510_0267180 3300061734 Bacteria 1276
661 JGI24738J21930_10004878
662 JGI25406J46586_10035795
663 Ga0070658_10020296
664 Ga0070676_10067812
665 Ga0070683_100010806
666 Ga0070683_100221932
667 Ga0070683_100349040
668 Ga0070683_100395924
669 Ga0070677_10031200
670 Ga0070666_10586246
671 Ga0070680_100025551
672 Ga0070680_100169506
673 Ga0070682_100003551
674 Ga0070682_100051165
675 Ga0070682_100076438
676 Ga0070682_100098769
677 Ga0068868_100536992
678 Ga0070660_100021121
679 Ga0070689_100017072
680 Ga0070691_10001184
681 Ga0070691_10081428
682 Ga0070687_100038390
683 Ga0070661_100074664
684 Ga0070661_100588036
685 Ga0070661_100751711
686 Ga0070692_10098980
687 Ga0070692_10153890
688 Ga0070675_100041952
689 Ga0070675_100346548
690 Ga0070674_100135323
691 Ga0070674_100322722
692 Ga0070673_100496039
693 Ga0070688_100043759
694 Ga0070688_100332783
695 Ga0070659_100004790
696 Ga0070659_100165323
697 Ga0070701_10011639
698 Ga0070705_100149592
699 Ga0070700_100106870
700 Ga0070694_100418630
701 Ga0070708_100213855
702 Ga0070708_100562798
703 Ga0070678_100166224
704 Ga0070678_100587572
705 Ga0070662_100078895
706 Ga0070681_10063717
707 Ga0070681_10080587
708 Ga0068867_100225710
709 Ga0068867_100285828
710 Ga0070685_10028696
711 Ga0070706_100993424
712 Ga0070698_100187221
713 Ga0070699_100052843
714 Ga0070699_100305519
715 Ga0070679_100052410
716 Ga0070679_100432292
717 Ga0070684_100074588
718 Ga0070684_100099106
719 Ga0070684_100163262
720 Ga0070684_100656600
721 Ga0070684_100874760
722 Ga0068853_100032064
723 Ga0068853_100422867
724 Ga0070672_100277957
725 Ga0070672_100557238
726 Ga0070686_100285544
727 Ga0070693_100099679
728 Ga0070665_100093217
729 Ga0070704_100063726
730 Ga0070704_100098994
731 Ga0070664_100130694
732 Ga0070664_100264686
733 Ga0070664_100405587
734 Ga0068857_100114534
735 Ga0068857_100145822
736 Ga0068854_100024362
737 Ga0068854_100073483
738 Ga0068854_100141080
739 Ga0068854_100270124
740 Ga0068856_100301741
741 Ga0070702_100006499
742 Ga0070702_100006838
743 Ga0068852_100002729
744 Ga0068852_100549500
745 Ga0068859_100033807
746 Ga0068859_100974025
747 Ga0068861_100346461
748 Ga0068851_10009412
749 Ga0068870_10005881
750 Ga0068870_10037588
751 Ga0068870_10074876
752 Ga0068863_100020946
753 Ga0068863_100226317
754 Ga0068858_100027009
755 Ga0068860_100172147
756 Ga0068860_100234522
757 Ga0068862_100272783
758 Ga0081455_10017529
759 Ga0081455_10134333
760 Ga0081455_10180983
761 Ga0081455_10252859
762 Ga0081539_10006369
763 Ga0075364_10428151
764 Ga0075432_10014112
765 Ga0075367_10215011
766 Ga0097621_100087668
767 Ga0068871_100104875
768 Ga0068871_100559442
769 Ga0075428_100031741
770 Ga0075428_100143111
771 Ga0075428_100198138
772 Ga0075430_100034498
773 Ga0075431_100102283
774 Ga0075431_100310615
775 Ga0075433_10137758
776 Ga0075433_10236638
777 Ga0075433_10265993
778 Ga0075433_10374598
779 Ga0075434_100733000
780 Ga0075429_100049911
781 Ga0075429_100053133
782 Ga0075429_100336623
783 Ga0068865_100066771
784 Ga0068865_100086537
785 Ga0068865_100170614
786 Ga0068865_100298754
787 Ga0075436_100018683
788 Ga0097620_100033805
789 Ga0097620_100974217
790 Ga0111539_10016729
791 Ga0111539_10026695
792 Ga0111539_10437282
793 Ga0111539_11111433
794 Ga0105245_10082250
795 Ga0105245_10183917
796 Ga0105245_10266119
797 Ga0105247_10313687
798 Ga0114129_10016628
799 Ga0114129_10251482
800 Ga0114129_10309027
801 Ga0114129_10569440
802 Ga0105243_10010878
803 Ga0105243_10019884
804 Ga0105243_10035385
805 Ga0105243_10168419
806 Ga0105243_10237624
807 Ga0105241_10090193
808 Ga0105242_10041185
809 Ga0105242_10119140
810 Ga0105242_10983310
811 Ga0105248_10243054
812 Ga0105248_10696690
813 Ga0105237_10534875
814 Ga0105238_10056633
815 Ga0105249_10071606
816 Ga0105249_10766978
817 Ga0105239_10087701
818 Ga0105239_10206708
819 Ga0105246_10161852
820 Ga0105246_10181732
821 Ga0105246_10207634
822 Ga0105246_10234917
823 Ga0105246_10292098
824 Ga0105246_10368420
825 Ga0105246_10610556
826 Ga0105246_10654858
827 Ga0157371_10018177
828 Ga0157371_10098404
829 Ga0157369_10236196
830 Ga0157374_10267946
831 Ga0163162_10068235
832 Ga0157372_10015689
833 Ga0157372_10106559
834 Ga0157372_10395367
835 Ga0157372_11416316
836 Ga0157375_10059062
837 Ga0157375_10551011
838 Ga0163163_10235048
839 Ga0163163_10795243
840 Ga0157380_10027642
841 Ga0157380_10250498
842 Ga0157380_10260966
843 Ga0157380_10749262
844 Ga0157377_10001619
845 Ga0157377_10013898
846 Ga0157377_10098622
847 Ga0157377_10127607
848 Ga0157377_10144776
849 Ga0157377_10327457
850 Ga0157379_10012042
851 Ga0157379_10065994
852 Ga0157376_10147692
853 Ga0157376_10391470
854 Ga0163161_10158325
855 Ga0163161_10357551
856 Ga0163161_10731064
857 Ga0206356_10619810
858 Ga0224712_10061860
859 Ga0207653_10151671
860 Ga0207682_10043194
861 Ga0207688_10004673
862 Ga0207688_10025237
863 Ga0207688_10085097
864 Ga0207645_10082943
865 Ga0207643_10143180
866 Ga0207705_10341686
867 Ga0207684_10539132
868 Ga0207654_10045805
869 Ga0207707_10209715
870 Ga0207660_10054412
871 Ga0207660_10130660
872 Ga0207662_10356788
873 Ga0207657_10008194
874 Ga0207657_10078670
875 Ga0207649_10032335
876 Ga0207649_10052952
877 Ga0207652_10224380
878 Ga0207652_10431279
879 Ga0207681_10173750
880 Ga0207650_10019951
881 Ga0207650_10067936
882 Ga0207659_10007680
883 Ga0207659_10028465
884 Ga0207687_10079402
885 Ga0207687_10114127
886 Ga0207687_10281813
887 Ga0207690_10034834
888 Ga0207690_10529191
889 Ga0207706_10059369
890 Ga0207706_10059783
891 Ga0207706_10387748
892 Ga0207686_10014049
893 Ga0207709_10033670
894 Ga0207709_10355723
895 Ga0207709_10374706
896 Ga0207670_10046961
897 Ga0207669_10125304
898 Ga0207704_10141814
899 Ga0207704_10357218
900 Ga0207691_10036874
901 Ga0207691_10039916
902 Ga0207711_10100442
903 Ga0207689_10031514
904 Ga0207689_10239489
905 Ga0207661_10019376
906 Ga0207661_10118924
907 Ga0207661_10183494
908 Ga0207661_10449804
909 Ga0207679_10022903
910 Ga0207679_10111935
911 Ga0207651_10843673
912 Ga0207668_10668306
913 Ga0207640_10009620
914 Ga0207640_10287561
915 Ga0207658_10383170
916 Ga0207677_10109458
917 Ga0207677_10124811
918 Ga0207677_10435254
919 Ga0207677_10595508
920 Ga0207703_10529504
921 Ga0207639_10114078
922 Ga0207639_10337911
923 Ga0207678_10149407
924 Ga0207678_10177068
925 Ga0207678_10357190
926 Ga0207708_10030221
927 Ga0207708_10124855
928 Ga0207708_10512415
929 Ga0207702_10093017
930 Ga0207702_10344518
931 Ga0207641_10420412
932 Ga0207641_10702885
933 Ga0207648_10013335
934 Ga0207648_10043300
935 Ga0207648_10253266
936 Ga0207648_10264428
937 Ga0207648_10284569
938 Ga0207676_10039555
939 Ga0207674_10063058
940 Ga0207674_10164008
941 Ga0207675_100093758
942 Ga0207675_100420497
943 Ga0207675_100645049
944 Ga0207683_10017642
945 Ga0207683_10060770
946 Ga0207683_10088560
947 Ga0207683_10101842
948 Ga0207683_10715337
949 Ga0207698_10019214
950 Ga0207698_10271452
951 Ga0207698_10386309
952 Ga0207698_10522068
953 Ga0207428_10009174
954 Ga0207428_10015782
955 Ga0207428_10051632
956 Ga0207428_10130303
957 Ga0268265_10392826
958 Ga0307408_100155576
959 Ga0307413_10351487
960 Ga0307406_10628544
961 Ga0307409_100093669
962 Ga0307416_100378744
963 Ga0307415_100136688
964 Ga0373942_0019523
965 Ga0373962_0008175
966 Ga0373962_0033937
967 Ga0373931_0364399
968 Ga0395900_0098422
969 Ga0395898_0475963
970 Ga0395901_0004367
971 Ga0439436_0026675
972 Ga0439439_0000575
973 Ga0451798_0937553
974 Ga0451853_2954668
975 Ga0439433_0018740
976 Ga0439442_018559
977 Ga0439445_0066601
978 Ga0439449_0077256
979 Ga0439457_040352
980 Ga0439462_0005622
981 Ga0439463_079597
982 Ga0450920_017093
983 Ga0450906_030573
984 Ga0439446_0000832
985 Ga0439446_0007119
986 Ga0439446_0076530
987 Ga0450908_010949
988 Ga0439434_0007170
989 Ga0439434_0011940
990 Ga0439459_0058840
991 Ga0450918_006012
992 Ga0495603_0018393
993 Ga0495641_0106849
994 Ga0495651_0399530
995 Ga0495605_0106960
996 Ga0495584_0122043
997 Ga0495596_0033470
998 Ga0495644_0063197
999 Ga0495644_0135021
1000 Ga0495663_0190098
1001 Ga0495667_0217177
1002 Ga0495634_0144340
1003 Ga0495670_0156350
1004 Ga0495589_0151816
1005 Ga0495600_0187518
1006 Ga0495674_0117666
1007 Ga0496100_0235862
1008 Ga0496100_0650332
1009 Ga0496101_0264616
1010 Ga0496101_0821529
1011 Ga0496101_0906263
1012 Ga0496103_0253774
1013 Ga0496104_0098299
1014 Ga0496104_0175237
1015 Ga0496104_0204351
1016 Ga0496105_0366616
1017 Ga0496105_0575407
1018 Ga0496106_0239662
1019 Ga0496106_0319991
1020 Ga0496107_0171904
1021 Ga0496107_0235755
1022 Ga0496107_0749389
1023 Ga0496108_0222591
1024 Ga0496108_0299224
1025 Ga0496108_0608698
1026 Ga0496109_0014515
1027 Ga0496109_0227297
1028 Ga0496110_0001012
1029 Ga0496110_0040698
1030 Ga0496110_0049155
1031 Ga0496110_0091556
1032 Ga0496111_0016754
1033 Ga0496111_0107527
1034 Ga0496111_0241533
1035 Ga0496111_0290862
1036 Ga0496112_0052526
1037 Ga0496112_0358369
1038 Ga0496113_0250372
1039 Ga0496114_0031231
1040 Ga0496115_0483637
1041 Ga0501031_0000606
1042 Ga0501031_0007909
1043 Ga0501031_0035463
1044 Ga0501031_0042082
1045 Ga0501031_0087817
1046 Ga0501031_0134000
1047 Ga0501031_0258020
1048 Ga0501032_0025958
1049 Ga0501032_0033124
1050 Ga0501032_0405092
1051 Ga0501033_0006070
1052 Ga0501033_0008450
1053 Ga0501033_0058623
1054 Ga0501033_0103002
1055 Ga0501033_0231941
1056 Ga0501033_0487070
1057 Ga0501034_0336113
1058 Ga0501036_0001341
1059 Ga0501036_0006649
1060 Ga0501036_0012707
1061 Ga0501036_0055348
1062 Ga0501036_0078331
1063 Ga0501036_0102127
1064 Ga0501036_0137938
1065 Ga0501036_0159180
1066 Ga0501036_0251229
1067 Ga0501036_0510416
1068 Ga0501036_0920035
1069 Ga0501037_0014381
1070 Ga0501037_0055252
1071 Ga0501037_0064551
1072 Ga0501037_0175796
1073 Ga0501037_0374388
1074 Ga0501037_0469333
1075 Ga0501038_0015192
1076 Ga0501038_0025799
1077 Ga0501038_0047611
1078 Ga0501038_0214532
1079 Ga0501038_0380352
1080 Ga0501038_0439390
1081 Ga0501038_0459201
1082 Ga0501039_0001267
1083 Ga0501039_0023011
1084 Ga0501039_0205437
1085 Ga0501039_0206711
1086 Ga0501040_0004638
1087 Ga0501040_0009087
1088 Ga0501040_0010745
1089 Ga0501040_0017926
1090 Ga0501040_0018997
1091 Ga0501040_0019001
1092 Ga0501040_0028378
1093 Ga0501040_0054816
1094 Ga0501040_0163336
1095 Ga0501040_0383719
1096 Ga0501041_0001640
1097 Ga0501041_0003389
1098 Ga0501041_0009927
1099 Ga0501041_0032552
1100 Ga0501041_0032878
1101 Ga0501041_0052888
1102 Ga0501041_0057781
1103 Ga0501041_0460464
1104 Ga0501042_0004166
1105 Ga0501042_0023793
1106 Ga0501042_0047137
1107 Ga0501042_0063627
1108 Ga0501042_0071819
1109 Ga0501042_0117208
1110 Ga0501042_0217416
1111 Ga0501042_0222912
1112 Ga0501042_0502631
1113 Ga0501043_0010486
1114 Ga0501043_0018367
1115 Ga0501043_0026438
1116 Ga0501043_0090925
1117 Ga0501043_0177584
1118 Ga0501043_0224792
1119 Ga0501043_0413215
1120 Ga0501046_0000122
1121 Ga0501046_0008606
1122 Ga0501046_0084135
1123 Ga0501046_0172965
1124 Ga0501046_0286577
1125 Ga0501048_0004582
1126 Ga0501048_0013844
1127 Ga0501048_0034167
1128 Ga0501048_0036409
1129 Ga0501048_0048466
1130 Ga0501048_0075289
1131 Ga0501048_0075431
1132 Ga0501048_0197481
1133 Ga0501048_0286900
1134 Ga0501048_0402135
1135 Ga0501067_0024495
1136 Ga0501067_0033696
1137 Ga0501067_0075672
1138 Ga0501067_0110739
1139 Ga0501068_0012575
1140 Ga0501068_0042233
1141 Ga0501068_0043349
1142 Ga0501068_0076200
1143 Ga0501068_0091688
1144 Ga0501068_0197333
1145 Ga0501068_0291290
1146 Ga0501069_0026501
1147 Ga0501069_0035471
1148 Ga0501069_0040851
1149 Ga0501069_0058046
1150 Ga0501069_0117340
1151 Ga0501069_0182773
1152 Ga0501070_0005391
1153 Ga0501070_0015181
1154 Ga0501070_0025665
1155 Ga0501070_0037359
1156 Ga0501070_0108998
1157 Ga0501070_0322079
1158 Ga0501071_0001256
1159 Ga0501071_0027643
1160 Ga0501071_0029364
1161 Ga0501071_0035200
1162 Ga0501071_0047647
1163 Ga0501071_0054999
1164 Ga0501071_0067747
1165 Ga0501071_0091792
1166 Ga0501071_0161420
1167 Ga0501071_0251953
1168 Ga0501071_0379874
1169 Ga0501072_0003792
1170 Ga0501072_0009346
1171 Ga0501072_0012610
1172 Ga0501072_0022310
1173 Ga0501072_0034426
1174 Ga0501072_0087875
1175 Ga0501072_0088211
1176 Ga0501072_0132704
1177 Ga0501072_0238376
1178 Ga0501072_0247274
1179 Ga0501072_0297278
1180 Ga0501073_0008113
1181 Ga0501073_0114426
1182 Ga0501074_0014859
1183 Ga0501074_0022359
1184 Ga0501074_0105595
1185 Ga0501074_0107354
1186 Ga0501074_0132415
1187 Ga0501074_0138161
1188 Ga0501074_0178660
1189 Ga0501074_0276565
1190 Ga0501074_0414177
1191 Ga0501075_0004358
1192 Ga0501075_0006497
1193 Ga0501075_0009552
1194 Ga0501075_0017824
1195 Ga0501075_0024853
1196 Ga0501075_0031794
1197 Ga0501075_0035874
1198 Ga0501075_0037435
1199 Ga0501075_0105444
1200 Ga0501075_0256194
1201 Ga0501075_0257349
1202 Ga0501075_0389379
1203 Ga0501076_0002557
1204 Ga0501076_0019245
1205 Ga0501076_0031889
1206 Ga0501076_0048610
1207 Ga0501076_0053670
1208 Ga0501076_0060351
1209 Ga0501076_0130191
1210 Ga0501076_0146017
1211 Ga0501076_0172378
1212 Ga0501076_0223629
1213 Ga0501076_0371424
1214 Ga0501076_0497280
1215 Ga0501077_0002372
1216 Ga0501077_0006113
1217 Ga0501077_0014636
1218 Ga0501077_0018438
1219 Ga0501077_0020432
1220 Ga0501077_0024546
1221 Ga0501077_0026466
1222 Ga0501077_0105461
1223 Ga0501077_0249834
1224 Ga0501077_0251812
1225 Ga0501077_0271418
1226 Ga0501079_0003376
1227 Ga0501079_0011749
1228 Ga0501079_0014336
1229 Ga0501079_0014569
1230 Ga0501079_0022803
1231 Ga0501079_0043908
1232 Ga0501079_0126780
1233 Ga0501079_0305451
1234 Ga0501079_0520266
1235 Ga0501079_0718339
1236 Ga0501080_0001820
1237 Ga0501080_0018503
1238 Ga0501080_0033905
1239 Ga0501080_0077938
1240 Ga0501080_0095701
1241 Ga0501080_0203397
1242 Ga0501081_0026060
1243 Ga0501081_0043957
1244 Ga0501081_0044839
1245 Ga0501081_0051971
1246 Ga0501081_0064426
1247 Ga0501081_0162934
1248 Ga0501081_0179853
1249 Ga0501081_0212744
1250 Ga0501081_0553134
1251 Ga0501083_0001412
1252 Ga0501083_0009056
1253 Ga0501083_0039260
1254 Ga0501083_0056496
1255 Ga0501083_0218050
1256 Ga0501083_0231143
1257 Ga0501035_0015492
1258 Ga0501035_0048322
1259 Ga0501035_0065121
1260 Ga0501035_0119193
1261 Ga0501035_0278049
1262 Ga0501035_0300042
1263 Ga0501035_0369229
1264 Ga0501044_0008263
1265 Ga0501044_0042191
1266 Ga0501044_0077387
1267 Ga0501045_0003659
1268 Ga0501045_0008863
1269 Ga0501045_0014960
1270 Ga0501045_0024498
1271 Ga0501045_0161245
1272 Ga0501045_0194509
1273 nmdc:mga0yw44_258940_c1
1274 nmdc:mga0yw44_274059_c1
1275 nmdc:mga05p37_120271_c1
1276 nmdc:mga05p37_62787_c1
1277 nmdc:mga05p37_8097_c1
1278 nmdc:mga05p37_984270_c1
1279 nmdc:mga09592_6854_c1
1280 nmdc:mga06r32_81072_c1
1281 nmdc:mga08y16_123837_c1
1282 nmdc:mga08y16_21674_c1
1283 nmdc:mga08y16_42813_c1
1284 nmdc:mga08y16_62074_c1
1285 nmdc:mga0n895_453610_c1
1286 nmdc:mga0n895_52742_c1
1287 nmdc:mga0n895_632370_c1
1288 nmdc:mga0rr50_887482_c1
1289 nmdc:mga08x19_109315_c1
1290 nmdc:mga0a205_221043_c1
1291 nmdc:mga0a205_31476_c1
1292 nmdc:mga0a205_417643_c1
1293 nmdc:mga0a205_60127_c1
1294 Ga0495612_0042904
1295 Ga0501084_0009851
1296 Ga0501084_0014778
1297 Ga0501084_0037668
1298 Ga0501084_0065694
1299 Ga0501084_0111464
1300 Ga0501084_0390790
1301 Ga0501084_0474364
1302 Ga0501082_0003561
1303 Ga0501082_0004532
1304 Ga0501082_0021034
1305 Ga0501082_0025354
1306 Ga0501082_0040343
1307 Ga0501082_0056851
1308 Ga0501082_0071864
1309 Ga0501082_0185009
1310 Ga0501082_0188425
1311 Ga0501082_0300010
1312 Ga0501082_0479662
1313 Ga0530510_0014204
1314 Ga0530510_0040064
1315 Ga0530510_0048882
1316 Ga0530510_0051003
1317 Ga0530510_0056942
1318 Ga0530510_0101445
1319 Ga0530510_0169817
1320 Ga0530510_0267180

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

22

84

0.98

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

42

75

0.94

PF07729

FCD

FCD domain

94

214

0.93

PF09339

HTH_IclR

IclR helix-turn-helix domain

33

77

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kvr-assembly1.cif.gz_A-2 x-ray crystal structure of a fragment (1-75) of a transcriptional regulator pdhr from escherichia coli cft073 0.9175 22 84
4r1h-assembly1.cif.gz_B gntr family transcriptional regulator from listeria monocytogenes 0.8853 22 84
7b5y-assembly1.cif.gz_D s. agalactiae busr in complex with its busab-promotor dna 0.8769 23 84
4tv7-assembly2.cif.gz_D crystal structure of bacillus subtilis gabr at 2.05 angstroms resolution 0.8734 22 86
4tv7-assembly1.cif.gz_A crystal structure of bacillus subtilis gabr at 2.05 angstroms resolution 0.8685 22 86
ID Description Score Start End Superfamily
3sxyB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9689 24 84 1.10.10.10
af_P0ACM2_11_76_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9536 22 84 1.10.10.10
af_Q79G00_16_82_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9476 19 83 1.10.10.10
2hs5A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9446 21 84 1.10.10.10
af_P31460_2_70_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9194 21 85 1.10.10.10
ID Description Score Start End GO Terms
AF-G9ZWH5-F1-model_v4 Transcriptional regulator, GntR family 0.918 22 223 GO:0003677
GO:0003700
AF-A0A0J6D2I6-F1-model_v4 HTH gntR-type domain-containing protein 0.9068 23 217 GO:0003677
GO:0003700
AF-A0A0M7A050-F1-model_v4 Carbon starvation induced regulator 0.9053 23 223 GO:0003677
GO:0003700
AF-A0A2N3ANR7-F1-model_v4 GntR family transcriptional regulator 0.9051 14 223 GO:0003677
GO:0003700
AF-A0A4R4RQ10-F1-model_v4 GntR family transcriptional regulator 0.9044 22 219 GO:0003677
GO:0003700

Map