F473300
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 660 | 252 | 1320 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300002075|JGI24738J21930_10004878|JGI24738J21930_100048784 |
| Length | 230 |
| Sequence | VAREAVSCYISPMTILAPRANLNDQVYATLRERILTRDPGPGAKLSLHELAAXLGVSRSPVHHALTRLVSEGLLSVKARRGYFVTPVTSQALLEGYEVRLALELHAADVAVDTASDEQVTDLRRRHIATVEAISXEEWDAANASFHEAQVDLAGNKLLSRFYRELSINLMMQVIRGGRVERHEHLVTEHEAIVSGFETRDRAVARAAITRHVESGRRIALEAVERAGGAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 61 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 151 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 152 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 153 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 154 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 155 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 157 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 158 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 159 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 160 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 161 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 162 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 163 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 164 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 165 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 166 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 167 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 168 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 169 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 170 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 171 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 172 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 173 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 174 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 175 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 176 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 177 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 178 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 179 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 196 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 197 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 198 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 199 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 200 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 203 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 204 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 205 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 206 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 207 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 208 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 241 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.61 |
| Nodule | 0 |
| Rhizoplane | 5.3 |
| Rhizosphere | 93.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10004878 | 3300002075 | Bacteria | 3256 |
| 2 | JGI25406J46586_10035795 | 3300003203 | Bacteria | 1809 |
| 3 | Ga0070658_10020296 | 3300005327 | Bacteria | 5324 |
| 4 | Ga0070676_10067812 | 3300005328 | Bacteria | 2134 |
| 5 | Ga0070683_100010806 | 3300005329 | Bacteria | 7857 |
| 6 | Ga0070683_100221932 | 3300005329 | Bacteria | 1796 |
| 7 | Ga0070683_100349040 | 3300005329 | Bacteria | 1409 |
| 8 | Ga0070683_100395924 | 3300005329 | Bacteria | 1317 |
| 9 | Ga0070677_10031200 | 3300005333 | Bacteria | 2035 |
| 10 | Ga0070666_10586246 | 3300005335 | Bacteria | 813 |
| 11 | Ga0070680_100025551 | 3300005336 | Bacteria | 4721 |
| 12 | Ga0070680_100169506 | 3300005336 | Bacteria | 1836 |
| 13 | Ga0070682_100003551 | 3300005337 | Bacteria | 8630 |
| 14 | Ga0070682_100051165 | 3300005337 | Bacteria | 2581 |
| 15 | Ga0070682_100076438 | 3300005337 | Bacteria | 2155 |
| 16 | Ga0070682_100098769 | 3300005337 | Bacteria | 1924 |
| 17 | Ga0068868_100536992 | 3300005338 | Bacteria | 1029 |
| 18 | Ga0070660_100021121 | 3300005339 | Bacteria | 4796 |
| 19 | Ga0070689_100017072 | 3300005340 | Bacteria | 5324 |
| 20 | Ga0070691_10001184 | 3300005341 | Bacteria | 10931 |
| 21 | Ga0070691_10081428 | 3300005341 | Bacteria | 1586 |
| 22 | Ga0070687_100038390 | 3300005343 | Bacteria | 2400 |
| 23 | Ga0070661_100074664 | 3300005344 | Bacteria | 2497 |
| 24 | Ga0070661_100588036 | 3300005344 | Unclassified | 899 |
| 25 | Ga0070661_100751711 | 3300005344 | Bacteria | 797 |
| 26 | Ga0070692_10098980 | 3300005345 | Bacteria | 1596 |
| 27 | Ga0070692_10153890 | 3300005345 | Unclassified | 1312 |
| 28 | Ga0070675_100041952 | 3300005354 | Bacteria | 3738 |
| 29 | Ga0070675_100346548 | 3300005354 | Bacteria | 1317 |
| 30 | Ga0070674_100135323 | 3300005356 | Bacteria | 1842 |
| 31 | Ga0070674_100322722 | 3300005356 | Bacteria | 1238 |
| 32 | Ga0070673_100496039 | 3300005364 | Unclassified | 1104 |
| 33 | Ga0070688_100043759 | 3300005365 | Bacteria | 2760 |
| 34 | Ga0070688_100332783 | 3300005365 | Bacteria | 1107 |
| 35 | Ga0070659_100004790 | 3300005366 | Bacteria | 9673 |
| 36 | Ga0070659_100165323 | 3300005366 | Bacteria | 1810 |
| 37 | Ga0070701_10011639 | 3300005438 | Bacteria | 3942 |
| 38 | Ga0070705_100149592 | 3300005440 | Bacteria | 1547 |
| 39 | Ga0070700_100106870 | 3300005441 | Bacteria | 1853 |
| 40 | Ga0070694_100418630 | 3300005444 | Unclassified | 1052 |
| 41 | Ga0070708_100213855 | 3300005445 | Bacteria | 1807 |
| 42 | Ga0070708_100562798 | 3300005445 | Bacteria | 1075 |
| 43 | Ga0070678_100166224 | 3300005456 | Bacteria | 1792 |
| 44 | Ga0070678_100587572 | 3300005456 | Bacteria | 993 |
| 45 | Ga0070662_100078895 | 3300005457 | Bacteria | 2447 |
| 46 | Ga0070681_10063717 | 3300005458 | Bacteria | 3658 |
| 47 | Ga0070681_10080587 | 3300005458 | Bacteria | 3211 |
| 48 | Ga0068867_100225710 | 3300005459 | Bacteria | 1511 |
| 49 | Ga0068867_100285828 | 3300005459 | Bacteria | 1354 |
| 50 | Ga0070685_10028696 | 3300005466 | Bacteria | 3086 |
| 51 | Ga0070706_100993424 | 3300005467 | Bacteria | 774 |
| 52 | Ga0070698_100187221 | 3300005471 | Bacteria | 2008 |
| 53 | Ga0070699_100052843 | 3300005518 | Bacteria | 3515 |
| 54 | Ga0070699_100305519 | 3300005518 | Bacteria | 1427 |
| 55 | Ga0070679_100052410 | 3300005530 | Bacteria | 4064 |
| 56 | Ga0070679_100432292 | 3300005530 | Bacteria | 1261 |
| 57 | Ga0070684_100074588 | 3300005535 | Bacteria | 2990 |
| 58 | Ga0070684_100099106 | 3300005535 | Bacteria | 2600 |
| 59 | Ga0070684_100163262 | 3300005535 | Bacteria | 2021 |
| 60 | Ga0070684_100656600 | 3300005535 | Bacteria | 976 |
| 61 | Ga0070684_100874760 | 3300005535 | Bacteria | 841 |
| 62 | Ga0068853_100032064 | 3300005539 | Bacteria | 4449 |
| 63 | Ga0068853_100422867 | 3300005539 | Bacteria | 1249 |
| 64 | Ga0070672_100277957 | 3300005543 | Bacteria | 1415 |
| 65 | Ga0070672_100557238 | 3300005543 | Bacteria | 995 |
| 66 | Ga0070686_100285544 | 3300005544 | Bacteria | 1219 |
| 67 | Ga0070693_100099679 | 3300005547 | Bacteria | 1767 |
| 68 | Ga0070665_100093217 | 3300005548 | Bacteria | 3016 |
| 69 | Ga0070704_100063726 | 3300005549 | Bacteria | 2646 |
| 70 | Ga0070704_100098994 | 3300005549 | Bacteria | 2192 |
| 71 | Ga0070664_100130694 | 3300005564 | Unclassified | 2205 |
| 72 | Ga0070664_100264686 | 3300005564 | Bacteria | 1547 |
| 73 | Ga0070664_100405587 | 3300005564 | Bacteria | 1247 |
| 74 | Ga0068857_100114534 | 3300005577 | Bacteria | 2425 |
| 75 | Ga0068857_100145822 | 3300005577 | Bacteria | 2142 |
| 76 | Ga0068854_100024362 | 3300005578 | Bacteria | 4143 |
| 77 | Ga0068854_100073483 | 3300005578 | Bacteria | 2506 |
| 78 | Ga0068854_100141080 | 3300005578 | Bacteria | 1849 |
| 79 | Ga0068854_100270124 | 3300005578 | Bacteria | 1365 |
| 80 | Ga0068856_100301741 | 3300005614 | Bacteria | 1619 |
| 81 | Ga0070702_100006499 | 3300005615 | Bacteria | 5540 |
| 82 | Ga0070702_100006838 | 3300005615 | Bacteria | 5426 |
| 83 | Ga0068852_100002729 | 3300005616 | Bacteria | 12211 |
| 84 | Ga0068852_100549500 | 3300005616 | Bacteria | 1155 |
| 85 | Ga0068859_100033807 | 3300005617 | Bacteria | 5133 |
| 86 | Ga0068859_100974025 | 3300005617 | Bacteria | 931 |
| 87 | Ga0068861_100346461 | 3300005719 | Bacteria | 1301 |
| 88 | Ga0068851_10009412 | 3300005834 | Bacteria | 4543 |
| 89 | Ga0068870_10005881 | 3300005840 | Bacteria | 5387 |
| 90 | Ga0068870_10037588 | 3300005840 | Bacteria | 2496 |
| 91 | Ga0068870_10074876 | 3300005840 | Bacteria | 1856 |
| 92 | Ga0068863_100020946 | 3300005841 | Bacteria | 6244 |
| 93 | Ga0068863_100226317 | 3300005841 | Unclassified | 1803 |
| 94 | Ga0068858_100027009 | 3300005842 | Bacteria | 5332 |
| 95 | Ga0068860_100172147 | 3300005843 | Bacteria | 2091 |
| 96 | Ga0068860_100234522 | 3300005843 | Bacteria | 1784 |
| 97 | Ga0068862_100272783 | 3300005844 | Bacteria | 1548 |
| 98 | Ga0081455_10017529 | 3300005937 | Bacteria | 6861 |
| 99 | Ga0081455_10134333 | 3300005937 | Bacteria | 1930 |
| 100 | Ga0081455_10180983 | 3300005937 | Bacteria | 1596 |
| 101 | Ga0081455_10252859 | 3300005937 | Bacteria | 1288 |
| 102 | Ga0081539_10006369 | 3300005985 | Bacteria | 11359 |
| 103 | Ga0075364_10428151 | 3300006051 | Bacteria | 904 |
| 104 | Ga0075432_10014112 | 3300006058 | Bacteria | 2720 |
| 105 | Ga0075367_10215011 | 3300006178 | Bacteria | 1202 |
| 106 | Ga0097621_100087668 | 3300006237 | Bacteria | 2599 |
| 107 | Ga0068871_100104875 | 3300006358 | Bacteria | 2371 |
| 108 | Ga0068871_100559442 | 3300006358 | Bacteria | 1037 |
| 109 | Ga0075428_100031741 | 3300006844 | Bacteria | 5835 |
| 110 | Ga0075428_100143111 | 3300006844 | Bacteria | 2599 |
| 111 | Ga0075428_100198138 | 3300006844 | Bacteria | 2172 |
| 112 | Ga0075430_100034498 | 3300006846 | Bacteria | 4294 |
| 113 | Ga0075431_100102283 | 3300006847 | Bacteria | 2957 |
| 114 | Ga0075431_100310615 | 3300006847 | Bacteria | 1591 |
| 115 | Ga0075433_10137758 | 3300006852 | Bacteria | 2169 |
| 116 | Ga0075433_10236638 | 3300006852 | Bacteria | 1621 |
| 117 | Ga0075433_10265993 | 3300006852 | Bacteria | 1520 |
| 118 | Ga0075433_10374598 | 3300006852 | Bacteria | 1257 |
| 119 | Ga0075434_100733000 | 3300006871 | Bacteria | 1005 |
| 120 | Ga0075429_100049911 | 3300006880 | Bacteria | 3640 |
| 121 | Ga0075429_100053133 | 3300006880 | Bacteria | 3525 |
| 122 | Ga0075429_100336623 | 3300006880 | Bacteria | 1321 |
| 123 | Ga0068865_100066771 | 3300006881 | Bacteria | 2538 |
| 124 | Ga0068865_100086537 | 3300006881 | Bacteria | 2262 |
| 125 | Ga0068865_100170614 | 3300006881 | Bacteria | 1667 |
| 126 | Ga0068865_100298754 | 3300006881 | Bacteria | 1288 |
| 127 | Ga0075436_100018683 | 3300006914 | Bacteria | 4745 |
| 128 | Ga0097620_100033805 | 3300006931 | Bacteria | 5133 |
| 129 | Ga0097620_100974217 | 3300006931 | Bacteria | 931 |
| 130 | Ga0111539_10016729 | 3300009094 | Bacteria | 9088 |
| 131 | Ga0111539_10026695 | 3300009094 | Bacteria | 7057 |
| 132 | Ga0111539_10437282 | 3300009094 | Bacteria | 1523 |
| 133 | Ga0111539_11111433 | 3300009094 | Bacteria | 918 |
| 134 | Ga0105245_10082250 | 3300009098 | Bacteria | 2946 |
| 135 | Ga0105245_10183917 | 3300009098 | Bacteria | 1998 |
| 136 | Ga0105245_10266119 | 3300009098 | Bacteria | 1670 |
| 137 | Ga0105247_10313687 | 3300009101 | Bacteria | 1092 |
| 138 | Ga0114129_10016628 | 3300009147 | Bacteria | 10477 |
| 139 | Ga0114129_10251482 | 3300009147 | Bacteria | 2372 |
| 140 | Ga0114129_10309027 | 3300009147 | Bacteria | 2105 |
| 141 | Ga0114129_10569440 | 3300009147 | Bacteria | 1471 |
| 142 | Ga0105243_10010878 | 3300009148 | Bacteria | 6884 |
| 143 | Ga0105243_10019884 | 3300009148 | Bacteria | 5093 |
| 144 | Ga0105243_10035385 | 3300009148 | Bacteria | 3871 |
| 145 | Ga0105243_10168419 | 3300009148 | Bacteria | 1895 |
| 146 | Ga0105243_10237624 | 3300009148 | Bacteria | 1620 |
| 147 | Ga0105241_10090193 | 3300009174 | Bacteria | 2417 |
| 148 | Ga0105242_10041185 | 3300009176 | Bacteria | 3725 |
| 149 | Ga0105242_10119140 | 3300009176 | Bacteria | 2262 |
| 150 | Ga0105242_10983310 | 3300009176 | Unclassified | 850 |
| 151 | Ga0105248_10243054 | 3300009177 | Bacteria | 2026 |
| 152 | Ga0105248_10696690 | 3300009177 | Bacteria | 1146 |
| 153 | Ga0105237_10534875 | 3300009545 | Bacteria | 1179 |
| 154 | Ga0105238_10056633 | 3300009551 | Bacteria | 3932 |
| 155 | Ga0105249_10071606 | 3300009553 | Bacteria | 3203 |
| 156 | Ga0105249_10766978 | 3300009553 | Unclassified | 1027 |
| 157 | Ga0105239_10087701 | 3300010375 | Bacteria | 3430 |
| 158 | Ga0105239_10206708 | 3300010375 | Bacteria | 2200 |
| 159 | Ga0105246_10161852 | 3300011119 | Bacteria | 1705 |
| 160 | Ga0105246_10181732 | 3300011119 | Unclassified | 1620 |
| 161 | Ga0105246_10207634 | 3300011119 | Bacteria | 1527 |
| 162 | Ga0105246_10234917 | 3300011119 | Bacteria | 1446 |
| 163 | Ga0105246_10292098 | 3300011119 | Bacteria | 1312 |
| 164 | Ga0105246_10368420 | 3300011119 | Bacteria | 1183 |
| 165 | Ga0105246_10610556 | 3300011119 | Bacteria | 944 |
| 166 | Ga0105246_10654858 | 3300011119 | Unclassified | 915 |
| 167 | Ga0157371_10018177 | 3300013102 | Bacteria | 5206 |
| 168 | Ga0157371_10098404 | 3300013102 | Bacteria | 2074 |
| 169 | Ga0157369_10236196 | 3300013105 | Bacteria | 1910 |
| 170 | Ga0157374_10267946 | 3300013296 | Bacteria | 1684 |
| 171 | Ga0163162_10068235 | 3300013306 | Bacteria | 3607 |
| 172 | Ga0157372_10015689 | 3300013307 | Bacteria | 8124 |
| 173 | Ga0157372_10106559 | 3300013307 | Bacteria | 3206 |
| 174 | Ga0157372_10395367 | 3300013307 | Bacteria | 1611 |
| 175 | Ga0157372_11416316 | 3300013307 | Bacteria | 801 |
| 176 | Ga0157375_10059062 | 3300013308 | Bacteria | 3797 |
| 177 | Ga0157375_10551011 | 3300013308 | Bacteria | 1315 |
| 178 | Ga0163163_10235048 | 3300014325 | Bacteria | 1882 |
| 179 | Ga0163163_10795243 | 3300014325 | Bacteria | 1009 |
| 180 | Ga0157380_10027642 | 3300014326 | Bacteria | 4315 |
| 181 | Ga0157380_10250498 | 3300014326 | Bacteria | 1603 |
| 182 | Ga0157380_10260966 | 3300014326 | Unclassified | 1574 |
| 183 | Ga0157380_10749262 | 3300014326 | Bacteria | 988 |
| 184 | Ga0157377_10001619 | 3300014745 | Bacteria | 9818 |
| 185 | Ga0157377_10013898 | 3300014745 | Bacteria | 4085 |
| 186 | Ga0157377_10098622 | 3300014745 | Bacteria | 1737 |
| 187 | Ga0157377_10127607 | 3300014745 | Bacteria | 1549 |
| 188 | Ga0157377_10144776 | 3300014745 | Bacteria | 1464 |
| 189 | Ga0157377_10327457 | 3300014745 | Bacteria | 1020 |
| 190 | Ga0157379_10012042 | 3300014968 | Bacteria | 7557 |
| 191 | Ga0157379_10065994 | 3300014968 | Bacteria | 3235 |
| 192 | Ga0157376_10147692 | 3300014969 | Bacteria | 2116 |
| 193 | Ga0157376_10391470 | 3300014969 | Bacteria | 1341 |
| 194 | Ga0163161_10158325 | 3300017792 | Bacteria | 1725 |
| 195 | Ga0163161_10357551 | 3300017792 | Bacteria | 1162 |
| 196 | Ga0163161_10731064 | 3300017792 | Bacteria | 826 |
| 197 | Ga0206356_10619810 | 3300020070 | Bacteria | 937 |
| 198 | Ga0224712_10061860 | 3300022467 | Bacteria | 1494 |
| 199 | Ga0207653_10151671 | 3300025885 | Unclassified | 853 |
| 200 | Ga0207682_10043194 | 3300025893 | Bacteria | 1844 |
| 201 | Ga0207688_10004673 | 3300025901 | Bacteria | 7463 |
| 202 | Ga0207688_10025237 | 3300025901 | Bacteria | 3263 |
| 203 | Ga0207688_10085097 | 3300025901 | Bacteria | 1811 |
| 204 | Ga0207645_10082943 | 3300025907 | Bacteria | 2055 |
| 205 | Ga0207643_10143180 | 3300025908 | Bacteria | 1429 |
| 206 | Ga0207705_10341686 | 3300025909 | Bacteria | 1152 |
| 207 | Ga0207684_10539132 | 3300025910 | Bacteria | 999 |
| 208 | Ga0207654_10045805 | 3300025911 | Bacteria | 2491 |
| 209 | Ga0207707_10209715 | 3300025912 | Bacteria | 1697 |
| 210 | Ga0207660_10054412 | 3300025917 | Bacteria | 2856 |
| 211 | Ga0207660_10130660 | 3300025917 | Bacteria | 1911 |
| 212 | Ga0207662_10356788 | 3300025918 | Bacteria | 983 |
| 213 | Ga0207657_10008194 | 3300025919 | Bacteria | 10648 |
| 214 | Ga0207657_10078670 | 3300025919 | Bacteria | 2776 |
| 215 | Ga0207649_10032335 | 3300025920 | Bacteria | 3118 |
| 216 | Ga0207649_10052952 | 3300025920 | Bacteria | 2520 |
| 217 | Ga0207652_10224380 | 3300025921 | Bacteria | 1693 |
| 218 | Ga0207652_10431279 | 3300025921 | Bacteria | 1188 |
| 219 | Ga0207681_10173750 | 3300025923 | Bacteria | 1635 |
| 220 | Ga0207650_10019951 | 3300025925 | Bacteria | 4719 |
| 221 | Ga0207650_10067936 | 3300025925 | Bacteria | 2676 |
| 222 | Ga0207659_10007680 | 3300025926 | Bacteria | 6653 |
| 223 | Ga0207659_10028465 | 3300025926 | Bacteria | 3798 |
| 224 | Ga0207687_10079402 | 3300025927 | Bacteria | 2366 |
| 225 | Ga0207687_10114127 | 3300025927 | Unclassified | 2010 |
| 226 | Ga0207687_10281813 | 3300025927 | Bacteria | 1332 |
| 227 | Ga0207690_10034834 | 3300025932 | Bacteria | 3247 |
| 228 | Ga0207690_10529191 | 3300025932 | Unclassified | 956 |
| 229 | Ga0207706_10059369 | 3300025933 | Bacteria | 3368 |
| 230 | Ga0207706_10059783 | 3300025933 | Bacteria | 3356 |
| 231 | Ga0207706_10387748 | 3300025933 | Bacteria | 1212 |
| 232 | Ga0207686_10014049 | 3300025934 | Bacteria | 4447 |
| 233 | Ga0207709_10033670 | 3300025935 | Bacteria | 3012 |
| 234 | Ga0207709_10355723 | 3300025935 | Bacteria | 1107 |
| 235 | Ga0207709_10374706 | 3300025935 | Bacteria | 1081 |
| 236 | Ga0207670_10046961 | 3300025936 | Bacteria | 2872 |
| 237 | Ga0207669_10125304 | 3300025937 | Unclassified | 1753 |
| 238 | Ga0207704_10141814 | 3300025938 | Bacteria | 1682 |
| 239 | Ga0207704_10357218 | 3300025938 | Bacteria | 1139 |
| 240 | Ga0207691_10036874 | 3300025940 | Bacteria | 4529 |
| 241 | Ga0207691_10039916 | 3300025940 | Bacteria | 4341 |
| 242 | Ga0207711_10100442 | 3300025941 | Bacteria | 2559 |
| 243 | Ga0207689_10031514 | 3300025942 | Bacteria | 4413 |
| 244 | Ga0207689_10239489 | 3300025942 | Bacteria | 1500 |
| 245 | Ga0207661_10019376 | 3300025944 | Bacteria | 5072 |
| 246 | Ga0207661_10118924 | 3300025944 | Bacteria | 2247 |
| 247 | Ga0207661_10183494 | 3300025944 | Bacteria | 1830 |
| 248 | Ga0207661_10449804 | 3300025944 | Bacteria | 1173 |
| 249 | Ga0207679_10022903 | 3300025945 | Bacteria | 4261 |
| 250 | Ga0207679_10111935 | 3300025945 | Bacteria | 2156 |
| 251 | Ga0207651_10843673 | 3300025960 | Bacteria | 814 |
| 252 | Ga0207668_10668306 | 3300025972 | Bacteria | 911 |
| 253 | Ga0207640_10009620 | 3300025981 | Bacteria | 5419 |
| 254 | Ga0207640_10287561 | 3300025981 | Bacteria | 1294 |
| 255 | Ga0207658_10383170 | 3300025986 | Bacteria | 1232 |
| 256 | Ga0207677_10109458 | 3300026023 | Bacteria | 2054 |
| 257 | Ga0207677_10124811 | 3300026023 | Bacteria | 1943 |
| 258 | Ga0207677_10435254 | 3300026023 | Bacteria | 1120 |
| 259 | Ga0207677_10595508 | 3300026023 | Bacteria | 970 |
| 260 | Ga0207703_10529504 | 3300026035 | Bacteria | 1109 |
| 261 | Ga0207639_10114078 | 3300026041 | Bacteria | 2208 |
| 262 | Ga0207639_10337911 | 3300026041 | Bacteria | 1342 |
| 263 | Ga0207678_10149407 | 3300026067 | Bacteria | 1995 |
| 264 | Ga0207678_10177068 | 3300026067 | Bacteria | 1821 |
| 265 | Ga0207678_10357190 | 3300026067 | Bacteria | 1261 |
| 266 | Ga0207708_10030221 | 3300026075 | Bacteria | 4108 |
| 267 | Ga0207708_10124855 | 3300026075 | Bacteria | 2008 |
| 268 | Ga0207708_10512415 | 3300026075 | Unclassified | 1007 |
| 269 | Ga0207702_10093017 | 3300026078 | Bacteria | 2644 |
| 270 | Ga0207702_10344518 | 3300026078 | Bacteria | 1424 |
| 271 | Ga0207641_10420412 | 3300026088 | Bacteria | 1287 |
| 272 | Ga0207641_10702885 | 3300026088 | Bacteria | 996 |
| 273 | Ga0207648_10013335 | 3300026089 | Bacteria | 7653 |
| 274 | Ga0207648_10043300 | 3300026089 | Bacteria | 3952 |
| 275 | Ga0207648_10253266 | 3300026089 | Unclassified | 1570 |
| 276 | Ga0207648_10264428 | 3300026089 | Bacteria | 1535 |
| 277 | Ga0207648_10284569 | 3300026089 | Bacteria | 1479 |
| 278 | Ga0207676_10039555 | 3300026095 | Bacteria | 3608 |
| 279 | Ga0207674_10063058 | 3300026116 | Bacteria | 3742 |
| 280 | Ga0207674_10164008 | 3300026116 | Bacteria | 2176 |
| 281 | Ga0207675_100093758 | 3300026118 | Bacteria | 2824 |
| 282 | Ga0207675_100420497 | 3300026118 | Unclassified | 1320 |
| 283 | Ga0207675_100645049 | 3300026118 | Bacteria | 1065 |
| 284 | Ga0207683_10017642 | 3300026121 | Bacteria | 6085 |
| 285 | Ga0207683_10060770 | 3300026121 | Bacteria | 3322 |
| 286 | Ga0207683_10088560 | 3300026121 | Bacteria | 2754 |
| 287 | Ga0207683_10101842 | 3300026121 | Bacteria | 2564 |
| 288 | Ga0207683_10715337 | 3300026121 | Bacteria | 929 |
| 289 | Ga0207698_10019214 | 3300026142 | Bacteria | 4673 |
| 290 | Ga0207698_10271452 | 3300026142 | Bacteria | 1564 |
| 291 | Ga0207698_10386309 | 3300026142 | Bacteria | 1333 |
| 292 | Ga0207698_10522068 | 3300026142 | Bacteria | 1159 |
| 293 | Ga0207428_10009174 | 3300027907 | Bacteria | 8888 |
| 294 | Ga0207428_10015782 | 3300027907 | Bacteria | 6518 |
| 295 | Ga0207428_10051632 | 3300027907 | Bacteria | 3286 |
| 296 | Ga0207428_10130303 | 3300027907 | Bacteria | 1925 |
| 297 | Ga0268265_10392826 | 3300028380 | Bacteria | 1280 |
| 298 | Ga0307408_100155576 | 3300031548 | Bacteria | 1810 |
| 299 | Ga0307413_10351487 | 3300031824 | Bacteria | 1138 |
| 300 | Ga0307406_10628544 | 3300031901 | Unclassified | 889 |
| 301 | Ga0307409_100093669 | 3300031995 | Bacteria | 2469 |
| 302 | Ga0307416_100378744 | 3300032002 | Archaea | 1444 |
| 303 | Ga0307415_100136688 | 3300032126 | Unclassified | 1865 |
| 304 | Ga0373942_0019523 | 3300035207 | Bacteria | 1693 |
| 305 | Ga0373962_0008175 | 3300035242 | Bacteria | 2571 |
| 306 | Ga0373962_0033937 | 3300035242 | Bacteria | 1411 |
| 307 | Ga0373931_0364399 | 3300035691 | Bacteria | 907 |
| 308 | Ga0395900_0098422 | 3300037418 | Bacteria | 3005 |
| 309 | Ga0395898_0475963 | 3300037466 | Bacteria | 1188 |
| 310 | Ga0395901_0004367 | 3300038443 | Bacteria | 14260 |
| 311 | Ga0439436_0026675 | 3300041404 | Bacteria | 1693 |
| 312 | Ga0439439_0000575 | 3300041406 | Bacteria | 6416 |
| 313 | Ga0451798_0937553 | 3300041458 | Bacteria | 1089 |
| 314 | Ga0451853_2954668 | 3300041512 | Bacteria | 1107 |
| 315 | Ga0439433_0018740 | 3300041999 | Bacteria | 1541 |
| 316 | Ga0439442_018559 | 3300042002 | Bacteria | 1438 |
| 317 | Ga0439445_0066601 | 3300042004 | Bacteria | 992 |
| 318 | Ga0439449_0077256 | 3300042007 | Bacteria | 1228 |
| 319 | Ga0439457_040352 | 3300042014 | Bacteria | 1040 |
| 320 | Ga0439462_0005622 | 3300042015 | Bacteria | 3095 |
| 321 | Ga0439463_079597 | 3300042016 | Bacteria | 842 |
| 322 | Ga0450920_017093 | 3300042122 | Bacteria | 1385 |
| 323 | Ga0450906_030573 | 3300042145 | Bacteria | 952 |
| 324 | Ga0439446_0000832 | 3300042156 | Bacteria | 6590 |
| 325 | Ga0439446_0007119 | 3300042156 | Bacteria | 2934 |
| 326 | Ga0439446_0076530 | 3300042156 | Bacteria | 1030 |
| 327 | Ga0450908_010949 | 3300042184 | Bacteria | 1667 |
| 328 | Ga0439434_0007170 | 3300042435 | Bacteria | 3264 |
| 329 | Ga0439434_0011940 | 3300042435 | Bacteria | 2567 |
| 330 | Ga0439459_0058840 | 3300042438 | Bacteria | 863 |
| 331 | Ga0450918_006012 | 3300042531 | Unclassified | 2171 |
| 332 | Ga0495603_0018393 | 3300046455 | Bacteria | 4228 |
| 333 | Ga0495641_0106849 | 3300046461 | Bacteria | 1249 |
| 334 | Ga0495651_0399530 | 3300046462 | Unclassified | 898 |
| 335 | Ga0495605_0106960 | 3300046474 | Bacteria | 1280 |
| 336 | Ga0495584_0122043 | 3300046491 | Bacteria | 1320 |
| 337 | Ga0495596_0033470 | 3300046500 | Bacteria | 2045 |
| 338 | Ga0495644_0063197 | 3300046523 | Bacteria | 1391 |
| 339 | Ga0495644_0135021 | 3300046523 | Bacteria | 941 |
| 340 | Ga0495663_0190098 | 3300046525 | Bacteria | 714 |
| 341 | Ga0495667_0217177 | 3300046559 | Unclassified | 1221 |
| 342 | Ga0495634_0144340 | 3300046642 | Bacteria | 1509 |
| 343 | Ga0495670_0156350 | 3300046691 | Bacteria | 1197 |
| 344 | Ga0495589_0151816 | 3300046794 | Bacteria | 1106 |
| 345 | Ga0495600_0187518 | 3300046809 | Bacteria | 1331 |
| 346 | Ga0495674_0117666 | 3300047319 | Bacteria | 2248 |
| 347 | Ga0496100_0235862 | 3300048903 | Bacteria | 1348 |
| 348 | Ga0496100_0650332 | 3300048903 | Bacteria | 821 |
| 349 | Ga0496101_0264616 | 3300048904 | Bacteria | 1342 |
| 350 | Ga0496101_0821529 | 3300048904 | Bacteria | 733 |
| 351 | Ga0496101_0906263 | 3300048904 | Bacteria | 694 |
| 352 | Ga0496103_0253774 | 3300048906 | Bacteria | 1132 |
| 353 | Ga0496104_0098299 | 3300048907 | Bacteria | 2802 |
| 354 | Ga0496104_0175237 | 3300048907 | Bacteria | 2055 |
| 355 | Ga0496104_0204351 | 3300048907 | Bacteria | 1887 |
| 356 | Ga0496105_0366616 | 3300048908 | Bacteria | 1148 |
| 357 | Ga0496105_0575407 | 3300048908 | Bacteria | 877 |
| 358 | Ga0496106_0239662 | 3300048909 | Unclassified | 1449 |
| 359 | Ga0496106_0319991 | 3300048909 | Bacteria | 1245 |
| 360 | Ga0496107_0171904 | 3300048910 | Bacteria | 1608 |
| 361 | Ga0496107_0235755 | 3300048910 | Bacteria | 1362 |
| 362 | Ga0496107_0749389 | 3300048910 | Bacteria | 717 |
| 363 | Ga0496108_0222591 | 3300048911 | Unclassified | 1640 |
| 364 | Ga0496108_0299224 | 3300048911 | Bacteria | 1401 |
| 365 | Ga0496108_0608698 | 3300048911 | Bacteria | 952 |
| 366 | Ga0496109_0014515 | 3300048912 | Bacteria | 6852 |
| 367 | Ga0496109_0227297 | 3300048912 | Bacteria | 1755 |
| 368 | Ga0496110_0001012 | 3300048913 | Bacteria | 19807 |
| 369 | Ga0496110_0040698 | 3300048913 | Bacteria | 4051 |
| 370 | Ga0496110_0049155 | 3300048913 | Bacteria | 3698 |
| 371 | Ga0496110_0091556 | 3300048913 | Bacteria | 2720 |
| 372 | Ga0496111_0016754 | 3300048914 | Bacteria | 5055 |
| 373 | Ga0496111_0107527 | 3300048914 | Bacteria | 2054 |
| 374 | Ga0496111_0241533 | 3300048914 | Bacteria | 1341 |
| 375 | Ga0496111_0290862 | 3300048914 | Bacteria | 1211 |
| 376 | Ga0496112_0052526 | 3300048915 | Bacteria | 4000 |
| 377 | Ga0496112_0358369 | 3300048915 | Bacteria | 1401 |
| 378 | Ga0496113_0250372 | 3300048916 | Bacteria | 1414 |
| 379 | Ga0496114_0031231 | 3300048917 | Bacteria | 4382 |
| 380 | Ga0496115_0483637 | 3300048918 | Bacteria | 997 |
| 381 | Ga0501031_0000606 | 3300049568 | Bacteria | 21133 |
| 382 | Ga0501031_0007909 | 3300049568 | Bacteria | 6920 |
| 383 | Ga0501031_0035463 | 3300049568 | Bacteria | 3253 |
| 384 | Ga0501031_0042082 | 3300049568 | Bacteria | 2982 |
| 385 | Ga0501031_0087817 | 3300049568 | Bacteria | 2027 |
| 386 | Ga0501031_0134000 | 3300049568 | Bacteria | 1618 |
| 387 | Ga0501031_0258020 | 3300049568 | Bacteria | 1133 |
| 388 | Ga0501032_0025958 | 3300049569 | Bacteria | 4035 |
| 389 | Ga0501032_0033124 | 3300049569 | Bacteria | 3542 |
| 390 | Ga0501032_0405092 | 3300049569 | Bacteria | 876 |
| 391 | Ga0501033_0006070 | 3300049570 | Bacteria | 9474 |
| 392 | Ga0501033_0008450 | 3300049570 | Bacteria | 7974 |
| 393 | Ga0501033_0058623 | 3300049570 | Bacteria | 2844 |
| 394 | Ga0501033_0103002 | 3300049570 | Bacteria | 2082 |
| 395 | Ga0501033_0231941 | 3300049570 | Bacteria | 1311 |
| 396 | Ga0501033_0487070 | 3300049570 | Bacteria | 854 |
| 397 | Ga0501034_0336113 | 3300049571 | Bacteria | 1441 |
| 398 | Ga0501036_0001341 | 3300049572 | Bacteria | 18917 |
| 399 | Ga0501036_0006649 | 3300049572 | Bacteria | 9397 |
| 400 | Ga0501036_0012707 | 3300049572 | Bacteria | 6986 |
| 401 | Ga0501036_0055348 | 3300049572 | Bacteria | 3360 |
| 402 | Ga0501036_0078331 | 3300049572 | Bacteria | 2795 |
| 403 | Ga0501036_0102127 | 3300049572 | Bacteria | 2426 |
| 404 | Ga0501036_0137938 | 3300049572 | Bacteria | 2058 |
| 405 | Ga0501036_0159180 | 3300049572 | Bacteria | 1904 |
| 406 | Ga0501036_0251229 | 3300049572 | Unclassified | 1482 |
| 407 | Ga0501036_0510416 | 3300049572 | Bacteria | 1000 |
| 408 | Ga0501036_0920035 | 3300049572 | Unclassified | 717 |
| 409 | Ga0501037_0014381 | 3300049573 | Bacteria | 5825 |
| 410 | Ga0501037_0055252 | 3300049573 | Bacteria | 2903 |
| 411 | Ga0501037_0064551 | 3300049573 | Bacteria | 2668 |
| 412 | Ga0501037_0175796 | 3300049573 | Bacteria | 1521 |
| 413 | Ga0501037_0374388 | 3300049573 | Bacteria | 980 |
| 414 | Ga0501037_0469333 | 3300049573 | Unclassified | 857 |
| 415 | Ga0501038_0015192 | 3300049574 | Bacteria | 7002 |
| 416 | Ga0501038_0025799 | 3300049574 | Bacteria | 5236 |
| 417 | Ga0501038_0047611 | 3300049574 | Bacteria | 3713 |
| 418 | Ga0501038_0214532 | 3300049574 | Unclassified | 1538 |
| 419 | Ga0501038_0380352 | 3300049574 | Bacteria | 1095 |
| 420 | Ga0501038_0439390 | 3300049574 | Bacteria | 1005 |
| 421 | Ga0501038_0459201 | 3300049574 | Bacteria | 978 |
| 422 | Ga0501039_0001267 | 3300049575 | Bacteria | 18469 |
| 423 | Ga0501039_0023011 | 3300049575 | Bacteria | 4779 |
| 424 | Ga0501039_0205437 | 3300049575 | Bacteria | 1549 |
| 425 | Ga0501039_0206711 | 3300049575 | Bacteria | 1543 |
| 426 | Ga0501040_0004638 | 3300049576 | Bacteria | 8918 |
| 427 | Ga0501040_0009087 | 3300049576 | Bacteria | 6468 |
| 428 | Ga0501040_0010745 | 3300049576 | Bacteria | 5986 |
| 429 | Ga0501040_0017926 | 3300049576 | Bacteria | 4700 |
| 430 | Ga0501040_0018997 | 3300049576 | Bacteria | 4568 |
| 431 | Ga0501040_0019001 | 3300049576 | Bacteria | 4568 |
| 432 | Ga0501040_0028378 | 3300049576 | Bacteria | 3772 |
| 433 | Ga0501040_0054816 | 3300049576 | Bacteria | 2733 |
| 434 | Ga0501040_0163336 | 3300049576 | Bacteria | 1575 |
| 435 | Ga0501040_0383719 | 3300049576 | Unclassified | 1008 |
| 436 | Ga0501041_0001640 | 3300049577 | Bacteria | 12508 |
| 437 | Ga0501041_0003389 | 3300049577 | Bacteria | 9171 |
| 438 | Ga0501041_0009927 | 3300049577 | Bacteria | 5607 |
| 439 | Ga0501041_0032552 | 3300049577 | Bacteria | 3151 |
| 440 | Ga0501041_0032878 | 3300049577 | Unclassified | 3135 |
| 441 | Ga0501041_0052888 | 3300049577 | Bacteria | 2476 |
| 442 | Ga0501041_0057781 | 3300049577 | Bacteria | 2373 |
| 443 | Ga0501041_0460464 | 3300049577 | Unclassified | 808 |
| 444 | Ga0501042_0004166 | 3300049578 | Bacteria | 9194 |
| 445 | Ga0501042_0023793 | 3300049578 | Bacteria | 4290 |
| 446 | Ga0501042_0047137 | 3300049578 | Bacteria | 3072 |
| 447 | Ga0501042_0063627 | 3300049578 | Bacteria | 2636 |
| 448 | Ga0501042_0071819 | 3300049578 | Bacteria | 2476 |
| 449 | Ga0501042_0117208 | 3300049578 | Bacteria | 1917 |
| 450 | Ga0501042_0217416 | 3300049578 | Bacteria | 1378 |
| 451 | Ga0501042_0222912 | 3300049578 | Bacteria | 1360 |
| 452 | Ga0501042_0502631 | 3300049578 | Bacteria | 880 |
| 453 | Ga0501043_0010486 | 3300049579 | Bacteria | 7257 |
| 454 | Ga0501043_0018367 | 3300049579 | Bacteria | 5483 |
| 455 | Ga0501043_0026438 | 3300049579 | Bacteria | 4553 |
| 456 | Ga0501043_0090925 | 3300049579 | Bacteria | 2400 |
| 457 | Ga0501043_0177584 | 3300049579 | Bacteria | 1660 |
| 458 | Ga0501043_0224792 | 3300049579 | Bacteria | 1451 |
| 459 | Ga0501043_0413215 | 3300049579 | Bacteria | 1018 |
| 460 | Ga0501046_0000122 | 3300049580 | Bacteria | 82617 |
| 461 | Ga0501046_0008606 | 3300049580 | Bacteria | 8878 |
| 462 | Ga0501046_0084135 | 3300049580 | Bacteria | 2454 |
| 463 | Ga0501046_0172965 | 3300049580 | Bacteria | 1619 |
| 464 | Ga0501046_0286577 | 3300049580 | Unclassified | 1205 |
| 465 | Ga0501048_0004582 | 3300049582 | Bacteria | 10521 |
| 466 | Ga0501048_0013844 | 3300049582 | Bacteria | 5983 |
| 467 | Ga0501048_0034167 | 3300049582 | Bacteria | 3671 |
| 468 | Ga0501048_0036409 | 3300049582 | Bacteria | 3537 |
| 469 | Ga0501048_0048466 | 3300049582 | Bacteria | 3030 |
| 470 | Ga0501048_0075289 | 3300049582 | Bacteria | 2381 |
| 471 | Ga0501048_0075431 | 3300049582 | Bacteria | 2379 |
| 472 | Ga0501048_0197481 | 3300049582 | Bacteria | 1426 |
| 473 | Ga0501048_0286900 | 3300049582 | Bacteria | 1170 |
| 474 | Ga0501048_0402135 | 3300049582 | Bacteria | 979 |
| 475 | Ga0501067_0024495 | 3300049583 | Bacteria | 3347 |
| 476 | Ga0501067_0033696 | 3300049583 | Bacteria | 2841 |
| 477 | Ga0501067_0075672 | 3300049583 | Unclassified | 1865 |
| 478 | Ga0501067_0110739 | 3300049583 | Bacteria | 1526 |
| 479 | Ga0501068_0012575 | 3300049584 | Bacteria | 4802 |
| 480 | Ga0501068_0042233 | 3300049584 | Bacteria | 2742 |
| 481 | Ga0501068_0043349 | 3300049584 | Bacteria | 2706 |
| 482 | Ga0501068_0076200 | 3300049584 | Bacteria | 2052 |
| 483 | Ga0501068_0091688 | 3300049584 | Bacteria | 1875 |
| 484 | Ga0501068_0197333 | 3300049584 | Bacteria | 1276 |
| 485 | Ga0501068_0291290 | 3300049584 | Bacteria | 1044 |
| 486 | Ga0501069_0026501 | 3300049585 | Bacteria | 3174 |
| 487 | Ga0501069_0035471 | 3300049585 | Bacteria | 2749 |
| 488 | Ga0501069_0040851 | 3300049585 | Bacteria | 2563 |
| 489 | Ga0501069_0058046 | 3300049585 | Bacteria | 2158 |
| 490 | Ga0501069_0117340 | 3300049585 | Bacteria | 1518 |
| 491 | Ga0501069_0182773 | 3300049585 | Bacteria | 1212 |
| 492 | Ga0501070_0005391 | 3300049586 | Bacteria | 10906 |
| 493 | Ga0501070_0015181 | 3300049586 | Bacteria | 6483 |
| 494 | Ga0501070_0025665 | 3300049586 | Bacteria | 4943 |
| 495 | Ga0501070_0037359 | 3300049586 | Bacteria | 4055 |
| 496 | Ga0501070_0108998 | 3300049586 | Bacteria | 2288 |
| 497 | Ga0501070_0322079 | 3300049586 | Unclassified | 1257 |
| 498 | Ga0501071_0001256 | 3300049587 | Bacteria | 14371 |
| 499 | Ga0501071_0027643 | 3300049587 | Bacteria | 3992 |
| 500 | Ga0501071_0029364 | 3300049587 | Bacteria | 3880 |
| 501 | Ga0501071_0035200 | 3300049587 | Bacteria | 3566 |
| 502 | Ga0501071_0047647 | 3300049587 | Bacteria | 3079 |
| 503 | Ga0501071_0054999 | 3300049587 | Bacteria | 2872 |
| 504 | Ga0501071_0067747 | 3300049587 | Bacteria | 2596 |
| 505 | Ga0501071_0091792 | 3300049587 | Bacteria | 2231 |
| 506 | Ga0501071_0161420 | 3300049587 | Unclassified | 1675 |
| 507 | Ga0501071_0251953 | 3300049587 | Bacteria | 1333 |
| 508 | Ga0501071_0379874 | 3300049587 | Bacteria | 1077 |
| 509 | Ga0501072_0003792 | 3300049588 | Bacteria | 11410 |
| 510 | Ga0501072_0009346 | 3300049588 | Bacteria | 7452 |
| 511 | Ga0501072_0012610 | 3300049588 | Bacteria | 6461 |
| 512 | Ga0501072_0022310 | 3300049588 | Bacteria | 4911 |
| 513 | Ga0501072_0034426 | 3300049588 | Bacteria | 3970 |
| 514 | Ga0501072_0087875 | 3300049588 | Bacteria | 2466 |
| 515 | Ga0501072_0088211 | 3300049588 | Bacteria | 2461 |
| 516 | Ga0501072_0132704 | 3300049588 | Bacteria | 1985 |
| 517 | Ga0501072_0238376 | 3300049588 | Bacteria | 1448 |
| 518 | Ga0501072_0247274 | 3300049588 | Bacteria | 1420 |
| 519 | Ga0501072_0297278 | 3300049588 | Bacteria | 1283 |
| 520 | Ga0501073_0008113 | 3300049589 | Bacteria | 7790 |
| 521 | Ga0501073_0114426 | 3300049589 | Bacteria | 1870 |
| 522 | Ga0501074_0014859 | 3300049590 | Bacteria | 5661 |
| 523 | Ga0501074_0022359 | 3300049590 | Bacteria | 4593 |
| 524 | Ga0501074_0105595 | 3300049590 | Bacteria | 2016 |
| 525 | Ga0501074_0107354 | 3300049590 | Bacteria | 1999 |
| 526 | Ga0501074_0132415 | 3300049590 | Bacteria | 1783 |
| 527 | Ga0501074_0138161 | 3300049590 | Bacteria | 1743 |
| 528 | Ga0501074_0178660 | 3300049590 | Unclassified | 1514 |
| 529 | Ga0501074_0276565 | 3300049590 | Bacteria | 1194 |
| 530 | Ga0501074_0414177 | 3300049590 | Bacteria | 956 |
| 531 | Ga0501075_0004358 | 3300049591 | Bacteria | 9570 |
| 532 | Ga0501075_0006497 | 3300049591 | Bacteria | 8051 |
| 533 | Ga0501075_0009552 | 3300049591 | Bacteria | 6790 |
| 534 | Ga0501075_0017824 | 3300049591 | Bacteria | 5129 |
| 535 | Ga0501075_0024853 | 3300049591 | Bacteria | 4397 |
| 536 | Ga0501075_0031794 | 3300049591 | Bacteria | 3920 |
| 537 | Ga0501075_0035874 | 3300049591 | Bacteria | 3699 |
| 538 | Ga0501075_0037435 | 3300049591 | Bacteria | 3625 |
| 539 | Ga0501075_0105444 | 3300049591 | Bacteria | 2142 |
| 540 | Ga0501075_0256194 | 3300049591 | Bacteria | 1333 |
| 541 | Ga0501075_0257349 | 3300049591 | Bacteria | 1330 |
| 542 | Ga0501075_0389379 | 3300049591 | Bacteria | 1062 |
| 543 | Ga0501076_0002557 | 3300049592 | Bacteria | 12515 |
| 544 | Ga0501076_0019245 | 3300049592 | Bacteria | 5215 |
| 545 | Ga0501076_0031889 | 3300049592 | Bacteria | 4112 |
| 546 | Ga0501076_0048610 | 3300049592 | Bacteria | 3352 |
| 547 | Ga0501076_0053670 | 3300049592 | Bacteria | 3194 |
| 548 | Ga0501076_0060351 | 3300049592 | Bacteria | 3017 |
| 549 | Ga0501076_0130191 | 3300049592 | Bacteria | 2040 |
| 550 | Ga0501076_0146017 | 3300049592 | Bacteria | 1923 |
| 551 | Ga0501076_0172378 | 3300049592 | Bacteria | 1764 |
| 552 | Ga0501076_0223629 | 3300049592 | Unclassified | 1538 |
| 553 | Ga0501076_0371424 | 3300049592 | Bacteria | 1175 |
| 554 | Ga0501076_0497280 | 3300049592 | Bacteria | 1005 |
| 555 | Ga0501077_0002372 | 3300049593 | Bacteria | 11310 |
| 556 | Ga0501077_0006113 | 3300049593 | Bacteria | 7352 |
| 557 | Ga0501077_0014636 | 3300049593 | Bacteria | 4931 |
| 558 | Ga0501077_0018438 | 3300049593 | Bacteria | 4416 |
| 559 | Ga0501077_0020432 | 3300049593 | Bacteria | 4192 |
| 560 | Ga0501077_0024546 | 3300049593 | Bacteria | 3829 |
| 561 | Ga0501077_0026466 | 3300049593 | Bacteria | 3681 |
| 562 | Ga0501077_0105461 | 3300049593 | Bacteria | 1786 |
| 563 | Ga0501077_0249834 | 3300049593 | Bacteria | 1128 |
| 564 | Ga0501077_0251812 | 3300049593 | Bacteria | 1123 |
| 565 | Ga0501077_0271418 | 3300049593 | Bacteria | 1079 |
| 566 | Ga0501079_0003376 | 3300049741 | Bacteria | 11711 |
| 567 | Ga0501079_0011749 | 3300049741 | Bacteria | 6688 |
| 568 | Ga0501079_0014336 | 3300049741 | Bacteria | 6043 |
| 569 | Ga0501079_0014569 | 3300049741 | Bacteria | 5997 |
| 570 | Ga0501079_0022803 | 3300049741 | Bacteria | 4805 |
| 571 | Ga0501079_0043908 | 3300049741 | Bacteria | 3450 |
| 572 | Ga0501079_0126780 | 3300049741 | Bacteria | 1986 |
| 573 | Ga0501079_0305451 | 3300049741 | Unclassified | 1245 |
| 574 | Ga0501079_0520266 | 3300049741 | Unclassified | 935 |
| 575 | Ga0501079_0718339 | 3300049741 | Bacteria | 786 |
| 576 | Ga0501080_0001820 | 3300049742 | Bacteria | 18281 |
| 577 | Ga0501080_0018503 | 3300049742 | Bacteria | 6444 |
| 578 | Ga0501080_0033905 | 3300049742 | Bacteria | 4766 |
| 579 | Ga0501080_0077938 | 3300049742 | Bacteria | 3082 |
| 580 | Ga0501080_0095701 | 3300049742 | Unclassified | 2757 |
| 581 | Ga0501080_0203397 | 3300049742 | Bacteria | 1817 |
| 582 | Ga0501081_0026060 | 3300049743 | Bacteria | 3939 |
| 583 | Ga0501081_0043957 | 3300049743 | Bacteria | 3065 |
| 584 | Ga0501081_0044839 | 3300049743 | Unclassified | 3036 |
| 585 | Ga0501081_0051971 | 3300049743 | Bacteria | 2826 |
| 586 | Ga0501081_0064426 | 3300049743 | Bacteria | 2545 |
| 587 | Ga0501081_0162934 | 3300049743 | Bacteria | 1607 |
| 588 | Ga0501081_0179853 | 3300049743 | Bacteria | 1530 |
| 589 | Ga0501081_0212744 | 3300049743 | Unclassified | 1404 |
| 590 | Ga0501081_0553134 | 3300049743 | Bacteria | 860 |
| 591 | Ga0501083_0001412 | 3300049744 | Bacteria | 16364 |
| 592 | Ga0501083_0009056 | 3300049744 | Bacteria | 7031 |
| 593 | Ga0501083_0039260 | 3300049744 | Bacteria | 3215 |
| 594 | Ga0501083_0056496 | 3300049744 | Bacteria | 2630 |
| 595 | Ga0501083_0218050 | 3300049744 | Bacteria | 1243 |
| 596 | Ga0501083_0231143 | 3300049744 | Bacteria | 1204 |
| 597 | Ga0501035_0015492 | 3300049822 | Bacteria | 7033 |
| 598 | Ga0501035_0048322 | 3300049822 | Bacteria | 3816 |
| 599 | Ga0501035_0065121 | 3300049822 | Bacteria | 3237 |
| 600 | Ga0501035_0119193 | 3300049822 | Bacteria | 2308 |
| 601 | Ga0501035_0278049 | 3300049822 | Bacteria | 1416 |
| 602 | Ga0501035_0300042 | 3300049822 | Bacteria | 1354 |
| 603 | Ga0501035_0369229 | 3300049822 | Bacteria | 1198 |
| 604 | Ga0501044_0008263 | 3300049823 | Bacteria | 11414 |
| 605 | Ga0501044_0042191 | 3300049823 | Bacteria | 4747 |
| 606 | Ga0501044_0077387 | 3300049823 | Bacteria | 3374 |
| 607 | Ga0501045_0003659 | 3300049824 | Bacteria | 10570 |
| 608 | Ga0501045_0008863 | 3300049824 | Bacteria | 7023 |
| 609 | Ga0501045_0014960 | 3300049824 | Bacteria | 5506 |
| 610 | Ga0501045_0024498 | 3300049824 | Bacteria | 4333 |
| 611 | Ga0501045_0161245 | 3300049824 | Bacteria | 1669 |
| 612 | Ga0501045_0194509 | 3300049824 | Bacteria | 1511 |
| 613 | nmdc:mga0yw44_258940_c1 | 3300050492 | Unclassified | 1159 |
| 614 | nmdc:mga0yw44_274059_c1 | 3300050492 | Bacteria | 1127 |
| 615 | nmdc:mga05p37_120271_c1 | 3300050507 | Bacteria | 3226 |
| 616 | nmdc:mga05p37_62787_c1 | 3300050507 | Bacteria | 4572 |
| 617 | nmdc:mga05p37_8097_c1 | 3300050507 | Bacteria | 12423 |
| 618 | nmdc:mga05p37_984270_c1 | 3300050507 | Bacteria | 898 |
| 619 | nmdc:mga09592_6854_c1 | 3300050508 | Bacteria | 9274 |
| 620 | nmdc:mga06r32_81072_c1 | 3300050510 | Bacteria | 3160 |
| 621 | nmdc:mga08y16_123837_c1 | 3300050511 | Bacteria | 2690 |
| 622 | nmdc:mga08y16_21674_c1 | 3300050511 | Bacteria | 6783 |
| 623 | nmdc:mga08y16_42813_c1 | 3300050511 | Bacteria | 4742 |
| 624 | nmdc:mga08y16_62074_c1 | 3300050511 | Bacteria | 3903 |
| 625 | nmdc:mga0n895_453610_c1 | 3300050512 | Bacteria | 1294 |
| 626 | nmdc:mga0n895_52742_c1 | 3300050512 | Bacteria | 3993 |
| 627 | nmdc:mga0n895_632370_c1 | 3300050512 | Bacteria | 1070 |
| 628 | nmdc:mga0rr50_887482_c1 | 3300050513 | Bacteria | 760 |
| 629 | nmdc:mga08x19_109315_c1 | 3300050514 | Bacteria | 1843 |
| 630 | nmdc:mga0a205_221043_c1 | 3300050515 | Bacteria | 1779 |
| 631 | nmdc:mga0a205_31476_c1 | 3300050515 | Bacteria | 5082 |
| 632 | nmdc:mga0a205_417643_c1 | 3300050515 | Bacteria | 1204 |
| 633 | nmdc:mga0a205_60127_c1 | 3300050515 | Bacteria | 3670 |
| 634 | Ga0495612_0042904 | 3300053078 | Bacteria | 1847 |
| 635 | Ga0501084_0009851 | 3300054114 | Bacteria | 7897 |
| 636 | Ga0501084_0014778 | 3300054114 | Bacteria | 6473 |
| 637 | Ga0501084_0037668 | 3300054114 | Bacteria | 4041 |
| 638 | Ga0501084_0065694 | 3300054114 | Bacteria | 3036 |
| 639 | Ga0501084_0111464 | 3300054114 | Bacteria | 2299 |
| 640 | Ga0501084_0390790 | 3300054114 | Bacteria | 1175 |
| 641 | Ga0501084_0474364 | 3300054114 | Bacteria | 1058 |
| 642 | Ga0501082_0003561 | 3300060353 | Bacteria | 13596 |
| 643 | Ga0501082_0004532 | 3300060353 | Bacteria | 12128 |
| 644 | Ga0501082_0021034 | 3300060353 | Bacteria | 5627 |
| 645 | Ga0501082_0025354 | 3300060353 | Bacteria | 5110 |
| 646 | Ga0501082_0040343 | 3300060353 | Bacteria | 4027 |
| 647 | Ga0501082_0056851 | 3300060353 | Bacteria | 3370 |
| 648 | Ga0501082_0071864 | 3300060353 | Bacteria | 2980 |
| 649 | Ga0501082_0185009 | 3300060353 | Bacteria | 1812 |
| 650 | Ga0501082_0188425 | 3300060353 | Bacteria | 1795 |
| 651 | Ga0501082_0300010 | 3300060353 | Unclassified | 1399 |
| 652 | Ga0501082_0479662 | 3300060353 | Bacteria | 1087 |
| 653 | Ga0530510_0014204 | 3300061734 | Bacteria | 5613 |
| 654 | Ga0530510_0040064 | 3300061734 | Bacteria | 3381 |
| 655 | Ga0530510_0048882 | 3300061734 | Bacteria | 3056 |
| 656 | Ga0530510_0051003 | 3300061734 | Unclassified | 2989 |
| 657 | Ga0530510_0056942 | 3300061734 | Bacteria | 2825 |
| 658 | Ga0530510_0101445 | 3300061734 | Bacteria | 2104 |
| 659 | Ga0530510_0169817 | 3300061734 | Bacteria | 1615 |
| 660 | Ga0530510_0267180 | 3300061734 | Bacteria | 1276 |
| 661 | JGI24738J21930_10004878 | |||
| 662 | JGI25406J46586_10035795 | |||
| 663 | Ga0070658_10020296 | |||
| 664 | Ga0070676_10067812 | |||
| 665 | Ga0070683_100010806 | |||
| 666 | Ga0070683_100221932 | |||
| 667 | Ga0070683_100349040 | |||
| 668 | Ga0070683_100395924 | |||
| 669 | Ga0070677_10031200 | |||
| 670 | Ga0070666_10586246 | |||
| 671 | Ga0070680_100025551 | |||
| 672 | Ga0070680_100169506 | |||
| 673 | Ga0070682_100003551 | |||
| 674 | Ga0070682_100051165 | |||
| 675 | Ga0070682_100076438 | |||
| 676 | Ga0070682_100098769 | |||
| 677 | Ga0068868_100536992 | |||
| 678 | Ga0070660_100021121 | |||
| 679 | Ga0070689_100017072 | |||
| 680 | Ga0070691_10001184 | |||
| 681 | Ga0070691_10081428 | |||
| 682 | Ga0070687_100038390 | |||
| 683 | Ga0070661_100074664 | |||
| 684 | Ga0070661_100588036 | |||
| 685 | Ga0070661_100751711 | |||
| 686 | Ga0070692_10098980 | |||
| 687 | Ga0070692_10153890 | |||
| 688 | Ga0070675_100041952 | |||
| 689 | Ga0070675_100346548 | |||
| 690 | Ga0070674_100135323 | |||
| 691 | Ga0070674_100322722 | |||
| 692 | Ga0070673_100496039 | |||
| 693 | Ga0070688_100043759 | |||
| 694 | Ga0070688_100332783 | |||
| 695 | Ga0070659_100004790 | |||
| 696 | Ga0070659_100165323 | |||
| 697 | Ga0070701_10011639 | |||
| 698 | Ga0070705_100149592 | |||
| 699 | Ga0070700_100106870 | |||
| 700 | Ga0070694_100418630 | |||
| 701 | Ga0070708_100213855 | |||
| 702 | Ga0070708_100562798 | |||
| 703 | Ga0070678_100166224 | |||
| 704 | Ga0070678_100587572 | |||
| 705 | Ga0070662_100078895 | |||
| 706 | Ga0070681_10063717 | |||
| 707 | Ga0070681_10080587 | |||
| 708 | Ga0068867_100225710 | |||
| 709 | Ga0068867_100285828 | |||
| 710 | Ga0070685_10028696 | |||
| 711 | Ga0070706_100993424 | |||
| 712 | Ga0070698_100187221 | |||
| 713 | Ga0070699_100052843 | |||
| 714 | Ga0070699_100305519 | |||
| 715 | Ga0070679_100052410 | |||
| 716 | Ga0070679_100432292 | |||
| 717 | Ga0070684_100074588 | |||
| 718 | Ga0070684_100099106 | |||
| 719 | Ga0070684_100163262 | |||
| 720 | Ga0070684_100656600 | |||
| 721 | Ga0070684_100874760 | |||
| 722 | Ga0068853_100032064 | |||
| 723 | Ga0068853_100422867 | |||
| 724 | Ga0070672_100277957 | |||
| 725 | Ga0070672_100557238 | |||
| 726 | Ga0070686_100285544 | |||
| 727 | Ga0070693_100099679 | |||
| 728 | Ga0070665_100093217 | |||
| 729 | Ga0070704_100063726 | |||
| 730 | Ga0070704_100098994 | |||
| 731 | Ga0070664_100130694 | |||
| 732 | Ga0070664_100264686 | |||
| 733 | Ga0070664_100405587 | |||
| 734 | Ga0068857_100114534 | |||
| 735 | Ga0068857_100145822 | |||
| 736 | Ga0068854_100024362 | |||
| 737 | Ga0068854_100073483 | |||
| 738 | Ga0068854_100141080 | |||
| 739 | Ga0068854_100270124 | |||
| 740 | Ga0068856_100301741 | |||
| 741 | Ga0070702_100006499 | |||
| 742 | Ga0070702_100006838 | |||
| 743 | Ga0068852_100002729 | |||
| 744 | Ga0068852_100549500 | |||
| 745 | Ga0068859_100033807 | |||
| 746 | Ga0068859_100974025 | |||
| 747 | Ga0068861_100346461 | |||
| 748 | Ga0068851_10009412 | |||
| 749 | Ga0068870_10005881 | |||
| 750 | Ga0068870_10037588 | |||
| 751 | Ga0068870_10074876 | |||
| 752 | Ga0068863_100020946 | |||
| 753 | Ga0068863_100226317 | |||
| 754 | Ga0068858_100027009 | |||
| 755 | Ga0068860_100172147 | |||
| 756 | Ga0068860_100234522 | |||
| 757 | Ga0068862_100272783 | |||
| 758 | Ga0081455_10017529 | |||
| 759 | Ga0081455_10134333 | |||
| 760 | Ga0081455_10180983 | |||
| 761 | Ga0081455_10252859 | |||
| 762 | Ga0081539_10006369 | |||
| 763 | Ga0075364_10428151 | |||
| 764 | Ga0075432_10014112 | |||
| 765 | Ga0075367_10215011 | |||
| 766 | Ga0097621_100087668 | |||
| 767 | Ga0068871_100104875 | |||
| 768 | Ga0068871_100559442 | |||
| 769 | Ga0075428_100031741 | |||
| 770 | Ga0075428_100143111 | |||
| 771 | Ga0075428_100198138 | |||
| 772 | Ga0075430_100034498 | |||
| 773 | Ga0075431_100102283 | |||
| 774 | Ga0075431_100310615 | |||
| 775 | Ga0075433_10137758 | |||
| 776 | Ga0075433_10236638 | |||
| 777 | Ga0075433_10265993 | |||
| 778 | Ga0075433_10374598 | |||
| 779 | Ga0075434_100733000 | |||
| 780 | Ga0075429_100049911 | |||
| 781 | Ga0075429_100053133 | |||
| 782 | Ga0075429_100336623 | |||
| 783 | Ga0068865_100066771 | |||
| 784 | Ga0068865_100086537 | |||
| 785 | Ga0068865_100170614 | |||
| 786 | Ga0068865_100298754 | |||
| 787 | Ga0075436_100018683 | |||
| 788 | Ga0097620_100033805 | |||
| 789 | Ga0097620_100974217 | |||
| 790 | Ga0111539_10016729 | |||
| 791 | Ga0111539_10026695 | |||
| 792 | Ga0111539_10437282 | |||
| 793 | Ga0111539_11111433 | |||
| 794 | Ga0105245_10082250 | |||
| 795 | Ga0105245_10183917 | |||
| 796 | Ga0105245_10266119 | |||
| 797 | Ga0105247_10313687 | |||
| 798 | Ga0114129_10016628 | |||
| 799 | Ga0114129_10251482 | |||
| 800 | Ga0114129_10309027 | |||
| 801 | Ga0114129_10569440 | |||
| 802 | Ga0105243_10010878 | |||
| 803 | Ga0105243_10019884 | |||
| 804 | Ga0105243_10035385 | |||
| 805 | Ga0105243_10168419 | |||
| 806 | Ga0105243_10237624 | |||
| 807 | Ga0105241_10090193 | |||
| 808 | Ga0105242_10041185 | |||
| 809 | Ga0105242_10119140 | |||
| 810 | Ga0105242_10983310 | |||
| 811 | Ga0105248_10243054 | |||
| 812 | Ga0105248_10696690 | |||
| 813 | Ga0105237_10534875 | |||
| 814 | Ga0105238_10056633 | |||
| 815 | Ga0105249_10071606 | |||
| 816 | Ga0105249_10766978 | |||
| 817 | Ga0105239_10087701 | |||
| 818 | Ga0105239_10206708 | |||
| 819 | Ga0105246_10161852 | |||
| 820 | Ga0105246_10181732 | |||
| 821 | Ga0105246_10207634 | |||
| 822 | Ga0105246_10234917 | |||
| 823 | Ga0105246_10292098 | |||
| 824 | Ga0105246_10368420 | |||
| 825 | Ga0105246_10610556 | |||
| 826 | Ga0105246_10654858 | |||
| 827 | Ga0157371_10018177 | |||
| 828 | Ga0157371_10098404 | |||
| 829 | Ga0157369_10236196 | |||
| 830 | Ga0157374_10267946 | |||
| 831 | Ga0163162_10068235 | |||
| 832 | Ga0157372_10015689 | |||
| 833 | Ga0157372_10106559 | |||
| 834 | Ga0157372_10395367 | |||
| 835 | Ga0157372_11416316 | |||
| 836 | Ga0157375_10059062 | |||
| 837 | Ga0157375_10551011 | |||
| 838 | Ga0163163_10235048 | |||
| 839 | Ga0163163_10795243 | |||
| 840 | Ga0157380_10027642 | |||
| 841 | Ga0157380_10250498 | |||
| 842 | Ga0157380_10260966 | |||
| 843 | Ga0157380_10749262 | |||
| 844 | Ga0157377_10001619 | |||
| 845 | Ga0157377_10013898 | |||
| 846 | Ga0157377_10098622 | |||
| 847 | Ga0157377_10127607 | |||
| 848 | Ga0157377_10144776 | |||
| 849 | Ga0157377_10327457 | |||
| 850 | Ga0157379_10012042 | |||
| 851 | Ga0157379_10065994 | |||
| 852 | Ga0157376_10147692 | |||
| 853 | Ga0157376_10391470 | |||
| 854 | Ga0163161_10158325 | |||
| 855 | Ga0163161_10357551 | |||
| 856 | Ga0163161_10731064 | |||
| 857 | Ga0206356_10619810 | |||
| 858 | Ga0224712_10061860 | |||
| 859 | Ga0207653_10151671 | |||
| 860 | Ga0207682_10043194 | |||
| 861 | Ga0207688_10004673 | |||
| 862 | Ga0207688_10025237 | |||
| 863 | Ga0207688_10085097 | |||
| 864 | Ga0207645_10082943 | |||
| 865 | Ga0207643_10143180 | |||
| 866 | Ga0207705_10341686 | |||
| 867 | Ga0207684_10539132 | |||
| 868 | Ga0207654_10045805 | |||
| 869 | Ga0207707_10209715 | |||
| 870 | Ga0207660_10054412 | |||
| 871 | Ga0207660_10130660 | |||
| 872 | Ga0207662_10356788 | |||
| 873 | Ga0207657_10008194 | |||
| 874 | Ga0207657_10078670 | |||
| 875 | Ga0207649_10032335 | |||
| 876 | Ga0207649_10052952 | |||
| 877 | Ga0207652_10224380 | |||
| 878 | Ga0207652_10431279 | |||
| 879 | Ga0207681_10173750 | |||
| 880 | Ga0207650_10019951 | |||
| 881 | Ga0207650_10067936 | |||
| 882 | Ga0207659_10007680 | |||
| 883 | Ga0207659_10028465 | |||
| 884 | Ga0207687_10079402 | |||
| 885 | Ga0207687_10114127 | |||
| 886 | Ga0207687_10281813 | |||
| 887 | Ga0207690_10034834 | |||
| 888 | Ga0207690_10529191 | |||
| 889 | Ga0207706_10059369 | |||
| 890 | Ga0207706_10059783 | |||
| 891 | Ga0207706_10387748 | |||
| 892 | Ga0207686_10014049 | |||
| 893 | Ga0207709_10033670 | |||
| 894 | Ga0207709_10355723 | |||
| 895 | Ga0207709_10374706 | |||
| 896 | Ga0207670_10046961 | |||
| 897 | Ga0207669_10125304 | |||
| 898 | Ga0207704_10141814 | |||
| 899 | Ga0207704_10357218 | |||
| 900 | Ga0207691_10036874 | |||
| 901 | Ga0207691_10039916 | |||
| 902 | Ga0207711_10100442 | |||
| 903 | Ga0207689_10031514 | |||
| 904 | Ga0207689_10239489 | |||
| 905 | Ga0207661_10019376 | |||
| 906 | Ga0207661_10118924 | |||
| 907 | Ga0207661_10183494 | |||
| 908 | Ga0207661_10449804 | |||
| 909 | Ga0207679_10022903 | |||
| 910 | Ga0207679_10111935 | |||
| 911 | Ga0207651_10843673 | |||
| 912 | Ga0207668_10668306 | |||
| 913 | Ga0207640_10009620 | |||
| 914 | Ga0207640_10287561 | |||
| 915 | Ga0207658_10383170 | |||
| 916 | Ga0207677_10109458 | |||
| 917 | Ga0207677_10124811 | |||
| 918 | Ga0207677_10435254 | |||
| 919 | Ga0207677_10595508 | |||
| 920 | Ga0207703_10529504 | |||
| 921 | Ga0207639_10114078 | |||
| 922 | Ga0207639_10337911 | |||
| 923 | Ga0207678_10149407 | |||
| 924 | Ga0207678_10177068 | |||
| 925 | Ga0207678_10357190 | |||
| 926 | Ga0207708_10030221 | |||
| 927 | Ga0207708_10124855 | |||
| 928 | Ga0207708_10512415 | |||
| 929 | Ga0207702_10093017 | |||
| 930 | Ga0207702_10344518 | |||
| 931 | Ga0207641_10420412 | |||
| 932 | Ga0207641_10702885 | |||
| 933 | Ga0207648_10013335 | |||
| 934 | Ga0207648_10043300 | |||
| 935 | Ga0207648_10253266 | |||
| 936 | Ga0207648_10264428 | |||
| 937 | Ga0207648_10284569 | |||
| 938 | Ga0207676_10039555 | |||
| 939 | Ga0207674_10063058 | |||
| 940 | Ga0207674_10164008 | |||
| 941 | Ga0207675_100093758 | |||
| 942 | Ga0207675_100420497 | |||
| 943 | Ga0207675_100645049 | |||
| 944 | Ga0207683_10017642 | |||
| 945 | Ga0207683_10060770 | |||
| 946 | Ga0207683_10088560 | |||
| 947 | Ga0207683_10101842 | |||
| 948 | Ga0207683_10715337 | |||
| 949 | Ga0207698_10019214 | |||
| 950 | Ga0207698_10271452 | |||
| 951 | Ga0207698_10386309 | |||
| 952 | Ga0207698_10522068 | |||
| 953 | Ga0207428_10009174 | |||
| 954 | Ga0207428_10015782 | |||
| 955 | Ga0207428_10051632 | |||
| 956 | Ga0207428_10130303 | |||
| 957 | Ga0268265_10392826 | |||
| 958 | Ga0307408_100155576 | |||
| 959 | Ga0307413_10351487 | |||
| 960 | Ga0307406_10628544 | |||
| 961 | Ga0307409_100093669 | |||
| 962 | Ga0307416_100378744 | |||
| 963 | Ga0307415_100136688 | |||
| 964 | Ga0373942_0019523 | |||
| 965 | Ga0373962_0008175 | |||
| 966 | Ga0373962_0033937 | |||
| 967 | Ga0373931_0364399 | |||
| 968 | Ga0395900_0098422 | |||
| 969 | Ga0395898_0475963 | |||
| 970 | Ga0395901_0004367 | |||
| 971 | Ga0439436_0026675 | |||
| 972 | Ga0439439_0000575 | |||
| 973 | Ga0451798_0937553 | |||
| 974 | Ga0451853_2954668 | |||
| 975 | Ga0439433_0018740 | |||
| 976 | Ga0439442_018559 | |||
| 977 | Ga0439445_0066601 | |||
| 978 | Ga0439449_0077256 | |||
| 979 | Ga0439457_040352 | |||
| 980 | Ga0439462_0005622 | |||
| 981 | Ga0439463_079597 | |||
| 982 | Ga0450920_017093 | |||
| 983 | Ga0450906_030573 | |||
| 984 | Ga0439446_0000832 | |||
| 985 | Ga0439446_0007119 | |||
| 986 | Ga0439446_0076530 | |||
| 987 | Ga0450908_010949 | |||
| 988 | Ga0439434_0007170 | |||
| 989 | Ga0439434_0011940 | |||
| 990 | Ga0439459_0058840 | |||
| 991 | Ga0450918_006012 | |||
| 992 | Ga0495603_0018393 | |||
| 993 | Ga0495641_0106849 | |||
| 994 | Ga0495651_0399530 | |||
| 995 | Ga0495605_0106960 | |||
| 996 | Ga0495584_0122043 | |||
| 997 | Ga0495596_0033470 | |||
| 998 | Ga0495644_0063197 | |||
| 999 | Ga0495644_0135021 | |||
| 1000 | Ga0495663_0190098 | |||
| 1001 | Ga0495667_0217177 | |||
| 1002 | Ga0495634_0144340 | |||
| 1003 | Ga0495670_0156350 | |||
| 1004 | Ga0495589_0151816 | |||
| 1005 | Ga0495600_0187518 | |||
| 1006 | Ga0495674_0117666 | |||
| 1007 | Ga0496100_0235862 | |||
| 1008 | Ga0496100_0650332 | |||
| 1009 | Ga0496101_0264616 | |||
| 1010 | Ga0496101_0821529 | |||
| 1011 | Ga0496101_0906263 | |||
| 1012 | Ga0496103_0253774 | |||
| 1013 | Ga0496104_0098299 | |||
| 1014 | Ga0496104_0175237 | |||
| 1015 | Ga0496104_0204351 | |||
| 1016 | Ga0496105_0366616 | |||
| 1017 | Ga0496105_0575407 | |||
| 1018 | Ga0496106_0239662 | |||
| 1019 | Ga0496106_0319991 | |||
| 1020 | Ga0496107_0171904 | |||
| 1021 | Ga0496107_0235755 | |||
| 1022 | Ga0496107_0749389 | |||
| 1023 | Ga0496108_0222591 | |||
| 1024 | Ga0496108_0299224 | |||
| 1025 | Ga0496108_0608698 | |||
| 1026 | Ga0496109_0014515 | |||
| 1027 | Ga0496109_0227297 | |||
| 1028 | Ga0496110_0001012 | |||
| 1029 | Ga0496110_0040698 | |||
| 1030 | Ga0496110_0049155 | |||
| 1031 | Ga0496110_0091556 | |||
| 1032 | Ga0496111_0016754 | |||
| 1033 | Ga0496111_0107527 | |||
| 1034 | Ga0496111_0241533 | |||
| 1035 | Ga0496111_0290862 | |||
| 1036 | Ga0496112_0052526 | |||
| 1037 | Ga0496112_0358369 | |||
| 1038 | Ga0496113_0250372 | |||
| 1039 | Ga0496114_0031231 | |||
| 1040 | Ga0496115_0483637 | |||
| 1041 | Ga0501031_0000606 | |||
| 1042 | Ga0501031_0007909 | |||
| 1043 | Ga0501031_0035463 | |||
| 1044 | Ga0501031_0042082 | |||
| 1045 | Ga0501031_0087817 | |||
| 1046 | Ga0501031_0134000 | |||
| 1047 | Ga0501031_0258020 | |||
| 1048 | Ga0501032_0025958 | |||
| 1049 | Ga0501032_0033124 | |||
| 1050 | Ga0501032_0405092 | |||
| 1051 | Ga0501033_0006070 | |||
| 1052 | Ga0501033_0008450 | |||
| 1053 | Ga0501033_0058623 | |||
| 1054 | Ga0501033_0103002 | |||
| 1055 | Ga0501033_0231941 | |||
| 1056 | Ga0501033_0487070 | |||
| 1057 | Ga0501034_0336113 | |||
| 1058 | Ga0501036_0001341 | |||
| 1059 | Ga0501036_0006649 | |||
| 1060 | Ga0501036_0012707 | |||
| 1061 | Ga0501036_0055348 | |||
| 1062 | Ga0501036_0078331 | |||
| 1063 | Ga0501036_0102127 | |||
| 1064 | Ga0501036_0137938 | |||
| 1065 | Ga0501036_0159180 | |||
| 1066 | Ga0501036_0251229 | |||
| 1067 | Ga0501036_0510416 | |||
| 1068 | Ga0501036_0920035 | |||
| 1069 | Ga0501037_0014381 | |||
| 1070 | Ga0501037_0055252 | |||
| 1071 | Ga0501037_0064551 | |||
| 1072 | Ga0501037_0175796 | |||
| 1073 | Ga0501037_0374388 | |||
| 1074 | Ga0501037_0469333 | |||
| 1075 | Ga0501038_0015192 | |||
| 1076 | Ga0501038_0025799 | |||
| 1077 | Ga0501038_0047611 | |||
| 1078 | Ga0501038_0214532 | |||
| 1079 | Ga0501038_0380352 | |||
| 1080 | Ga0501038_0439390 | |||
| 1081 | Ga0501038_0459201 | |||
| 1082 | Ga0501039_0001267 | |||
| 1083 | Ga0501039_0023011 | |||
| 1084 | Ga0501039_0205437 | |||
| 1085 | Ga0501039_0206711 | |||
| 1086 | Ga0501040_0004638 | |||
| 1087 | Ga0501040_0009087 | |||
| 1088 | Ga0501040_0010745 | |||
| 1089 | Ga0501040_0017926 | |||
| 1090 | Ga0501040_0018997 | |||
| 1091 | Ga0501040_0019001 | |||
| 1092 | Ga0501040_0028378 | |||
| 1093 | Ga0501040_0054816 | |||
| 1094 | Ga0501040_0163336 | |||
| 1095 | Ga0501040_0383719 | |||
| 1096 | Ga0501041_0001640 | |||
| 1097 | Ga0501041_0003389 | |||
| 1098 | Ga0501041_0009927 | |||
| 1099 | Ga0501041_0032552 | |||
| 1100 | Ga0501041_0032878 | |||
| 1101 | Ga0501041_0052888 | |||
| 1102 | Ga0501041_0057781 | |||
| 1103 | Ga0501041_0460464 | |||
| 1104 | Ga0501042_0004166 | |||
| 1105 | Ga0501042_0023793 | |||
| 1106 | Ga0501042_0047137 | |||
| 1107 | Ga0501042_0063627 | |||
| 1108 | Ga0501042_0071819 | |||
| 1109 | Ga0501042_0117208 | |||
| 1110 | Ga0501042_0217416 | |||
| 1111 | Ga0501042_0222912 | |||
| 1112 | Ga0501042_0502631 | |||
| 1113 | Ga0501043_0010486 | |||
| 1114 | Ga0501043_0018367 | |||
| 1115 | Ga0501043_0026438 | |||
| 1116 | Ga0501043_0090925 | |||
| 1117 | Ga0501043_0177584 | |||
| 1118 | Ga0501043_0224792 | |||
| 1119 | Ga0501043_0413215 | |||
| 1120 | Ga0501046_0000122 | |||
| 1121 | Ga0501046_0008606 | |||
| 1122 | Ga0501046_0084135 | |||
| 1123 | Ga0501046_0172965 | |||
| 1124 | Ga0501046_0286577 | |||
| 1125 | Ga0501048_0004582 | |||
| 1126 | Ga0501048_0013844 | |||
| 1127 | Ga0501048_0034167 | |||
| 1128 | Ga0501048_0036409 | |||
| 1129 | Ga0501048_0048466 | |||
| 1130 | Ga0501048_0075289 | |||
| 1131 | Ga0501048_0075431 | |||
| 1132 | Ga0501048_0197481 | |||
| 1133 | Ga0501048_0286900 | |||
| 1134 | Ga0501048_0402135 | |||
| 1135 | Ga0501067_0024495 | |||
| 1136 | Ga0501067_0033696 | |||
| 1137 | Ga0501067_0075672 | |||
| 1138 | Ga0501067_0110739 | |||
| 1139 | Ga0501068_0012575 | |||
| 1140 | Ga0501068_0042233 | |||
| 1141 | Ga0501068_0043349 | |||
| 1142 | Ga0501068_0076200 | |||
| 1143 | Ga0501068_0091688 | |||
| 1144 | Ga0501068_0197333 | |||
| 1145 | Ga0501068_0291290 | |||
| 1146 | Ga0501069_0026501 | |||
| 1147 | Ga0501069_0035471 | |||
| 1148 | Ga0501069_0040851 | |||
| 1149 | Ga0501069_0058046 | |||
| 1150 | Ga0501069_0117340 | |||
| 1151 | Ga0501069_0182773 | |||
| 1152 | Ga0501070_0005391 | |||
| 1153 | Ga0501070_0015181 | |||
| 1154 | Ga0501070_0025665 | |||
| 1155 | Ga0501070_0037359 | |||
| 1156 | Ga0501070_0108998 | |||
| 1157 | Ga0501070_0322079 | |||
| 1158 | Ga0501071_0001256 | |||
| 1159 | Ga0501071_0027643 | |||
| 1160 | Ga0501071_0029364 | |||
| 1161 | Ga0501071_0035200 | |||
| 1162 | Ga0501071_0047647 | |||
| 1163 | Ga0501071_0054999 | |||
| 1164 | Ga0501071_0067747 | |||
| 1165 | Ga0501071_0091792 | |||
| 1166 | Ga0501071_0161420 | |||
| 1167 | Ga0501071_0251953 | |||
| 1168 | Ga0501071_0379874 | |||
| 1169 | Ga0501072_0003792 | |||
| 1170 | Ga0501072_0009346 | |||
| 1171 | Ga0501072_0012610 | |||
| 1172 | Ga0501072_0022310 | |||
| 1173 | Ga0501072_0034426 | |||
| 1174 | Ga0501072_0087875 | |||
| 1175 | Ga0501072_0088211 | |||
| 1176 | Ga0501072_0132704 | |||
| 1177 | Ga0501072_0238376 | |||
| 1178 | Ga0501072_0247274 | |||
| 1179 | Ga0501072_0297278 | |||
| 1180 | Ga0501073_0008113 | |||
| 1181 | Ga0501073_0114426 | |||
| 1182 | Ga0501074_0014859 | |||
| 1183 | Ga0501074_0022359 | |||
| 1184 | Ga0501074_0105595 | |||
| 1185 | Ga0501074_0107354 | |||
| 1186 | Ga0501074_0132415 | |||
| 1187 | Ga0501074_0138161 | |||
| 1188 | Ga0501074_0178660 | |||
| 1189 | Ga0501074_0276565 | |||
| 1190 | Ga0501074_0414177 | |||
| 1191 | Ga0501075_0004358 | |||
| 1192 | Ga0501075_0006497 | |||
| 1193 | Ga0501075_0009552 | |||
| 1194 | Ga0501075_0017824 | |||
| 1195 | Ga0501075_0024853 | |||
| 1196 | Ga0501075_0031794 | |||
| 1197 | Ga0501075_0035874 | |||
| 1198 | Ga0501075_0037435 | |||
| 1199 | Ga0501075_0105444 | |||
| 1200 | Ga0501075_0256194 | |||
| 1201 | Ga0501075_0257349 | |||
| 1202 | Ga0501075_0389379 | |||
| 1203 | Ga0501076_0002557 | |||
| 1204 | Ga0501076_0019245 | |||
| 1205 | Ga0501076_0031889 | |||
| 1206 | Ga0501076_0048610 | |||
| 1207 | Ga0501076_0053670 | |||
| 1208 | Ga0501076_0060351 | |||
| 1209 | Ga0501076_0130191 | |||
| 1210 | Ga0501076_0146017 | |||
| 1211 | Ga0501076_0172378 | |||
| 1212 | Ga0501076_0223629 | |||
| 1213 | Ga0501076_0371424 | |||
| 1214 | Ga0501076_0497280 | |||
| 1215 | Ga0501077_0002372 | |||
| 1216 | Ga0501077_0006113 | |||
| 1217 | Ga0501077_0014636 | |||
| 1218 | Ga0501077_0018438 | |||
| 1219 | Ga0501077_0020432 | |||
| 1220 | Ga0501077_0024546 | |||
| 1221 | Ga0501077_0026466 | |||
| 1222 | Ga0501077_0105461 | |||
| 1223 | Ga0501077_0249834 | |||
| 1224 | Ga0501077_0251812 | |||
| 1225 | Ga0501077_0271418 | |||
| 1226 | Ga0501079_0003376 | |||
| 1227 | Ga0501079_0011749 | |||
| 1228 | Ga0501079_0014336 | |||
| 1229 | Ga0501079_0014569 | |||
| 1230 | Ga0501079_0022803 | |||
| 1231 | Ga0501079_0043908 | |||
| 1232 | Ga0501079_0126780 | |||
| 1233 | Ga0501079_0305451 | |||
| 1234 | Ga0501079_0520266 | |||
| 1235 | Ga0501079_0718339 | |||
| 1236 | Ga0501080_0001820 | |||
| 1237 | Ga0501080_0018503 | |||
| 1238 | Ga0501080_0033905 | |||
| 1239 | Ga0501080_0077938 | |||
| 1240 | Ga0501080_0095701 | |||
| 1241 | Ga0501080_0203397 | |||
| 1242 | Ga0501081_0026060 | |||
| 1243 | Ga0501081_0043957 | |||
| 1244 | Ga0501081_0044839 | |||
| 1245 | Ga0501081_0051971 | |||
| 1246 | Ga0501081_0064426 | |||
| 1247 | Ga0501081_0162934 | |||
| 1248 | Ga0501081_0179853 | |||
| 1249 | Ga0501081_0212744 | |||
| 1250 | Ga0501081_0553134 | |||
| 1251 | Ga0501083_0001412 | |||
| 1252 | Ga0501083_0009056 | |||
| 1253 | Ga0501083_0039260 | |||
| 1254 | Ga0501083_0056496 | |||
| 1255 | Ga0501083_0218050 | |||
| 1256 | Ga0501083_0231143 | |||
| 1257 | Ga0501035_0015492 | |||
| 1258 | Ga0501035_0048322 | |||
| 1259 | Ga0501035_0065121 | |||
| 1260 | Ga0501035_0119193 | |||
| 1261 | Ga0501035_0278049 | |||
| 1262 | Ga0501035_0300042 | |||
| 1263 | Ga0501035_0369229 | |||
| 1264 | Ga0501044_0008263 | |||
| 1265 | Ga0501044_0042191 | |||
| 1266 | Ga0501044_0077387 | |||
| 1267 | Ga0501045_0003659 | |||
| 1268 | Ga0501045_0008863 | |||
| 1269 | Ga0501045_0014960 | |||
| 1270 | Ga0501045_0024498 | |||
| 1271 | Ga0501045_0161245 | |||
| 1272 | Ga0501045_0194509 | |||
| 1273 | nmdc:mga0yw44_258940_c1 | |||
| 1274 | nmdc:mga0yw44_274059_c1 | |||
| 1275 | nmdc:mga05p37_120271_c1 | |||
| 1276 | nmdc:mga05p37_62787_c1 | |||
| 1277 | nmdc:mga05p37_8097_c1 | |||
| 1278 | nmdc:mga05p37_984270_c1 | |||
| 1279 | nmdc:mga09592_6854_c1 | |||
| 1280 | nmdc:mga06r32_81072_c1 | |||
| 1281 | nmdc:mga08y16_123837_c1 | |||
| 1282 | nmdc:mga08y16_21674_c1 | |||
| 1283 | nmdc:mga08y16_42813_c1 | |||
| 1284 | nmdc:mga08y16_62074_c1 | |||
| 1285 | nmdc:mga0n895_453610_c1 | |||
| 1286 | nmdc:mga0n895_52742_c1 | |||
| 1287 | nmdc:mga0n895_632370_c1 | |||
| 1288 | nmdc:mga0rr50_887482_c1 | |||
| 1289 | nmdc:mga08x19_109315_c1 | |||
| 1290 | nmdc:mga0a205_221043_c1 | |||
| 1291 | nmdc:mga0a205_31476_c1 | |||
| 1292 | nmdc:mga0a205_417643_c1 | |||
| 1293 | nmdc:mga0a205_60127_c1 | |||
| 1294 | Ga0495612_0042904 | |||
| 1295 | Ga0501084_0009851 | |||
| 1296 | Ga0501084_0014778 | |||
| 1297 | Ga0501084_0037668 | |||
| 1298 | Ga0501084_0065694 | |||
| 1299 | Ga0501084_0111464 | |||
| 1300 | Ga0501084_0390790 | |||
| 1301 | Ga0501084_0474364 | |||
| 1302 | Ga0501082_0003561 | |||
| 1303 | Ga0501082_0004532 | |||
| 1304 | Ga0501082_0021034 | |||
| 1305 | Ga0501082_0025354 | |||
| 1306 | Ga0501082_0040343 | |||
| 1307 | Ga0501082_0056851 | |||
| 1308 | Ga0501082_0071864 | |||
| 1309 | Ga0501082_0185009 | |||
| 1310 | Ga0501082_0188425 | |||
| 1311 | Ga0501082_0300010 | |||
| 1312 | Ga0501082_0479662 | |||
| 1313 | Ga0530510_0014204 | |||
| 1314 | Ga0530510_0040064 | |||
| 1315 | Ga0530510_0048882 | |||
| 1316 | Ga0530510_0051003 | |||
| 1317 | Ga0530510_0056942 | |||
| 1318 | Ga0530510_0101445 | |||
| 1319 | Ga0530510_0169817 | |||
| 1320 | Ga0530510_0267180 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5kvr-assembly1.cif.gz_A-2 | x-ray crystal structure of a fragment (1-75) of a transcriptional regulator pdhr from escherichia coli cft073 | 0.9175 | 22 | 84 |
| 4r1h-assembly1.cif.gz_B | gntr family transcriptional regulator from listeria monocytogenes | 0.8853 | 22 | 84 |
| 7b5y-assembly1.cif.gz_D | s. agalactiae busr in complex with its busab-promotor dna | 0.8769 | 23 | 84 |
| 4tv7-assembly2.cif.gz_D | crystal structure of bacillus subtilis gabr at 2.05 angstroms resolution | 0.8734 | 22 | 86 |
| 4tv7-assembly1.cif.gz_A | crystal structure of bacillus subtilis gabr at 2.05 angstroms resolution | 0.8685 | 22 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3sxyB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9689 | 24 | 84 | 1.10.10.10 |
| af_P0ACM2_11_76_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9536 | 22 | 84 | 1.10.10.10 |
| af_Q79G00_16_82_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9476 | 19 | 83 | 1.10.10.10 |
| 2hs5A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9446 | 21 | 84 | 1.10.10.10 |
| af_P31460_2_70_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9194 | 21 | 85 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-G9ZWH5-F1-model_v4 | Transcriptional regulator, GntR family | 0.918 | 22 | 223 |
GO:0003677
GO:0003700 |
| AF-A0A0J6D2I6-F1-model_v4 | HTH gntR-type domain-containing protein | 0.9068 | 23 | 217 |
GO:0003677
GO:0003700 |
| AF-A0A0M7A050-F1-model_v4 | Carbon starvation induced regulator | 0.9053 | 23 | 223 |
GO:0003677
GO:0003700 |
| AF-A0A2N3ANR7-F1-model_v4 | GntR family transcriptional regulator | 0.9051 | 14 | 223 |
GO:0003677
GO:0003700 |
| AF-A0A4R4RQ10-F1-model_v4 | GntR family transcriptional regulator | 0.9044 | 22 | 219 |
GO:0003677
GO:0003700 |