F473261
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 659 | 297 | 1318 | 329 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0087050|Ga0373937_0087050_421_1602 |
| Length | 393 |
| Sequence | VAADRVPLDRTAQPRTPVFEWACCSARRRGAGAPGGVFSYCLLSTTCGVQPAATTAQKEEYMMSKISSFFAFAAIAILLSAPADAQVTMRASHQFPGGKGDVRDDMVQMIAKDVGAANVGLTIQVYPGASLFKPNDQWNAIVNGQLDITLFPLDYASGKVPVFSATLMPGLIRSQDRAKRINNSPFMTDVRAEIEKHGAIVLSDAWFAGGVAAKGGCIVHPSDMKGRKLRAAGPTFAAMWESAGASIVSPPSNEIYNAFQSGVVNGTDTSLGTFQSMRLYEVTDCLTAPGNNALWFMYEPVLMSKKSFDKLNKAQQDAIIAAGKKAQAYYEGKADEVNKEAIKAFEDHKVKVVSLSDADYQAWLEVARKSSYAKFAQDVPNGQKLIDEALAVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 11 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 12 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 67 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 154 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 155 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 157 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 160 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 161 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 162 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 163 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 164 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 165 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 166 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 167 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 168 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 172 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 176 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 180 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 182 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 184 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 187 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 190 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 191 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 192 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 193 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 194 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 195 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 196 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 250 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 251 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 254 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 255 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 256 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 257 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 258 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 284 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 285 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 293 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 296 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 297 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.91 |
| Nodule | 0 |
| Rhizoplane | 3.34 |
| Rhizosphere | 95.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373937_0087050 | 3300036401 | Bacteria | 2891 |
| 2 | 2214911869 | 2209111006 | Bacteria | 6786 |
| 3 | ARcpr5oldR_c000029 | 3300000041 | Bacteria | 29077 |
| 4 | ARSoilYngRDRAFT_c00072 | 3300000042 | Bacteria | 16897 |
| 5 | ARcpr5yngRDRAFT_c000051 | 3300000043 | Bacteria | 18515 |
| 6 | ARSoilOldRDRAFT_c000078 | 3300000044 | Bacteria | 18538 |
| 7 | ARCol0oldRDRAFT_c00459 | 3300000045 | Bacteria | 3845 |
| 8 | ARCol0yngRDRAFT_1000056 | 3300000652 | Bacteria | 20075 |
| 9 | JGI24737J22298_10012020 | 3300001990 | Bacteria | 2827 |
| 10 | JGI25405J52794_10017317 | 3300003911 | Bacteria | 1430 |
| 11 | Ga0065717_1002104 | 3300005276 | Bacteria | 2915 |
| 12 | Ga0065716_1002476 | 3300005277 | Bacteria | 1756 |
| 13 | Ga0065704_10083802 | 3300005289 | Bacteria | 3415 |
| 14 | Ga0065715_10106453 | 3300005293 | Bacteria | 2829 |
| 15 | Ga0070658_10012028 | 3300005327 | Bacteria | 6951 |
| 16 | Ga0070658_10089225 | 3300005327 | Bacteria | 2539 |
| 17 | Ga0070658_10147435 | 3300005327 | Bacteria | 1968 |
| 18 | Ga0070676_10147513 | 3300005328 | Bacteria | 1503 |
| 19 | Ga0070683_100029663 | 3300005329 | Bacteria | 4957 |
| 20 | Ga0070683_100035510 | 3300005329 | Bacteria | 4556 |
| 21 | Ga0070683_100096539 | 3300005329 | Bacteria | 2780 |
| 22 | Ga0070680_100029424 | 3300005336 | Bacteria | 4413 |
| 23 | Ga0070680_100069612 | 3300005336 | Bacteria | 2889 |
| 24 | Ga0070680_100290154 | 3300005336 | Bacteria | 1387 |
| 25 | Ga0068868_100074621 | 3300005338 | Bacteria | 2709 |
| 26 | Ga0070660_100007264 | 3300005339 | Bacteria | 7714 |
| 27 | Ga0070660_100144635 | 3300005339 | Bacteria | 1909 |
| 28 | Ga0070691_10041412 | 3300005341 | Bacteria | 2178 |
| 29 | Ga0070661_100000534 | 3300005344 | Bacteria | 29159 |
| 30 | Ga0070661_100013055 | 3300005344 | Bacteria | 5825 |
| 31 | Ga0070692_10010043 | 3300005345 | Bacteria | 4294 |
| 32 | Ga0070692_10070074 | 3300005345 | Bacteria | 1866 |
| 33 | Ga0070669_100028908 | 3300005353 | Bacteria | 3994 |
| 34 | Ga0070675_100039583 | 3300005354 | Bacteria | 3847 |
| 35 | Ga0070688_100016727 | 3300005365 | Bacteria | 4199 |
| 36 | Ga0070688_100135663 | 3300005365 | Bacteria | 1666 |
| 37 | Ga0070659_100094240 | 3300005366 | Bacteria | 2404 |
| 38 | Ga0070667_100021395 | 3300005367 | Bacteria | 5371 |
| 39 | Ga0070667_100142260 | 3300005367 | Bacteria | 2102 |
| 40 | Ga0070703_10009780 | 3300005406 | Bacteria | 2703 |
| 41 | Ga0070709_10008931 | 3300005434 | Bacteria | 5517 |
| 42 | Ga0070709_10144689 | 3300005434 | Bacteria | 1636 |
| 43 | Ga0070714_100004852 | 3300005435 | Bacteria | 10210 |
| 44 | Ga0070714_100071605 | 3300005435 | Bacteria | 2998 |
| 45 | Ga0070714_100075499 | 3300005435 | Bacteria | 2924 |
| 46 | Ga0070714_100245884 | 3300005435 | Bacteria | 1653 |
| 47 | Ga0070713_100015251 | 3300005436 | Bacteria | 5734 |
| 48 | Ga0070713_100035154 | 3300005436 | Bacteria | 4031 |
| 49 | Ga0070713_100043614 | 3300005436 | Bacteria | 3668 |
| 50 | Ga0070713_100165511 | 3300005436 | Bacteria | 1977 |
| 51 | Ga0070713_100233619 | 3300005436 | Bacteria | 1672 |
| 52 | Ga0070710_10043415 | 3300005437 | Bacteria | 2490 |
| 53 | Ga0070710_10257431 | 3300005437 | Bacteria | 1124 |
| 54 | Ga0070711_100021985 | 3300005439 | Bacteria | 4130 |
| 55 | Ga0070711_100046980 | 3300005439 | Bacteria | 2944 |
| 56 | Ga0070711_100048137 | 3300005439 | Bacteria | 2913 |
| 57 | Ga0070694_100102197 | 3300005444 | Bacteria | 2029 |
| 58 | Ga0070663_100069216 | 3300005455 | Bacteria | 2563 |
| 59 | Ga0070681_10004821 | 3300005458 | Bacteria | 12928 |
| 60 | Ga0070681_10060239 | 3300005458 | Bacteria | 3774 |
| 61 | Ga0070681_10066993 | 3300005458 | Bacteria | 3559 |
| 62 | Ga0070681_10104672 | 3300005458 | Bacteria | 2772 |
| 63 | Ga0074259_12105788 | 3300005507 | Bacteria | 1310 |
| 64 | Ga0070699_100015846 | 3300005518 | Bacteria | 6470 |
| 65 | Ga0070679_100011066 | 3300005530 | Bacteria | 8583 |
| 66 | Ga0070679_100016685 | 3300005530 | Bacteria | 7093 |
| 67 | Ga0070679_100017604 | 3300005530 | Bacteria | 6917 |
| 68 | Ga0070679_100065636 | 3300005530 | Bacteria | 3617 |
| 69 | Ga0070679_100111202 | 3300005530 | Bacteria | 2726 |
| 70 | Ga0070679_100186321 | 3300005530 | Bacteria | 2046 |
| 71 | Ga0070684_100008632 | 3300005535 | Bacteria | 7983 |
| 72 | Ga0070684_100022129 | 3300005535 | Bacteria | 5299 |
| 73 | Ga0070684_100076053 | 3300005535 | Bacteria | 2963 |
| 74 | Ga0068853_100004769 | 3300005539 | Bacteria | 10539 |
| 75 | Ga0068853_100010929 | 3300005539 | Bacteria | 7359 |
| 76 | Ga0070672_100073562 | 3300005543 | Bacteria | 2724 |
| 77 | Ga0070672_100342037 | 3300005543 | Bacteria | 1274 |
| 78 | Ga0070686_100034533 | 3300005544 | Bacteria | 3117 |
| 79 | Ga0070695_100002680 | 3300005545 | Bacteria | 10305 |
| 80 | Ga0070696_100001722 | 3300005546 | Bacteria | 14339 |
| 81 | Ga0070696_100027300 | 3300005546 | Bacteria | 3888 |
| 82 | Ga0070696_100094394 | 3300005546 | Bacteria | 2135 |
| 83 | Ga0070704_100019446 | 3300005549 | Bacteria | 4363 |
| 84 | Ga0068855_100007766 | 3300005563 | Bacteria | 12955 |
| 85 | Ga0068855_100008252 | 3300005563 | Bacteria | 12590 |
| 86 | Ga0068855_100069930 | 3300005563 | Bacteria | 4084 |
| 87 | Ga0068855_100073898 | 3300005563 | Bacteria | 3960 |
| 88 | Ga0068855_100192890 | 3300005563 | Bacteria | 2297 |
| 89 | Ga0068855_100217464 | 3300005563 | Bacteria | 2144 |
| 90 | Ga0070664_100001929 | 3300005564 | Bacteria | 16665 |
| 91 | Ga0068857_100001319 | 3300005577 | Bacteria | 19521 |
| 92 | Ga0068857_100115620 | 3300005577 | Bacteria | 2413 |
| 93 | Ga0068857_100117321 | 3300005577 | Bacteria | 2395 |
| 94 | Ga0068857_100254726 | 3300005577 | Bacteria | 1610 |
| 95 | Ga0068854_100016881 | 3300005578 | Bacteria | 4875 |
| 96 | Ga0068854_100050830 | 3300005578 | Bacteria | 2968 |
| 97 | Ga0068854_100170336 | 3300005578 | Bacteria | 1694 |
| 98 | Ga0068856_100003061 | 3300005614 | Bacteria | 17098 |
| 99 | Ga0068856_100138006 | 3300005614 | Bacteria | 2444 |
| 100 | Ga0068856_100177033 | 3300005614 | Bacteria | 2146 |
| 101 | Ga0070702_100025455 | 3300005615 | Bacteria | 3171 |
| 102 | Ga0068852_100000554 | 3300005616 | Bacteria | 24527 |
| 103 | Ga0068852_100002959 | 3300005616 | Bacteria | 11801 |
| 104 | Ga0068852_100004557 | 3300005616 | Bacteria | 9813 |
| 105 | Ga0068852_100083301 | 3300005616 | Bacteria | 2844 |
| 106 | Ga0068852_100086236 | 3300005616 | Bacteria | 2798 |
| 107 | Ga0068852_100233337 | 3300005616 | Bacteria | 1755 |
| 108 | Ga0068859_100291001 | 3300005617 | Bacteria | 1726 |
| 109 | Ga0068861_100019068 | 3300005719 | Bacteria | 4897 |
| 110 | Ga0068851_10008121 | 3300005834 | Bacteria | 4844 |
| 111 | Ga0068863_100301324 | 3300005841 | Bacteria | 1555 |
| 112 | Ga0068858_100024666 | 3300005842 | Bacteria | 5600 |
| 113 | Ga0068858_100140765 | 3300005842 | Bacteria | 2265 |
| 114 | Ga0068860_100034634 | 3300005843 | Bacteria | 4844 |
| 115 | Ga0068862_100016334 | 3300005844 | Bacteria | 6178 |
| 116 | Ga0081455_10010000 | 3300005937 | Bacteria | 9697 |
| 117 | Ga0081540_1003907 | 3300005983 | Bacteria | 11608 |
| 118 | Ga0075365_10025911 | 3300006038 | Bacteria | 3716 |
| 119 | Ga0075364_10148885 | 3300006051 | Bacteria | 1577 |
| 120 | Ga0075432_10055282 | 3300006058 | Bacteria | 1406 |
| 121 | Ga0070715_10118308 | 3300006163 | Bacteria | 1260 |
| 122 | Ga0070712_100014927 | 3300006175 | Bacteria | 4994 |
| 123 | Ga0097621_100040496 | 3300006237 | Bacteria | 3746 |
| 124 | Ga0097621_100097801 | 3300006237 | Bacteria | 2465 |
| 125 | Ga0075370_10038270 | 3300006353 | Bacteria | 2699 |
| 126 | Ga0068871_100009241 | 3300006358 | Bacteria | 7130 |
| 127 | Ga0068871_100028870 | 3300006358 | Bacteria | 4353 |
| 128 | Ga0097620_100291019 | 3300006931 | Bacteria | 1726 |
| 129 | Ga0105240_10002585 | 3300009093 | Bacteria | 28988 |
| 130 | Ga0105240_10007789 | 3300009093 | Bacteria | 15482 |
| 131 | Ga0105240_10026466 | 3300009093 | Bacteria | 7611 |
| 132 | Ga0105240_10053422 | 3300009093 | Bacteria | 5070 |
| 133 | Ga0111539_10007739 | 3300009094 | Bacteria | 13721 |
| 134 | Ga0105245_10102254 | 3300009098 | Bacteria | 2654 |
| 135 | Ga0105247_10013648 | 3300009101 | Bacteria | 4873 |
| 136 | Ga0105247_10047888 | 3300009101 | Bacteria | 2626 |
| 137 | Ga0105243_10009481 | 3300009148 | Bacteria | 7411 |
| 138 | Ga0105241_10013737 | 3300009174 | Bacteria | 5931 |
| 139 | Ga0105241_10033974 | 3300009174 | Bacteria | 3831 |
| 140 | Ga0105242_10003746 | 3300009176 | Bacteria | 11815 |
| 141 | Ga0105248_10008602 | 3300009177 | Bacteria | 11211 |
| 142 | Ga0105237_10162124 | 3300009545 | Bacteria | 2235 |
| 143 | Ga0105238_10005650 | 3300009551 | Bacteria | 12365 |
| 144 | Ga0105238_10009355 | 3300009551 | Bacteria | 9813 |
| 145 | Ga0105238_10018906 | 3300009551 | Bacteria | 7017 |
| 146 | Ga0105238_10156841 | 3300009551 | Bacteria | 2251 |
| 147 | Ga0105238_10198599 | 3300009551 | Bacteria | 1981 |
| 148 | Ga0105238_10266416 | 3300009551 | Bacteria | 1693 |
| 149 | Ga0105249_10006636 | 3300009553 | Bacteria | 10070 |
| 150 | Ga0105246_10014859 | 3300011119 | Bacteria | 4904 |
| 151 | Ga0157315_1000484 | 3300012508 | Bacteria | 1851 |
| 152 | Ga0157373_10091002 | 3300013100 | Bacteria | 2148 |
| 153 | Ga0157373_10119000 | 3300013100 | Bacteria | 1856 |
| 154 | Ga0157371_10019442 | 3300013102 | Bacteria | 5010 |
| 155 | Ga0157371_10041023 | 3300013102 | Bacteria | 3304 |
| 156 | Ga0157371_10102975 | 3300013102 | Bacteria | 2026 |
| 157 | Ga0157370_10001270 | 3300013104 | Bacteria | 31545 |
| 158 | Ga0157370_10003871 | 3300013104 | Bacteria | 17431 |
| 159 | Ga0157370_10009975 | 3300013104 | Bacteria | 10050 |
| 160 | Ga0157370_10020607 | 3300013104 | Bacteria | 6582 |
| 161 | Ga0157370_10061699 | 3300013104 | Bacteria | 3558 |
| 162 | Ga0157370_10136016 | 3300013104 | Bacteria | 2291 |
| 163 | Ga0157370_10160929 | 3300013104 | Bacteria | 2089 |
| 164 | Ga0157370_10238178 | 3300013104 | Bacteria | 1684 |
| 165 | Ga0157369_10000895 | 3300013105 | Bacteria | 38049 |
| 166 | Ga0157369_10002601 | 3300013105 | Bacteria | 21597 |
| 167 | Ga0157369_10113846 | 3300013105 | Bacteria | 2873 |
| 168 | Ga0157369_10196083 | 3300013105 | Bacteria | 2121 |
| 169 | Ga0157369_10399800 | 3300013105 | Bacteria | 1425 |
| 170 | Ga0157374_10081300 | 3300013296 | Bacteria | 3075 |
| 171 | Ga0157374_10154841 | 3300013296 | Bacteria | 2230 |
| 172 | Ga0157378_10302397 | 3300013297 | Bacteria | 1548 |
| 173 | Ga0163162_10021249 | 3300013306 | Bacteria | 6388 |
| 174 | Ga0163162_10056217 | 3300013306 | Bacteria | 3964 |
| 175 | Ga0163162_10114262 | 3300013306 | Bacteria | 2799 |
| 176 | Ga0163162_10241467 | 3300013306 | Bacteria | 1937 |
| 177 | Ga0157372_10004580 | 3300013307 | Bacteria | 14701 |
| 178 | Ga0157372_10022454 | 3300013307 | Bacteria | 6829 |
| 179 | Ga0157372_10027347 | 3300013307 | Bacteria | 6210 |
| 180 | Ga0157372_10034933 | 3300013307 | Bacteria | 5532 |
| 181 | Ga0157372_10126363 | 3300013307 | Bacteria | 2940 |
| 182 | Ga0157372_10232687 | 3300013307 | Bacteria | 2136 |
| 183 | Ga0157375_10015977 | 3300013308 | Bacteria | 6733 |
| 184 | Ga0157375_10154689 | 3300013308 | Bacteria | 2431 |
| 185 | Ga0163163_10000757 | 3300014325 | Bacteria | 27476 |
| 186 | Ga0163163_10001222 | 3300014325 | Bacteria | 21707 |
| 187 | Ga0157380_10038881 | 3300014326 | Bacteria | 3696 |
| 188 | Ga0157377_10030644 | 3300014745 | Bacteria | 2916 |
| 189 | Ga0157377_10169037 | 3300014745 | Bacteria | 1366 |
| 190 | Ga0157379_10134030 | 3300014968 | Bacteria | 2231 |
| 191 | Ga0157379_10245781 | 3300014968 | Bacteria | 1623 |
| 192 | Ga0157376_10041184 | 3300014969 | Bacteria | 3781 |
| 193 | Ga0157376_10247744 | 3300014969 | Bacteria | 1663 |
| 194 | Ga0207666_1000343 | 3300025271 | Bacteria | 6396 |
| 195 | Ga0207697_10007410 | 3300025315 | Bacteria | 4897 |
| 196 | Ga0207656_10088259 | 3300025321 | Bacteria | 1404 |
| 197 | Ga0207692_10004582 | 3300025898 | Bacteria | 5481 |
| 198 | Ga0207688_10004300 | 3300025901 | Bacteria | 7767 |
| 199 | Ga0207680_10266326 | 3300025903 | Bacteria | 1187 |
| 200 | Ga0207647_10047471 | 3300025904 | Bacteria | 2671 |
| 201 | Ga0207699_10052120 | 3300025906 | Bacteria | 2421 |
| 202 | Ga0207645_10040159 | 3300025907 | Bacteria | 2997 |
| 203 | Ga0207705_10016504 | 3300025909 | Bacteria | 5290 |
| 204 | Ga0207705_10019680 | 3300025909 | Bacteria | 4827 |
| 205 | Ga0207705_10060216 | 3300025909 | Bacteria | 2742 |
| 206 | Ga0207705_10102758 | 3300025909 | Bacteria | 2104 |
| 207 | Ga0207654_10023112 | 3300025911 | Bacteria | 3326 |
| 208 | Ga0207654_10023523 | 3300025911 | Bacteria | 3301 |
| 209 | Ga0207654_10128529 | 3300025911 | Bacteria | 1601 |
| 210 | Ga0207707_10011542 | 3300025912 | Bacteria | 7692 |
| 211 | Ga0207707_10028062 | 3300025912 | Bacteria | 4920 |
| 212 | Ga0207707_10194815 | 3300025912 | Bacteria | 1768 |
| 213 | Ga0207707_10264712 | 3300025912 | Bacteria | 1491 |
| 214 | Ga0207707_10457711 | 3300025912 | Bacteria | 1091 |
| 215 | Ga0207695_10004433 | 3300025913 | Bacteria | 19160 |
| 216 | Ga0207695_10017259 | 3300025913 | Bacteria | 8404 |
| 217 | Ga0207695_10032370 | 3300025913 | Bacteria | 5722 |
| 218 | Ga0207695_10096789 | 3300025913 | Bacteria | 2953 |
| 219 | Ga0207695_10130049 | 3300025913 | Bacteria | 2476 |
| 220 | Ga0207671_10060402 | 3300025914 | Bacteria | 2812 |
| 221 | Ga0207693_10026873 | 3300025915 | Bacteria | 4552 |
| 222 | Ga0207663_10108042 | 3300025916 | Bacteria | 1883 |
| 223 | Ga0207660_10047796 | 3300025917 | Bacteria | 3027 |
| 224 | Ga0207660_10195634 | 3300025917 | Bacteria | 1577 |
| 225 | Ga0207660_10223221 | 3300025917 | Bacteria | 1479 |
| 226 | Ga0207662_10208455 | 3300025918 | Bacteria | 1268 |
| 227 | Ga0207657_10009889 | 3300025919 | Bacteria | 9548 |
| 228 | Ga0207657_10133464 | 3300025919 | Bacteria | 2033 |
| 229 | Ga0207657_10262520 | 3300025919 | Bacteria | 1374 |
| 230 | Ga0207649_10002364 | 3300025920 | Bacteria | 10572 |
| 231 | Ga0207649_10019384 | 3300025920 | Bacteria | 3887 |
| 232 | Ga0207649_10032953 | 3300025920 | Bacteria | 3092 |
| 233 | Ga0207652_10008705 | 3300025921 | Bacteria | 8168 |
| 234 | Ga0207652_10041447 | 3300025921 | Bacteria | 3914 |
| 235 | Ga0207652_10062760 | 3300025921 | Bacteria | 3211 |
| 236 | Ga0207652_10070843 | 3300025921 | Bacteria | 3028 |
| 237 | Ga0207652_10092261 | 3300025921 | Bacteria | 2664 |
| 238 | Ga0207646_10077035 | 3300025922 | Bacteria | 2980 |
| 239 | Ga0207681_10066864 | 3300025923 | Bacteria | 2489 |
| 240 | Ga0207681_10319148 | 3300025923 | Bacteria | 1235 |
| 241 | Ga0207694_10002378 | 3300025924 | Bacteria | 15389 |
| 242 | Ga0207694_10014709 | 3300025924 | Bacteria | 5900 |
| 243 | Ga0207694_10035460 | 3300025924 | Bacteria | 3827 |
| 244 | Ga0207694_10058866 | 3300025924 | Bacteria | 2988 |
| 245 | Ga0207694_10085831 | 3300025924 | Bacteria | 2478 |
| 246 | Ga0207659_10065689 | 3300025926 | Bacteria | 2630 |
| 247 | Ga0207687_10022697 | 3300025927 | Bacteria | 4179 |
| 248 | Ga0207687_10233088 | 3300025927 | Bacteria | 1455 |
| 249 | Ga0207700_10137977 | 3300025928 | Bacteria | 2000 |
| 250 | Ga0207700_10212529 | 3300025928 | Bacteria | 1636 |
| 251 | Ga0207664_10003344 | 3300025929 | Bacteria | 10662 |
| 252 | Ga0207664_10007925 | 3300025929 | Bacteria | 7381 |
| 253 | Ga0207664_10023865 | 3300025929 | Bacteria | 4589 |
| 254 | Ga0207690_10094227 | 3300025932 | Bacteria | 2124 |
| 255 | Ga0207690_10107839 | 3300025932 | Bacteria | 2001 |
| 256 | Ga0207690_10136275 | 3300025932 | Bacteria | 1803 |
| 257 | Ga0207706_10007810 | 3300025933 | Bacteria | 9874 |
| 258 | Ga0207686_10017403 | 3300025934 | Bacteria | 4050 |
| 259 | Ga0207686_10064900 | 3300025934 | Bacteria | 2326 |
| 260 | Ga0207686_10241750 | 3300025934 | Bacteria | 1314 |
| 261 | Ga0207709_10092973 | 3300025935 | Bacteria | 1976 |
| 262 | Ga0207665_10242423 | 3300025939 | Bacteria | 1329 |
| 263 | Ga0207711_10067338 | 3300025941 | Bacteria | 3099 |
| 264 | Ga0207711_10116633 | 3300025941 | Bacteria | 2381 |
| 265 | Ga0207661_10081182 | 3300025944 | Bacteria | 2678 |
| 266 | Ga0207661_10259003 | 3300025944 | Bacteria | 1549 |
| 267 | Ga0207667_10001311 | 3300025949 | Bacteria | 31212 |
| 268 | Ga0207667_10018592 | 3300025949 | Bacteria | 7788 |
| 269 | Ga0207667_10038687 | 3300025949 | Bacteria | 5090 |
| 270 | Ga0207667_10048328 | 3300025949 | Bacteria | 4499 |
| 271 | Ga0207667_10065695 | 3300025949 | Bacteria | 3783 |
| 272 | Ga0207667_10070130 | 3300025949 | Bacteria | 3648 |
| 273 | Ga0207667_10142924 | 3300025949 | Bacteria | 2464 |
| 274 | Ga0207667_10152458 | 3300025949 | Bacteria | 2378 |
| 275 | Ga0207668_10140812 | 3300025972 | Bacteria | 1855 |
| 276 | Ga0207640_10042585 | 3300025981 | Bacteria | 2896 |
| 277 | Ga0207640_10154434 | 3300025981 | Bacteria | 1690 |
| 278 | Ga0207658_10011174 | 3300025986 | Bacteria | 6116 |
| 279 | Ga0207658_10112167 | 3300025986 | Bacteria | 2158 |
| 280 | Ga0207703_10047022 | 3300026035 | Bacteria | 3478 |
| 281 | Ga0207703_10108888 | 3300026035 | Bacteria | 2360 |
| 282 | Ga0207703_10390416 | 3300026035 | Bacteria | 1289 |
| 283 | Ga0207639_10016878 | 3300026041 | Bacteria | 5173 |
| 284 | Ga0207639_10132234 | 3300026041 | Bacteria | 2067 |
| 285 | Ga0207639_10225641 | 3300026041 | Bacteria | 1621 |
| 286 | Ga0207678_10012696 | 3300026067 | Bacteria | 7399 |
| 287 | Ga0207708_10004283 | 3300026075 | Bacteria | 10507 |
| 288 | Ga0207702_10002277 | 3300026078 | Bacteria | 18412 |
| 289 | Ga0207702_10105381 | 3300026078 | Bacteria | 2497 |
| 290 | Ga0207641_10193239 | 3300026088 | Bacteria | 1872 |
| 291 | Ga0207674_10000039 | 3300026116 | Bacteria | 131096 |
| 292 | Ga0207674_10092964 | 3300026116 | Bacteria | 3005 |
| 293 | Ga0207674_10146800 | 3300026116 | Bacteria | 2317 |
| 294 | Ga0207675_100015653 | 3300026118 | Bacteria | 7073 |
| 295 | Ga0207698_10003989 | 3300026142 | Bacteria | 8953 |
| 296 | Ga0207698_10011251 | 3300026142 | Bacteria | 5792 |
| 297 | Ga0207698_10019968 | 3300026142 | Bacteria | 4601 |
| 298 | Ga0207698_10405485 | 3300026142 | Bacteria | 1304 |
| 299 | Ga0209966_1002877 | 3300027695 | Bacteria | 2886 |
| 300 | Ga0209998_10000758 | 3300027717 | Bacteria | 8460 |
| 301 | Ga0207428_10014000 | 3300027907 | Bacteria | 6986 |
| 302 | Ga0268264_10069274 | 3300028381 | Bacteria | 2983 |
| 303 | Ga0265338_10033308 | 3300028800 | Bacteria | 5002 |
| 304 | Ga0265338_10098428 | 3300028800 | Bacteria | 2393 |
| 305 | Ga0265325_10000004 | 3300031241 | Bacteria | 347347 |
| 306 | Ga0265325_10034833 | 3300031241 | Bacteria | 2676 |
| 307 | Ga0265325_10043495 | 3300031241 | Bacteria | 2343 |
| 308 | Ga0265325_10048228 | 3300031241 | Bacteria | 2202 |
| 309 | Ga0265325_10086133 | 3300031241 | Bacteria | 1555 |
| 310 | Ga0265340_10025334 | 3300031247 | Bacteria | 3004 |
| 311 | Ga0265339_10010467 | 3300031249 | Bacteria | 5761 |
| 312 | Ga0265316_10066828 | 3300031344 | Bacteria | 2781 |
| 313 | Ga0265313_10009264 | 3300031595 | Bacteria | 6412 |
| 314 | Ga0265313_10048143 | 3300031595 | Bacteria | 2059 |
| 315 | Ga0265314_10016876 | 3300031711 | Bacteria | 5752 |
| 316 | Ga0265342_10000182 | 3300031712 | Bacteria | 70252 |
| 317 | Ga0307405_10072929 | 3300031731 | Bacteria | 2215 |
| 318 | Ga0373930_0000532 | 3300034816 | Bacteria | 5242 |
| 319 | Ga0373948_0000419 | 3300034817 | Bacteria | 5248 |
| 320 | Ga0373950_0000167 | 3300034818 | Bacteria | 9380 |
| 321 | Ga0373958_0002350 | 3300034819 | Bacteria | 2638 |
| 322 | Ga0373938_0000028 | 3300034957 | Bacteria | 18996 |
| 323 | Ga0373928_0000334 | 3300035084 | Bacteria | 9420 |
| 324 | Ga0373929_0001866 | 3300035085 | Bacteria | 3948 |
| 325 | Ga0373934_0001517 | 3300035086 | Bacteria | 8514 |
| 326 | Ga0373934_0005199 | 3300035086 | Bacteria | 4815 |
| 327 | Ga0373934_0012356 | 3300035086 | Bacteria | 3224 |
| 328 | Ga0373934_0013164 | 3300035086 | Bacteria | 3124 |
| 329 | Ga0373949_0001620 | 3300035090 | Bacteria | 6293 |
| 330 | Ga0373951_0000666 | 3300035091 | Bacteria | 9448 |
| 331 | Ga0373952_0000851 | 3300035092 | Bacteria | 5544 |
| 332 | Ga0373923_0024586 | 3300035111 | Bacteria | 2378 |
| 333 | Ga0373923_0049411 | 3300035111 | Bacteria | 1759 |
| 334 | Ga0373932_0000749 | 3300035112 | Bacteria | 9676 |
| 335 | Ga0373936_0005568 | 3300035113 | Bacteria | 4751 |
| 336 | Ga0373939_0001838 | 3300035114 | Bacteria | 5105 |
| 337 | Ga0373939_0016499 | 3300035114 | Bacteria | 1948 |
| 338 | Ga0373941_0000671 | 3300035115 | Bacteria | 6933 |
| 339 | Ga0373941_0005651 | 3300035115 | Bacteria | 2960 |
| 340 | Ga0373945_0053045 | 3300035116 | Bacteria | 1496 |
| 341 | Ga0373945_0097102 | 3300035116 | Bacteria | 1149 |
| 342 | Ga0373953_0008219 | 3300035117 | Bacteria | 3533 |
| 343 | Ga0373953_0012296 | 3300035117 | Bacteria | 3027 |
| 344 | Ga0373953_0019942 | 3300035117 | Bacteria | 2501 |
| 345 | Ga0373954_0000002 | 3300035118 | Bacteria | 147478 |
| 346 | Ga0373954_0003738 | 3300035118 | Bacteria | 6489 |
| 347 | Ga0373954_0006044 | 3300035118 | Bacteria | 5266 |
| 348 | Ga0373954_0007284 | 3300035118 | Bacteria | 4836 |
| 349 | Ga0373954_0014031 | 3300035118 | Bacteria | 3571 |
| 350 | Ga0373956_0000945 | 3300035119 | Bacteria | 12079 |
| 351 | Ga0373956_0002179 | 3300035119 | Bacteria | 8087 |
| 352 | Ga0373956_0019484 | 3300035119 | Bacteria | 2877 |
| 353 | Ga0373956_0107005 | 3300035119 | Bacteria | 1300 |
| 354 | Ga0373957_0000339 | 3300035120 | Bacteria | 11828 |
| 355 | Ga0373957_0002968 | 3300035120 | Bacteria | 4921 |
| 356 | Ga0373957_0003036 | 3300035120 | Bacteria | 4882 |
| 357 | Ga0373957_0024413 | 3300035120 | Bacteria | 2171 |
| 358 | Ga0373960_0000599 | 3300035121 | Bacteria | 7394 |
| 359 | Ga0373955_0001962 | 3300035172 | Bacteria | 8862 |
| 360 | Ga0373955_0014629 | 3300035172 | Bacteria | 3822 |
| 361 | Ga0373955_0028909 | 3300035172 | Bacteria | 2878 |
| 362 | Ga0373955_0034110 | 3300035172 | Bacteria | 2684 |
| 363 | Ga0373955_0064377 | 3300035172 | Bacteria | 2032 |
| 364 | Ga0373955_0081179 | 3300035172 | Bacteria | 1833 |
| 365 | Ga0373942_0005239 | 3300035207 | Bacteria | 3003 |
| 366 | Ga0373961_0000433 | 3300035241 | Bacteria | 17272 |
| 367 | Ga0373962_0000881 | 3300035242 | Bacteria | 6853 |
| 368 | Ga0373924_0004417 | 3300035410 | Bacteria | 4909 |
| 369 | Ga0373924_0025366 | 3300035410 | Bacteria | 2344 |
| 370 | Ga0373924_0057243 | 3300035410 | Bacteria | 1625 |
| 371 | Ga0373924_0117377 | 3300035410 | Bacteria | 1153 |
| 372 | Ga0373935_0026607 | 3300035692 | Bacteria | 3572 |
| 373 | Ga0373935_0057754 | 3300035692 | Bacteria | 2476 |
| 374 | Ga0373935_0157622 | 3300035692 | Bacteria | 1545 |
| 375 | Ga0373935_0296636 | 3300035692 | Bacteria | 1141 |
| 376 | Ga0373927_0003675 | 3300035695 | Bacteria | 10916 |
| 377 | Ga0373927_0093708 | 3300035695 | Bacteria | 1951 |
| 378 | Ga0373927_0288887 | 3300035695 | Bacteria | 1079 |
| 379 | Ga0373933_0000890 | 3300035724 | Bacteria | 18271 |
| 380 | Ga0373933_0001687 | 3300035724 | Bacteria | 12853 |
| 381 | Ga0373933_0001764 | 3300035724 | Bacteria | 12529 |
| 382 | Ga0373933_0002111 | 3300035724 | Bacteria | 11412 |
| 383 | Ga0373933_0005461 | 3300035724 | Bacteria | 6922 |
| 384 | Ga0373933_0011582 | 3300035724 | Bacteria | 4865 |
| 385 | Ga0373933_0041104 | 3300035724 | Bacteria | 2728 |
| 386 | Ga0373933_0042536 | 3300035724 | Bacteria | 2685 |
| 387 | Ga0373947_0063299 | 3300035725 | Bacteria | 2253 |
| 388 | Ga0373947_0100781 | 3300035725 | Bacteria | 1815 |
| 389 | Ga0373947_0115514 | 3300035725 | Bacteria | 1701 |
| 390 | Ga0373947_0195698 | 3300035725 | Unclassified | 1321 |
| 391 | Ga0373947_0203572 | 3300035725 | Bacteria | 1296 |
| 392 | Ga0373937_0001304 | 3300036401 | Bacteria | 20884 |
| 393 | Ga0373937_0001794 | 3300036401 | Bacteria | 18033 |
| 394 | Ga0373937_0004227 | 3300036401 | Bacteria | 12173 |
| 395 | Ga0373937_0005332 | 3300036401 | Bacteria | 10992 |
| 396 | Ga0373937_0006421 | 3300036401 | Bacteria | 10147 |
| 397 | Ga0373937_0007322 | 3300036401 | Bacteria | 9554 |
| 398 | Ga0373937_0009035 | 3300036401 | Bacteria | 8651 |
| 399 | Ga0373937_0027575 | 3300036401 | Bacteria | 5136 |
| 400 | Ga0373937_0035972 | 3300036401 | Bacteria | 4510 |
| 401 | Ga0373937_0197854 | 3300036401 | Bacteria | 1889 |
| 402 | Ga0439465_0047164 | 3300041413 | Bacteria | 1404 |
| 403 | Ga0451853_1695856 | 3300041512 | Bacteria | 1978 |
| 404 | Ga0453684_0140242 | 3300044712 | Bacteria | 2888 |
| 405 | Ga0451576_0065472 | 3300045051 | Bacteria | 3784 |
| 406 | Ga0495617_024276 | 3300046452 | Bacteria | 2046 |
| 407 | Ga0495592_0000589 | 3300046454 | Bacteria | 25846 |
| 408 | Ga0495592_0002245 | 3300046454 | Bacteria | 13625 |
| 409 | Ga0495592_0028842 | 3300046454 | Bacteria | 4200 |
| 410 | Ga0495592_0040216 | 3300046454 | Bacteria | 3509 |
| 411 | Ga0495592_0075908 | 3300046454 | Bacteria | 2440 |
| 412 | Ga0495603_0020971 | 3300046455 | Bacteria | 3957 |
| 413 | Ga0495629_0013396 | 3300046459 | Bacteria | 5917 |
| 414 | Ga0495651_0003925 | 3300046462 | Bacteria | 11374 |
| 415 | Ga0495651_0021054 | 3300046462 | Bacteria | 5064 |
| 416 | Ga0495651_0031350 | 3300046462 | Bacteria | 4145 |
| 417 | Ga0495651_0037541 | 3300046462 | Bacteria | 3772 |
| 418 | Ga0495651_0050023 | 3300046462 | Bacteria | 3225 |
| 419 | Ga0495651_0115579 | 3300046462 | Bacteria | 1978 |
| 420 | Ga0495651_0118498 | 3300046462 | Bacteria | 1948 |
| 421 | Ga0495653_0001655 | 3300046463 | Bacteria | 17515 |
| 422 | Ga0495653_0004752 | 3300046463 | Bacteria | 10998 |
| 423 | Ga0495653_0059041 | 3300046463 | Bacteria | 2913 |
| 424 | Ga0495653_0061026 | 3300046463 | Bacteria | 2854 |
| 425 | Ga0495580_0050116 | 3300046472 | Bacteria | 2953 |
| 426 | Ga0495582_0083300 | 3300046473 | Bacteria | 1777 |
| 427 | Ga0495639_0007311 | 3300046475 | Bacteria | 4737 |
| 428 | Ga0495662_0032507 | 3300046476 | Bacteria | 2520 |
| 429 | Ga0495664_0005496 | 3300046477 | Bacteria | 6958 |
| 430 | Ga0495664_0151611 | 3300046477 | Bacteria | 1406 |
| 431 | Ga0495585_0008414 | 3300046492 | Bacteria | 6254 |
| 432 | Ga0495594_0127852 | 3300046499 | Bacteria | 1438 |
| 433 | Ga0495583_0083296 | 3300046506 | Unclassified | 1387 |
| 434 | Ga0495608_0001793 | 3300046511 | Bacteria | 15332 |
| 435 | Ga0495608_0001817 | 3300046511 | Bacteria | 15244 |
| 436 | Ga0495608_0005922 | 3300046511 | Bacteria | 8694 |
| 437 | Ga0495608_0021073 | 3300046511 | Bacteria | 4476 |
| 438 | Ga0495608_0044062 | 3300046511 | Bacteria | 2979 |
| 439 | Ga0495608_0072761 | 3300046511 | Bacteria | 2242 |
| 440 | Ga0495608_0084732 | 3300046511 | Bacteria | 2055 |
| 441 | Ga0495618_0008159 | 3300046514 | Bacteria | 6345 |
| 442 | Ga0495618_0018196 | 3300046514 | Bacteria | 4314 |
| 443 | Ga0495618_0072351 | 3300046514 | Bacteria | 2194 |
| 444 | Ga0495618_0157805 | 3300046514 | Bacteria | 1447 |
| 445 | Ga0495628_0004889 | 3300046516 | Bacteria | 11794 |
| 446 | Ga0495628_0009824 | 3300046516 | Bacteria | 8149 |
| 447 | Ga0495628_0014727 | 3300046516 | Bacteria | 6547 |
| 448 | Ga0495628_0159097 | 3300046516 | Bacteria | 1717 |
| 449 | Ga0495630_0027998 | 3300046517 | Bacteria | 4187 |
| 450 | Ga0495630_0041594 | 3300046517 | Bacteria | 3432 |
| 451 | Ga0495630_0122574 | 3300046517 | Bacteria | 1972 |
| 452 | Ga0495630_0134107 | 3300046517 | Bacteria | 1881 |
| 453 | Ga0495644_0014794 | 3300046523 | Bacteria | 2988 |
| 454 | Ga0495652_0010464 | 3300046529 | Bacteria | 8406 |
| 455 | Ga0495652_0013953 | 3300046529 | Bacteria | 7223 |
| 456 | Ga0495652_0089741 | 3300046529 | Bacteria | 2516 |
| 457 | Ga0495665_0069040 | 3300046531 | Bacteria | 1863 |
| 458 | Ga0495640_0005362 | 3300046533 | Bacteria | 10199 |
| 459 | Ga0495640_0013444 | 3300046533 | Bacteria | 6218 |
| 460 | Ga0495640_0027536 | 3300046533 | Bacteria | 4098 |
| 461 | Ga0495640_0041299 | 3300046533 | Bacteria | 3224 |
| 462 | Ga0495586_0003545 | 3300046535 | Bacteria | 8364 |
| 463 | Ga0495587_0002845 | 3300046536 | Bacteria | 11595 |
| 464 | Ga0495587_0092504 | 3300046536 | Bacteria | 1746 |
| 465 | Ga0495645_0002386 | 3300046543 | Bacteria | 12748 |
| 466 | Ga0495645_0008213 | 3300046543 | Bacteria | 7280 |
| 467 | Ga0495645_0109269 | 3300046543 | Bacteria | 1958 |
| 468 | Ga0495633_0019628 | 3300046558 | Bacteria | 3416 |
| 469 | Ga0495667_0013127 | 3300046559 | Bacteria | 5609 |
| 470 | Ga0495667_0041422 | 3300046559 | Bacteria | 3055 |
| 471 | Ga0495667_0045655 | 3300046559 | Bacteria | 2899 |
| 472 | Ga0495667_0049843 | 3300046559 | Bacteria | 2764 |
| 473 | Ga0495667_0257424 | 3300046559 | Bacteria | 1110 |
| 474 | Ga0495656_0004034 | 3300046615 | Bacteria | 4992 |
| 475 | Ga0495634_0013078 | 3300046642 | Bacteria | 6002 |
| 476 | Ga0495634_0015313 | 3300046642 | Bacteria | 5513 |
| 477 | Ga0495634_0023688 | 3300046642 | Bacteria | 4313 |
| 478 | Ga0495634_0047376 | 3300046642 | Bacteria | 2897 |
| 479 | Ga0495634_0067106 | 3300046642 | Bacteria | 2373 |
| 480 | Ga0495635_0002748 | 3300046663 | Bacteria | 12065 |
| 481 | Ga0495635_0004972 | 3300046663 | Bacteria | 9257 |
| 482 | Ga0495635_0026001 | 3300046663 | Bacteria | 4076 |
| 483 | Ga0495635_0038825 | 3300046663 | Bacteria | 3296 |
| 484 | Ga0495659_0007696 | 3300046664 | Bacteria | 3415 |
| 485 | Ga0495657_0001218 | 3300046675 | Bacteria | 22573 |
| 486 | Ga0495657_0019008 | 3300046675 | Bacteria | 4964 |
| 487 | Ga0495657_0058481 | 3300046675 | Bacteria | 2560 |
| 488 | Ga0495657_0156584 | 3300046675 | Bacteria | 1411 |
| 489 | Ga0495599_0000531 | 3300046678 | Bacteria | 21912 |
| 490 | Ga0495599_0000970 | 3300046678 | Bacteria | 16055 |
| 491 | Ga0495599_0007730 | 3300046678 | Bacteria | 6528 |
| 492 | Ga0495599_0009604 | 3300046678 | Bacteria | 5919 |
| 493 | Ga0495599_0017496 | 3300046678 | Bacteria | 4456 |
| 494 | Ga0495599_0024588 | 3300046678 | Bacteria | 3766 |
| 495 | Ga0495623_0000758 | 3300046679 | Bacteria | 21662 |
| 496 | Ga0495623_0004324 | 3300046679 | Bacteria | 9345 |
| 497 | Ga0495623_0050543 | 3300046679 | Bacteria | 2632 |
| 498 | Ga0495623_0104799 | 3300046679 | Bacteria | 1719 |
| 499 | Ga0495646_0000300 | 3300046680 | Bacteria | 25296 |
| 500 | Ga0495646_0048164 | 3300046680 | Bacteria | 2591 |
| 501 | Ga0495647_0003976 | 3300046681 | Bacteria | 4771 |
| 502 | Ga0495658_0087110 | 3300046683 | Bacteria | 1844 |
| 503 | Ga0495613_0035336 | 3300046689 | Bacteria | 3709 |
| 504 | Ga0495624_0168486 | 3300046690 | Bacteria | 1336 |
| 505 | Ga0495670_0001321 | 3300046691 | Bacteria | 12084 |
| 506 | Ga0495600_0017662 | 3300046809 | Bacteria | 4539 |
| 507 | Ga0495600_0019250 | 3300046809 | Bacteria | 4358 |
| 508 | Ga0495600_0064413 | 3300046809 | Bacteria | 2396 |
| 509 | Ga0495600_0087418 | 3300046809 | Bacteria | 2033 |
| 510 | Ga0495604_0001425 | 3300047317 | Bacteria | 19626 |
| 511 | Ga0495604_0015363 | 3300047317 | Bacteria | 6109 |
| 512 | Ga0495604_0024413 | 3300047317 | Bacteria | 4823 |
| 513 | Ga0495674_0005874 | 3300047319 | Bacteria | 11776 |
| 514 | Ga0495674_0037354 | 3300047319 | Bacteria | 4364 |
| 515 | Ga0495674_0054172 | 3300047319 | Bacteria | 3523 |
| 516 | Ga0495674_0055682 | 3300047319 | Bacteria | 3467 |
| 517 | Ga0495674_0069114 | 3300047319 | Bacteria | 3055 |
| 518 | Ga0495680_0002651 | 3300047322 | Bacteria | 18113 |
| 519 | Ga0495680_0007953 | 3300047322 | Bacteria | 9672 |
| 520 | Ga0495680_0009557 | 3300047322 | Bacteria | 8711 |
| 521 | Ga0495680_0016011 | 3300047322 | Bacteria | 6451 |
| 522 | Ga0495680_0036732 | 3300047322 | Bacteria | 3930 |
| 523 | Ga0495680_0057461 | 3300047322 | Bacteria | 3009 |
| 524 | Ga0495680_0125557 | 3300047322 | Bacteria | 1890 |
| 525 | Ga0495675_0001056 | 3300047444 | Bacteria | 16742 |
| 526 | Ga0495675_0018474 | 3300047444 | Bacteria | 4425 |
| 527 | Ga0495675_0021903 | 3300047444 | Bacteria | 4071 |
| 528 | Ga0495684_0006100 | 3300047471 | Bacteria | 9377 |
| 529 | Ga0495684_0019131 | 3300047471 | Bacteria | 5272 |
| 530 | Ga0495684_0048498 | 3300047471 | Bacteria | 3247 |
| 531 | Ga0495684_0097874 | 3300047471 | Bacteria | 2219 |
| 532 | Ga0495684_0112796 | 3300047471 | Bacteria | 2050 |
| 533 | Ga0495684_0116479 | 3300047471 | Bacteria | 2014 |
| 534 | Ga0495593_0009724 | 3300047673 | Bacteria | 5579 |
| 535 | Ga0495602_0003273 | 3300048088 | Bacteria | 16731 |
| 536 | Ga0495602_0017308 | 3300048088 | Bacteria | 7227 |
| 537 | Ga0495602_0037956 | 3300048088 | Bacteria | 4461 |
| 538 | Ga0496101_0195827 | 3300048904 | Bacteria | 1561 |
| 539 | Ga0496102_0210499 | 3300048905 | Bacteria | 1833 |
| 540 | Ga0496103_0081016 | 3300048906 | Bacteria | 2042 |
| 541 | Ga0496104_0000515 | 3300048907 | Bacteria | 33122 |
| 542 | Ga0496104_0067549 | 3300048907 | Bacteria | 3396 |
| 543 | Ga0496104_0080380 | 3300048907 | Bacteria | 3108 |
| 544 | Ga0496105_0244461 | 3300048908 | Bacteria | 1455 |
| 545 | Ga0496106_0015310 | 3300048909 | Bacteria | 5674 |
| 546 | Ga0496106_0158605 | 3300048909 | Bacteria | 1788 |
| 547 | Ga0496107_0015088 | 3300048910 | Bacteria | 5413 |
| 548 | Ga0496107_0090827 | 3300048910 | Bacteria | 2231 |
| 549 | Ga0496108_0008991 | 3300048911 | Bacteria | 8095 |
| 550 | Ga0496109_0001064 | 3300048912 | Bacteria | 22726 |
| 551 | Ga0496109_0113508 | 3300048912 | Bacteria | 2520 |
| 552 | Ga0496110_0193022 | 3300048913 | Bacteria | 1849 |
| 553 | Ga0496111_0055737 | 3300048914 | Bacteria | 2859 |
| 554 | Ga0496111_0081328 | 3300048914 | Bacteria | 2365 |
| 555 | Ga0496111_0148541 | 3300048914 | Bacteria | 1738 |
| 556 | Ga0496112_0075018 | 3300048915 | Bacteria | 3344 |
| 557 | Ga0496113_0004800 | 3300048916 | Bacteria | 8356 |
| 558 | Ga0496115_0045598 | 3300048918 | Bacteria | 3500 |
| 559 | Ga0496115_0138609 | 3300048918 | Bacteria | 2006 |
| 560 | Ga0501031_0001427 | 3300049568 | Bacteria | 14803 |
| 561 | Ga0501032_0002436 | 3300049569 | Bacteria | 14522 |
| 562 | Ga0501032_0062303 | 3300049569 | Bacteria | 2499 |
| 563 | Ga0501033_0000244 | 3300049570 | Bacteria | 52231 |
| 564 | Ga0501033_0013241 | 3300049570 | Bacteria | 6285 |
| 565 | Ga0501034_0000159 | 3300049571 | Bacteria | 127397 |
| 566 | Ga0501034_0031979 | 3300049571 | Bacteria | 5345 |
| 567 | Ga0501034_0046375 | 3300049571 | Bacteria | 4391 |
| 568 | Ga0501034_0187526 | 3300049571 | Bacteria | 2031 |
| 569 | Ga0501036_0000039 | 3300049572 | Bacteria | 83065 |
| 570 | Ga0501036_0079493 | 3300049572 | Bacteria | 2773 |
| 571 | Ga0501037_0003835 | 3300049573 | Bacteria | 10914 |
| 572 | Ga0501038_0001751 | 3300049574 | Bacteria | 20170 |
| 573 | Ga0501038_0062161 | 3300049574 | Bacteria | 3191 |
| 574 | Ga0501038_0265310 | 3300049574 | Bacteria | 1355 |
| 575 | Ga0501039_0001324 | 3300049575 | Bacteria | 18083 |
| 576 | Ga0501039_0101558 | 3300049575 | Bacteria | 2245 |
| 577 | Ga0501042_0064050 | 3300049578 | Bacteria | 2627 |
| 578 | Ga0501043_0030468 | 3300049579 | Bacteria | 4240 |
| 579 | Ga0501046_0000185 | 3300049580 | Bacteria | 63459 |
| 580 | Ga0501047_0000385 | 3300049581 | Bacteria | 49635 |
| 581 | Ga0501047_0010053 | 3300049581 | Bacteria | 8943 |
| 582 | Ga0501047_0133021 | 3300049581 | Bacteria | 2367 |
| 583 | Ga0501047_0157297 | 3300049581 | Bacteria | 2146 |
| 584 | Ga0501047_0315416 | 3300049581 | Bacteria | 1404 |
| 585 | Ga0501048_0007283 | 3300049582 | Bacteria | 8389 |
| 586 | Ga0501048_0335808 | 3300049582 | Bacteria | 1077 |
| 587 | Ga0501067_0000513 | 3300049583 | Bacteria | 21187 |
| 588 | Ga0501068_0001337 | 3300049584 | Bacteria | 13064 |
| 589 | Ga0501068_0026119 | 3300049584 | Bacteria | 3438 |
| 590 | Ga0501069_0006089 | 3300049585 | Bacteria | 6296 |
| 591 | Ga0501069_0149490 | 3300049585 | Bacteria | 1342 |
| 592 | Ga0501070_0003256 | 3300049586 | Bacteria | 14098 |
| 593 | Ga0501070_0008612 | 3300049586 | Bacteria | 8626 |
| 594 | Ga0501070_0010383 | 3300049586 | Bacteria | 7871 |
| 595 | Ga0501070_0112369 | 3300049586 | Bacteria | 2251 |
| 596 | Ga0501072_0001656 | 3300049588 | Bacteria | 16623 |
| 597 | Ga0501072_0038222 | 3300049588 | Bacteria | 3766 |
| 598 | Ga0501072_0106012 | 3300049588 | Bacteria | 2235 |
| 599 | Ga0501073_0000374 | 3300049589 | Bacteria | 30124 |
| 600 | Ga0501073_0000702 | 3300049589 | Bacteria | 23614 |
| 601 | Ga0501073_0025314 | 3300049589 | Bacteria | 4257 |
| 602 | Ga0501073_0045790 | 3300049589 | Bacteria | 3080 |
| 603 | Ga0501073_0115244 | 3300049589 | Bacteria | 1863 |
| 604 | Ga0501074_0000125 | 3300049590 | Bacteria | 39203 |
| 605 | Ga0501074_0001567 | 3300049590 | Bacteria | 15466 |
| 606 | Ga0501074_0148255 | 3300049590 | Bacteria | 1678 |
| 607 | Ga0501079_0026149 | 3300049741 | Bacteria | 4475 |
| 608 | Ga0501079_0085132 | 3300049741 | Bacteria | 2446 |
| 609 | Ga0501080_0000380 | 3300049742 | Bacteria | 34213 |
| 610 | Ga0501080_0001529 | 3300049742 | Bacteria | 19540 |
| 611 | Ga0501080_0007162 | 3300049742 | Bacteria | 10065 |
| 612 | Ga0501080_0227275 | 3300049742 | Bacteria | 1706 |
| 613 | Ga0501080_0287175 | 3300049742 | Bacteria | 1494 |
| 614 | Ga0501083_0001646 | 3300049744 | Bacteria | 15245 |
| 615 | Ga0501083_0004058 | 3300049744 | Bacteria | 10302 |
| 616 | Ga0501083_0017169 | 3300049744 | Bacteria | 5048 |
| 617 | Ga0501035_0001985 | 3300049822 | Bacteria | 20460 |
| 618 | Ga0501035_0026028 | 3300049822 | Bacteria | 5358 |
| 619 | Ga0501035_0045442 | 3300049822 | Bacteria | 3951 |
| 620 | Ga0501035_0059100 | 3300049822 | Bacteria | 3414 |
| 621 | Ga0501035_0306211 | 3300049822 | Bacteria | 1338 |
| 622 | Ga0501044_0001993 | 3300049823 | Bacteria | 23587 |
| 623 | Ga0501044_0171954 | 3300049823 | Bacteria | 2137 |
| 624 | Ga0501044_0172377 | 3300049823 | Bacteria | 2134 |
| 625 | Ga0501044_0475538 | 3300049823 | Bacteria | 1153 |
| 626 | nmdc:mga0yw44_56609_c1 | 3300050492 | Bacteria | 2390 |
| 627 | nmdc:mga07m45_24106_c2 | 3300050496 | Bacteria | 2611 |
| 628 | nmdc:mga08y16_14377_c1 | 3300050511 | Bacteria | 8332 |
| 629 | nmdc:mga0n895_41223_c1 | 3300050512 | Bacteria | 4487 |
| 630 | nmdc:mga0a205_65088_c1 | 3300050515 | Bacteria | 3521 |
| 631 | Ga0495601_0000731 | 3300053077 | Bacteria | 17670 |
| 632 | Ga0495601_0001011 | 3300053077 | Bacteria | 15401 |
| 633 | Ga0495601_0005133 | 3300053077 | Bacteria | 7610 |
| 634 | Ga0495601_0006865 | 3300053077 | Bacteria | 6668 |
| 635 | Ga0495601_0010360 | 3300053077 | Bacteria | 5545 |
| 636 | Ga0495601_0011836 | 3300053077 | Bacteria | 5232 |
| 637 | Ga0495601_0012932 | 3300053077 | Bacteria | 5011 |
| 638 | Ga0495612_0006577 | 3300053078 | Bacteria | 4768 |
| 639 | Ga0495612_0007659 | 3300053078 | Bacteria | 4411 |
| 640 | Ga0495595_0000356 | 3300053084 | Bacteria | 17378 |
| 641 | Ga0495595_0001701 | 3300053084 | Bacteria | 8618 |
| 642 | Ga0495595_0001936 | 3300053084 | Bacteria | 8032 |
| 643 | Ga0495595_0002476 | 3300053084 | Bacteria | 7225 |
| 644 | Ga0495619_0001094 | 3300053085 | Bacteria | 17821 |
| 645 | Ga0495619_0010836 | 3300053085 | Bacteria | 5737 |
| 646 | Ga0495619_0013399 | 3300053085 | Bacteria | 5167 |
| 647 | Ga0495619_0030417 | 3300053085 | Bacteria | 3496 |
| 648 | Ga0495619_0034502 | 3300053085 | Bacteria | 3289 |
| 649 | Ga0495619_0105669 | 3300053085 | Bacteria | 1920 |
| 650 | Ga0495619_0243271 | 3300053085 | Bacteria | 1247 |
| 651 | Ga0500652_004490 | 3300053131 | Bacteria | 4324 |
| 652 | Ga0501084_0023641 | 3300054114 | Bacteria | 5125 |
| 653 | Ga0501082_0000570 | 3300060353 | Bacteria | 32833 |
| 654 | Ga0501082_0026405 | 3300060353 | Bacteria | 5004 |
| 655 | Ga0501082_0086600 | 3300060353 | Bacteria | 2702 |
| 656 | Ga0501082_0173828 | 3300060353 | Bacteria | 1873 |
| 657 | Ga0530510_0149019 | 3300061734 | Bacteria | 1727 |
| 658 | 2643754663 | 2643221547 | Bacteria | 4740017 |
| 659 | 2643838558 | 2643221564 | Bacteria | 4193379 |
| 660 | Ga0373937_0087050 | |||
| 661 | 2214911869 | |||
| 662 | ARcpr5oldR_c000029 | |||
| 663 | ARSoilYngRDRAFT_c00072 | |||
| 664 | ARcpr5yngRDRAFT_c000051 | |||
| 665 | ARSoilOldRDRAFT_c000078 | |||
| 666 | ARCol0oldRDRAFT_c00459 | |||
| 667 | ARCol0yngRDRAFT_1000056 | |||
| 668 | JGI24737J22298_10012020 | |||
| 669 | JGI25405J52794_10017317 | |||
| 670 | Ga0065717_1002104 | |||
| 671 | Ga0065716_1002476 | |||
| 672 | Ga0065704_10083802 | |||
| 673 | Ga0065715_10106453 | |||
| 674 | Ga0070658_10012028 | |||
| 675 | Ga0070658_10089225 | |||
| 676 | Ga0070658_10147435 | |||
| 677 | Ga0070676_10147513 | |||
| 678 | Ga0070683_100029663 | |||
| 679 | Ga0070683_100035510 | |||
| 680 | Ga0070683_100096539 | |||
| 681 | Ga0070680_100029424 | |||
| 682 | Ga0070680_100069612 | |||
| 683 | Ga0070680_100290154 | |||
| 684 | Ga0068868_100074621 | |||
| 685 | Ga0070660_100007264 | |||
| 686 | Ga0070660_100144635 | |||
| 687 | Ga0070691_10041412 | |||
| 688 | Ga0070661_100000534 | |||
| 689 | Ga0070661_100013055 | |||
| 690 | Ga0070692_10010043 | |||
| 691 | Ga0070692_10070074 | |||
| 692 | Ga0070669_100028908 | |||
| 693 | Ga0070675_100039583 | |||
| 694 | Ga0070688_100016727 | |||
| 695 | Ga0070688_100135663 | |||
| 696 | Ga0070659_100094240 | |||
| 697 | Ga0070667_100021395 | |||
| 698 | Ga0070667_100142260 | |||
| 699 | Ga0070703_10009780 | |||
| 700 | Ga0070709_10008931 | |||
| 701 | Ga0070709_10144689 | |||
| 702 | Ga0070714_100004852 | |||
| 703 | Ga0070714_100071605 | |||
| 704 | Ga0070714_100075499 | |||
| 705 | Ga0070714_100245884 | |||
| 706 | Ga0070713_100015251 | |||
| 707 | Ga0070713_100035154 | |||
| 708 | Ga0070713_100043614 | |||
| 709 | Ga0070713_100165511 | |||
| 710 | Ga0070713_100233619 | |||
| 711 | Ga0070710_10043415 | |||
| 712 | Ga0070710_10257431 | |||
| 713 | Ga0070711_100021985 | |||
| 714 | Ga0070711_100046980 | |||
| 715 | Ga0070711_100048137 | |||
| 716 | Ga0070694_100102197 | |||
| 717 | Ga0070663_100069216 | |||
| 718 | Ga0070681_10004821 | |||
| 719 | Ga0070681_10060239 | |||
| 720 | Ga0070681_10066993 | |||
| 721 | Ga0070681_10104672 | |||
| 722 | Ga0074259_12105788 | |||
| 723 | Ga0070699_100015846 | |||
| 724 | Ga0070679_100011066 | |||
| 725 | Ga0070679_100016685 | |||
| 726 | Ga0070679_100017604 | |||
| 727 | Ga0070679_100065636 | |||
| 728 | Ga0070679_100111202 | |||
| 729 | Ga0070679_100186321 | |||
| 730 | Ga0070684_100008632 | |||
| 731 | Ga0070684_100022129 | |||
| 732 | Ga0070684_100076053 | |||
| 733 | Ga0068853_100004769 | |||
| 734 | Ga0068853_100010929 | |||
| 735 | Ga0070672_100073562 | |||
| 736 | Ga0070672_100342037 | |||
| 737 | Ga0070686_100034533 | |||
| 738 | Ga0070695_100002680 | |||
| 739 | Ga0070696_100001722 | |||
| 740 | Ga0070696_100027300 | |||
| 741 | Ga0070696_100094394 | |||
| 742 | Ga0070704_100019446 | |||
| 743 | Ga0068855_100007766 | |||
| 744 | Ga0068855_100008252 | |||
| 745 | Ga0068855_100069930 | |||
| 746 | Ga0068855_100073898 | |||
| 747 | Ga0068855_100192890 | |||
| 748 | Ga0068855_100217464 | |||
| 749 | Ga0070664_100001929 | |||
| 750 | Ga0068857_100001319 | |||
| 751 | Ga0068857_100115620 | |||
| 752 | Ga0068857_100117321 | |||
| 753 | Ga0068857_100254726 | |||
| 754 | Ga0068854_100016881 | |||
| 755 | Ga0068854_100050830 | |||
| 756 | Ga0068854_100170336 | |||
| 757 | Ga0068856_100003061 | |||
| 758 | Ga0068856_100138006 | |||
| 759 | Ga0068856_100177033 | |||
| 760 | Ga0070702_100025455 | |||
| 761 | Ga0068852_100000554 | |||
| 762 | Ga0068852_100002959 | |||
| 763 | Ga0068852_100004557 | |||
| 764 | Ga0068852_100083301 | |||
| 765 | Ga0068852_100086236 | |||
| 766 | Ga0068852_100233337 | |||
| 767 | Ga0068859_100291001 | |||
| 768 | Ga0068861_100019068 | |||
| 769 | Ga0068851_10008121 | |||
| 770 | Ga0068863_100301324 | |||
| 771 | Ga0068858_100024666 | |||
| 772 | Ga0068858_100140765 | |||
| 773 | Ga0068860_100034634 | |||
| 774 | Ga0068862_100016334 | |||
| 775 | Ga0081455_10010000 | |||
| 776 | Ga0081540_1003907 | |||
| 777 | Ga0075365_10025911 | |||
| 778 | Ga0075364_10148885 | |||
| 779 | Ga0075432_10055282 | |||
| 780 | Ga0070715_10118308 | |||
| 781 | Ga0070712_100014927 | |||
| 782 | Ga0097621_100040496 | |||
| 783 | Ga0097621_100097801 | |||
| 784 | Ga0075370_10038270 | |||
| 785 | Ga0068871_100009241 | |||
| 786 | Ga0068871_100028870 | |||
| 787 | Ga0097620_100291019 | |||
| 788 | Ga0105240_10002585 | |||
| 789 | Ga0105240_10007789 | |||
| 790 | Ga0105240_10026466 | |||
| 791 | Ga0105240_10053422 | |||
| 792 | Ga0111539_10007739 | |||
| 793 | Ga0105245_10102254 | |||
| 794 | Ga0105247_10013648 | |||
| 795 | Ga0105247_10047888 | |||
| 796 | Ga0105243_10009481 | |||
| 797 | Ga0105241_10013737 | |||
| 798 | Ga0105241_10033974 | |||
| 799 | Ga0105242_10003746 | |||
| 800 | Ga0105248_10008602 | |||
| 801 | Ga0105237_10162124 | |||
| 802 | Ga0105238_10005650 | |||
| 803 | Ga0105238_10009355 | |||
| 804 | Ga0105238_10018906 | |||
| 805 | Ga0105238_10156841 | |||
| 806 | Ga0105238_10198599 | |||
| 807 | Ga0105238_10266416 | |||
| 808 | Ga0105249_10006636 | |||
| 809 | Ga0105246_10014859 | |||
| 810 | Ga0157315_1000484 | |||
| 811 | Ga0157373_10091002 | |||
| 812 | Ga0157373_10119000 | |||
| 813 | Ga0157371_10019442 | |||
| 814 | Ga0157371_10041023 | |||
| 815 | Ga0157371_10102975 | |||
| 816 | Ga0157370_10001270 | |||
| 817 | Ga0157370_10003871 | |||
| 818 | Ga0157370_10009975 | |||
| 819 | Ga0157370_10020607 | |||
| 820 | Ga0157370_10061699 | |||
| 821 | Ga0157370_10136016 | |||
| 822 | Ga0157370_10160929 | |||
| 823 | Ga0157370_10238178 | |||
| 824 | Ga0157369_10000895 | |||
| 825 | Ga0157369_10002601 | |||
| 826 | Ga0157369_10113846 | |||
| 827 | Ga0157369_10196083 | |||
| 828 | Ga0157369_10399800 | |||
| 829 | Ga0157374_10081300 | |||
| 830 | Ga0157374_10154841 | |||
| 831 | Ga0157378_10302397 | |||
| 832 | Ga0163162_10021249 | |||
| 833 | Ga0163162_10056217 | |||
| 834 | Ga0163162_10114262 | |||
| 835 | Ga0163162_10241467 | |||
| 836 | Ga0157372_10004580 | |||
| 837 | Ga0157372_10022454 | |||
| 838 | Ga0157372_10027347 | |||
| 839 | Ga0157372_10034933 | |||
| 840 | Ga0157372_10126363 | |||
| 841 | Ga0157372_10232687 | |||
| 842 | Ga0157375_10015977 | |||
| 843 | Ga0157375_10154689 | |||
| 844 | Ga0163163_10000757 | |||
| 845 | Ga0163163_10001222 | |||
| 846 | Ga0157380_10038881 | |||
| 847 | Ga0157377_10030644 | |||
| 848 | Ga0157377_10169037 | |||
| 849 | Ga0157379_10134030 | |||
| 850 | Ga0157379_10245781 | |||
| 851 | Ga0157376_10041184 | |||
| 852 | Ga0157376_10247744 | |||
| 853 | Ga0207666_1000343 | |||
| 854 | Ga0207697_10007410 | |||
| 855 | Ga0207656_10088259 | |||
| 856 | Ga0207692_10004582 | |||
| 857 | Ga0207688_10004300 | |||
| 858 | Ga0207680_10266326 | |||
| 859 | Ga0207647_10047471 | |||
| 860 | Ga0207699_10052120 | |||
| 861 | Ga0207645_10040159 | |||
| 862 | Ga0207705_10016504 | |||
| 863 | Ga0207705_10019680 | |||
| 864 | Ga0207705_10060216 | |||
| 865 | Ga0207705_10102758 | |||
| 866 | Ga0207654_10023112 | |||
| 867 | Ga0207654_10023523 | |||
| 868 | Ga0207654_10128529 | |||
| 869 | Ga0207707_10011542 | |||
| 870 | Ga0207707_10028062 | |||
| 871 | Ga0207707_10194815 | |||
| 872 | Ga0207707_10264712 | |||
| 873 | Ga0207707_10457711 | |||
| 874 | Ga0207695_10004433 | |||
| 875 | Ga0207695_10017259 | |||
| 876 | Ga0207695_10032370 | |||
| 877 | Ga0207695_10096789 | |||
| 878 | Ga0207695_10130049 | |||
| 879 | Ga0207671_10060402 | |||
| 880 | Ga0207693_10026873 | |||
| 881 | Ga0207663_10108042 | |||
| 882 | Ga0207660_10047796 | |||
| 883 | Ga0207660_10195634 | |||
| 884 | Ga0207660_10223221 | |||
| 885 | Ga0207662_10208455 | |||
| 886 | Ga0207657_10009889 | |||
| 887 | Ga0207657_10133464 | |||
| 888 | Ga0207657_10262520 | |||
| 889 | Ga0207649_10002364 | |||
| 890 | Ga0207649_10019384 | |||
| 891 | Ga0207649_10032953 | |||
| 892 | Ga0207652_10008705 | |||
| 893 | Ga0207652_10041447 | |||
| 894 | Ga0207652_10062760 | |||
| 895 | Ga0207652_10070843 | |||
| 896 | Ga0207652_10092261 | |||
| 897 | Ga0207646_10077035 | |||
| 898 | Ga0207681_10066864 | |||
| 899 | Ga0207681_10319148 | |||
| 900 | Ga0207694_10002378 | |||
| 901 | Ga0207694_10014709 | |||
| 902 | Ga0207694_10035460 | |||
| 903 | Ga0207694_10058866 | |||
| 904 | Ga0207694_10085831 | |||
| 905 | Ga0207659_10065689 | |||
| 906 | Ga0207687_10022697 | |||
| 907 | Ga0207687_10233088 | |||
| 908 | Ga0207700_10137977 | |||
| 909 | Ga0207700_10212529 | |||
| 910 | Ga0207664_10003344 | |||
| 911 | Ga0207664_10007925 | |||
| 912 | Ga0207664_10023865 | |||
| 913 | Ga0207690_10094227 | |||
| 914 | Ga0207690_10107839 | |||
| 915 | Ga0207690_10136275 | |||
| 916 | Ga0207706_10007810 | |||
| 917 | Ga0207686_10017403 | |||
| 918 | Ga0207686_10064900 | |||
| 919 | Ga0207686_10241750 | |||
| 920 | Ga0207709_10092973 | |||
| 921 | Ga0207665_10242423 | |||
| 922 | Ga0207711_10067338 | |||
| 923 | Ga0207711_10116633 | |||
| 924 | Ga0207661_10081182 | |||
| 925 | Ga0207661_10259003 | |||
| 926 | Ga0207667_10001311 | |||
| 927 | Ga0207667_10018592 | |||
| 928 | Ga0207667_10038687 | |||
| 929 | Ga0207667_10048328 | |||
| 930 | Ga0207667_10065695 | |||
| 931 | Ga0207667_10070130 | |||
| 932 | Ga0207667_10142924 | |||
| 933 | Ga0207667_10152458 | |||
| 934 | Ga0207668_10140812 | |||
| 935 | Ga0207640_10042585 | |||
| 936 | Ga0207640_10154434 | |||
| 937 | Ga0207658_10011174 | |||
| 938 | Ga0207658_10112167 | |||
| 939 | Ga0207703_10047022 | |||
| 940 | Ga0207703_10108888 | |||
| 941 | Ga0207703_10390416 | |||
| 942 | Ga0207639_10016878 | |||
| 943 | Ga0207639_10132234 | |||
| 944 | Ga0207639_10225641 | |||
| 945 | Ga0207678_10012696 | |||
| 946 | Ga0207708_10004283 | |||
| 947 | Ga0207702_10002277 | |||
| 948 | Ga0207702_10105381 | |||
| 949 | Ga0207641_10193239 | |||
| 950 | Ga0207674_10000039 | |||
| 951 | Ga0207674_10092964 | |||
| 952 | Ga0207674_10146800 | |||
| 953 | Ga0207675_100015653 | |||
| 954 | Ga0207698_10003989 | |||
| 955 | Ga0207698_10011251 | |||
| 956 | Ga0207698_10019968 | |||
| 957 | Ga0207698_10405485 | |||
| 958 | Ga0209966_1002877 | |||
| 959 | Ga0209998_10000758 | |||
| 960 | Ga0207428_10014000 | |||
| 961 | Ga0268264_10069274 | |||
| 962 | Ga0265338_10033308 | |||
| 963 | Ga0265338_10098428 | |||
| 964 | Ga0265325_10000004 | |||
| 965 | Ga0265325_10034833 | |||
| 966 | Ga0265325_10043495 | |||
| 967 | Ga0265325_10048228 | |||
| 968 | Ga0265325_10086133 | |||
| 969 | Ga0265340_10025334 | |||
| 970 | Ga0265339_10010467 | |||
| 971 | Ga0265316_10066828 | |||
| 972 | Ga0265313_10009264 | |||
| 973 | Ga0265313_10048143 | |||
| 974 | Ga0265314_10016876 | |||
| 975 | Ga0265342_10000182 | |||
| 976 | Ga0307405_10072929 | |||
| 977 | Ga0373930_0000532 | |||
| 978 | Ga0373948_0000419 | |||
| 979 | Ga0373950_0000167 | |||
| 980 | Ga0373958_0002350 | |||
| 981 | Ga0373938_0000028 | |||
| 982 | Ga0373928_0000334 | |||
| 983 | Ga0373929_0001866 | |||
| 984 | Ga0373934_0001517 | |||
| 985 | Ga0373934_0005199 | |||
| 986 | Ga0373934_0012356 | |||
| 987 | Ga0373934_0013164 | |||
| 988 | Ga0373949_0001620 | |||
| 989 | Ga0373951_0000666 | |||
| 990 | Ga0373952_0000851 | |||
| 991 | Ga0373923_0024586 | |||
| 992 | Ga0373923_0049411 | |||
| 993 | Ga0373932_0000749 | |||
| 994 | Ga0373936_0005568 | |||
| 995 | Ga0373939_0001838 | |||
| 996 | Ga0373939_0016499 | |||
| 997 | Ga0373941_0000671 | |||
| 998 | Ga0373941_0005651 | |||
| 999 | Ga0373945_0053045 | |||
| 1000 | Ga0373945_0097102 | |||
| 1001 | Ga0373953_0008219 | |||
| 1002 | Ga0373953_0012296 | |||
| 1003 | Ga0373953_0019942 | |||
| 1004 | Ga0373954_0000002 | |||
| 1005 | Ga0373954_0003738 | |||
| 1006 | Ga0373954_0006044 | |||
| 1007 | Ga0373954_0007284 | |||
| 1008 | Ga0373954_0014031 | |||
| 1009 | Ga0373956_0000945 | |||
| 1010 | Ga0373956_0002179 | |||
| 1011 | Ga0373956_0019484 | |||
| 1012 | Ga0373956_0107005 | |||
| 1013 | Ga0373957_0000339 | |||
| 1014 | Ga0373957_0002968 | |||
| 1015 | Ga0373957_0003036 | |||
| 1016 | Ga0373957_0024413 | |||
| 1017 | Ga0373960_0000599 | |||
| 1018 | Ga0373955_0001962 | |||
| 1019 | Ga0373955_0014629 | |||
| 1020 | Ga0373955_0028909 | |||
| 1021 | Ga0373955_0034110 | |||
| 1022 | Ga0373955_0064377 | |||
| 1023 | Ga0373955_0081179 | |||
| 1024 | Ga0373942_0005239 | |||
| 1025 | Ga0373961_0000433 | |||
| 1026 | Ga0373962_0000881 | |||
| 1027 | Ga0373924_0004417 | |||
| 1028 | Ga0373924_0025366 | |||
| 1029 | Ga0373924_0057243 | |||
| 1030 | Ga0373924_0117377 | |||
| 1031 | Ga0373935_0026607 | |||
| 1032 | Ga0373935_0057754 | |||
| 1033 | Ga0373935_0157622 | |||
| 1034 | Ga0373935_0296636 | |||
| 1035 | Ga0373927_0003675 | |||
| 1036 | Ga0373927_0093708 | |||
| 1037 | Ga0373927_0288887 | |||
| 1038 | Ga0373933_0000890 | |||
| 1039 | Ga0373933_0001687 | |||
| 1040 | Ga0373933_0001764 | |||
| 1041 | Ga0373933_0002111 | |||
| 1042 | Ga0373933_0005461 | |||
| 1043 | Ga0373933_0011582 | |||
| 1044 | Ga0373933_0041104 | |||
| 1045 | Ga0373933_0042536 | |||
| 1046 | Ga0373947_0063299 | |||
| 1047 | Ga0373947_0100781 | |||
| 1048 | Ga0373947_0115514 | |||
| 1049 | Ga0373947_0195698 | |||
| 1050 | Ga0373947_0203572 | |||
| 1051 | Ga0373937_0001304 | |||
| 1052 | Ga0373937_0001794 | |||
| 1053 | Ga0373937_0004227 | |||
| 1054 | Ga0373937_0005332 | |||
| 1055 | Ga0373937_0006421 | |||
| 1056 | Ga0373937_0007322 | |||
| 1057 | Ga0373937_0009035 | |||
| 1058 | Ga0373937_0027575 | |||
| 1059 | Ga0373937_0035972 | |||
| 1060 | Ga0373937_0197854 | |||
| 1061 | Ga0439465_0047164 | |||
| 1062 | Ga0451853_1695856 | |||
| 1063 | Ga0453684_0140242 | |||
| 1064 | Ga0451576_0065472 | |||
| 1065 | Ga0495617_024276 | |||
| 1066 | Ga0495592_0000589 | |||
| 1067 | Ga0495592_0002245 | |||
| 1068 | Ga0495592_0028842 | |||
| 1069 | Ga0495592_0040216 | |||
| 1070 | Ga0495592_0075908 | |||
| 1071 | Ga0495603_0020971 | |||
| 1072 | Ga0495629_0013396 | |||
| 1073 | Ga0495651_0003925 | |||
| 1074 | Ga0495651_0021054 | |||
| 1075 | Ga0495651_0031350 | |||
| 1076 | Ga0495651_0037541 | |||
| 1077 | Ga0495651_0050023 | |||
| 1078 | Ga0495651_0115579 | |||
| 1079 | Ga0495651_0118498 | |||
| 1080 | Ga0495653_0001655 | |||
| 1081 | Ga0495653_0004752 | |||
| 1082 | Ga0495653_0059041 | |||
| 1083 | Ga0495653_0061026 | |||
| 1084 | Ga0495580_0050116 | |||
| 1085 | Ga0495582_0083300 | |||
| 1086 | Ga0495639_0007311 | |||
| 1087 | Ga0495662_0032507 | |||
| 1088 | Ga0495664_0005496 | |||
| 1089 | Ga0495664_0151611 | |||
| 1090 | Ga0495585_0008414 | |||
| 1091 | Ga0495594_0127852 | |||
| 1092 | Ga0495583_0083296 | |||
| 1093 | Ga0495608_0001793 | |||
| 1094 | Ga0495608_0001817 | |||
| 1095 | Ga0495608_0005922 | |||
| 1096 | Ga0495608_0021073 | |||
| 1097 | Ga0495608_0044062 | |||
| 1098 | Ga0495608_0072761 | |||
| 1099 | Ga0495608_0084732 | |||
| 1100 | Ga0495618_0008159 | |||
| 1101 | Ga0495618_0018196 | |||
| 1102 | Ga0495618_0072351 | |||
| 1103 | Ga0495618_0157805 | |||
| 1104 | Ga0495628_0004889 | |||
| 1105 | Ga0495628_0009824 | |||
| 1106 | Ga0495628_0014727 | |||
| 1107 | Ga0495628_0159097 | |||
| 1108 | Ga0495630_0027998 | |||
| 1109 | Ga0495630_0041594 | |||
| 1110 | Ga0495630_0122574 | |||
| 1111 | Ga0495630_0134107 | |||
| 1112 | Ga0495644_0014794 | |||
| 1113 | Ga0495652_0010464 | |||
| 1114 | Ga0495652_0013953 | |||
| 1115 | Ga0495652_0089741 | |||
| 1116 | Ga0495665_0069040 | |||
| 1117 | Ga0495640_0005362 | |||
| 1118 | Ga0495640_0013444 | |||
| 1119 | Ga0495640_0027536 | |||
| 1120 | Ga0495640_0041299 | |||
| 1121 | Ga0495586_0003545 | |||
| 1122 | Ga0495587_0002845 | |||
| 1123 | Ga0495587_0092504 | |||
| 1124 | Ga0495645_0002386 | |||
| 1125 | Ga0495645_0008213 | |||
| 1126 | Ga0495645_0109269 | |||
| 1127 | Ga0495633_0019628 | |||
| 1128 | Ga0495667_0013127 | |||
| 1129 | Ga0495667_0041422 | |||
| 1130 | Ga0495667_0045655 | |||
| 1131 | Ga0495667_0049843 | |||
| 1132 | Ga0495667_0257424 | |||
| 1133 | Ga0495656_0004034 | |||
| 1134 | Ga0495634_0013078 | |||
| 1135 | Ga0495634_0015313 | |||
| 1136 | Ga0495634_0023688 | |||
| 1137 | Ga0495634_0047376 | |||
| 1138 | Ga0495634_0067106 | |||
| 1139 | Ga0495635_0002748 | |||
| 1140 | Ga0495635_0004972 | |||
| 1141 | Ga0495635_0026001 | |||
| 1142 | Ga0495635_0038825 | |||
| 1143 | Ga0495659_0007696 | |||
| 1144 | Ga0495657_0001218 | |||
| 1145 | Ga0495657_0019008 | |||
| 1146 | Ga0495657_0058481 | |||
| 1147 | Ga0495657_0156584 | |||
| 1148 | Ga0495599_0000531 | |||
| 1149 | Ga0495599_0000970 | |||
| 1150 | Ga0495599_0007730 | |||
| 1151 | Ga0495599_0009604 | |||
| 1152 | Ga0495599_0017496 | |||
| 1153 | Ga0495599_0024588 | |||
| 1154 | Ga0495623_0000758 | |||
| 1155 | Ga0495623_0004324 | |||
| 1156 | Ga0495623_0050543 | |||
| 1157 | Ga0495623_0104799 | |||
| 1158 | Ga0495646_0000300 | |||
| 1159 | Ga0495646_0048164 | |||
| 1160 | Ga0495647_0003976 | |||
| 1161 | Ga0495658_0087110 | |||
| 1162 | Ga0495613_0035336 | |||
| 1163 | Ga0495624_0168486 | |||
| 1164 | Ga0495670_0001321 | |||
| 1165 | Ga0495600_0017662 | |||
| 1166 | Ga0495600_0019250 | |||
| 1167 | Ga0495600_0064413 | |||
| 1168 | Ga0495600_0087418 | |||
| 1169 | Ga0495604_0001425 | |||
| 1170 | Ga0495604_0015363 | |||
| 1171 | Ga0495604_0024413 | |||
| 1172 | Ga0495674_0005874 | |||
| 1173 | Ga0495674_0037354 | |||
| 1174 | Ga0495674_0054172 | |||
| 1175 | Ga0495674_0055682 | |||
| 1176 | Ga0495674_0069114 | |||
| 1177 | Ga0495680_0002651 | |||
| 1178 | Ga0495680_0007953 | |||
| 1179 | Ga0495680_0009557 | |||
| 1180 | Ga0495680_0016011 | |||
| 1181 | Ga0495680_0036732 | |||
| 1182 | Ga0495680_0057461 | |||
| 1183 | Ga0495680_0125557 | |||
| 1184 | Ga0495675_0001056 | |||
| 1185 | Ga0495675_0018474 | |||
| 1186 | Ga0495675_0021903 | |||
| 1187 | Ga0495684_0006100 | |||
| 1188 | Ga0495684_0019131 | |||
| 1189 | Ga0495684_0048498 | |||
| 1190 | Ga0495684_0097874 | |||
| 1191 | Ga0495684_0112796 | |||
| 1192 | Ga0495684_0116479 | |||
| 1193 | Ga0495593_0009724 | |||
| 1194 | Ga0495602_0003273 | |||
| 1195 | Ga0495602_0017308 | |||
| 1196 | Ga0495602_0037956 | |||
| 1197 | Ga0496101_0195827 | |||
| 1198 | Ga0496102_0210499 | |||
| 1199 | Ga0496103_0081016 | |||
| 1200 | Ga0496104_0000515 | |||
| 1201 | Ga0496104_0067549 | |||
| 1202 | Ga0496104_0080380 | |||
| 1203 | Ga0496105_0244461 | |||
| 1204 | Ga0496106_0015310 | |||
| 1205 | Ga0496106_0158605 | |||
| 1206 | Ga0496107_0015088 | |||
| 1207 | Ga0496107_0090827 | |||
| 1208 | Ga0496108_0008991 | |||
| 1209 | Ga0496109_0001064 | |||
| 1210 | Ga0496109_0113508 | |||
| 1211 | Ga0496110_0193022 | |||
| 1212 | Ga0496111_0055737 | |||
| 1213 | Ga0496111_0081328 | |||
| 1214 | Ga0496111_0148541 | |||
| 1215 | Ga0496112_0075018 | |||
| 1216 | Ga0496113_0004800 | |||
| 1217 | Ga0496115_0045598 | |||
| 1218 | Ga0496115_0138609 | |||
| 1219 | Ga0501031_0001427 | |||
| 1220 | Ga0501032_0002436 | |||
| 1221 | Ga0501032_0062303 | |||
| 1222 | Ga0501033_0000244 | |||
| 1223 | Ga0501033_0013241 | |||
| 1224 | Ga0501034_0000159 | |||
| 1225 | Ga0501034_0031979 | |||
| 1226 | Ga0501034_0046375 | |||
| 1227 | Ga0501034_0187526 | |||
| 1228 | Ga0501036_0000039 | |||
| 1229 | Ga0501036_0079493 | |||
| 1230 | Ga0501037_0003835 | |||
| 1231 | Ga0501038_0001751 | |||
| 1232 | Ga0501038_0062161 | |||
| 1233 | Ga0501038_0265310 | |||
| 1234 | Ga0501039_0001324 | |||
| 1235 | Ga0501039_0101558 | |||
| 1236 | Ga0501042_0064050 | |||
| 1237 | Ga0501043_0030468 | |||
| 1238 | Ga0501046_0000185 | |||
| 1239 | Ga0501047_0000385 | |||
| 1240 | Ga0501047_0010053 | |||
| 1241 | Ga0501047_0133021 | |||
| 1242 | Ga0501047_0157297 | |||
| 1243 | Ga0501047_0315416 | |||
| 1244 | Ga0501048_0007283 | |||
| 1245 | Ga0501048_0335808 | |||
| 1246 | Ga0501067_0000513 | |||
| 1247 | Ga0501068_0001337 | |||
| 1248 | Ga0501068_0026119 | |||
| 1249 | Ga0501069_0006089 | |||
| 1250 | Ga0501069_0149490 | |||
| 1251 | Ga0501070_0003256 | |||
| 1252 | Ga0501070_0008612 | |||
| 1253 | Ga0501070_0010383 | |||
| 1254 | Ga0501070_0112369 | |||
| 1255 | Ga0501072_0001656 | |||
| 1256 | Ga0501072_0038222 | |||
| 1257 | Ga0501072_0106012 | |||
| 1258 | Ga0501073_0000374 | |||
| 1259 | Ga0501073_0000702 | |||
| 1260 | Ga0501073_0025314 | |||
| 1261 | Ga0501073_0045790 | |||
| 1262 | Ga0501073_0115244 | |||
| 1263 | Ga0501074_0000125 | |||
| 1264 | Ga0501074_0001567 | |||
| 1265 | Ga0501074_0148255 | |||
| 1266 | Ga0501079_0026149 | |||
| 1267 | Ga0501079_0085132 | |||
| 1268 | Ga0501080_0000380 | |||
| 1269 | Ga0501080_0001529 | |||
| 1270 | Ga0501080_0007162 | |||
| 1271 | Ga0501080_0227275 | |||
| 1272 | Ga0501080_0287175 | |||
| 1273 | Ga0501083_0001646 | |||
| 1274 | Ga0501083_0004058 | |||
| 1275 | Ga0501083_0017169 | |||
| 1276 | Ga0501035_0001985 | |||
| 1277 | Ga0501035_0026028 | |||
| 1278 | Ga0501035_0045442 | |||
| 1279 | Ga0501035_0059100 | |||
| 1280 | Ga0501035_0306211 | |||
| 1281 | Ga0501044_0001993 | |||
| 1282 | Ga0501044_0171954 | |||
| 1283 | Ga0501044_0172377 | |||
| 1284 | Ga0501044_0475538 | |||
| 1285 | nmdc:mga0yw44_56609_c1 | |||
| 1286 | nmdc:mga07m45_24106_c2 | |||
| 1287 | nmdc:mga08y16_14377_c1 | |||
| 1288 | nmdc:mga0n895_41223_c1 | |||
| 1289 | nmdc:mga0a205_65088_c1 | |||
| 1290 | Ga0495601_0000731 | |||
| 1291 | Ga0495601_0001011 | |||
| 1292 | Ga0495601_0005133 | |||
| 1293 | Ga0495601_0006865 | |||
| 1294 | Ga0495601_0010360 | |||
| 1295 | Ga0495601_0011836 | |||
| 1296 | Ga0495601_0012932 | |||
| 1297 | Ga0495612_0006577 | |||
| 1298 | Ga0495612_0007659 | |||
| 1299 | Ga0495595_0000356 | |||
| 1300 | Ga0495595_0001701 | |||
| 1301 | Ga0495595_0001936 | |||
| 1302 | Ga0495595_0002476 | |||
| 1303 | Ga0495619_0001094 | |||
| 1304 | Ga0495619_0010836 | |||
| 1305 | Ga0495619_0013399 | |||
| 1306 | Ga0495619_0030417 | |||
| 1307 | Ga0495619_0034502 | |||
| 1308 | Ga0495619_0105669 | |||
| 1309 | Ga0495619_0243271 | |||
| 1310 | Ga0500652_004490 | |||
| 1311 | Ga0501084_0023641 | |||
| 1312 | Ga0501082_0000570 | |||
| 1313 | Ga0501082_0026405 | |||
| 1314 | Ga0501082_0086600 | |||
| 1315 | Ga0501082_0173828 | |||
| 1316 | Ga0530510_0149019 | |||
| 1317 | 2643754663 | |||
| 1318 | 2643838558 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4p47-assembly1.cif.gz_A | crystal structure of a trap periplasmic solute binding protein from ochrobactrum anthropi (oant_4429), target efi-510151, c-termius bound in ligand binding pocket | 0.9177 | 8 | 315 |
| 4mev-assembly1.cif.gz_A | crystal structure of a trap periplasmic solute binding protein from rhodoferax ferrireducens (rfer_1840), target efi-510211, with bound malonate, space group i422 | 0.9139 | 11 | 317 |
| 4mev-assembly1.cif.gz_A | crystal structure of a trap periplasmic solute binding protein from rhodoferax ferrireducens (rfer_1840), target efi-510211, with bound malonate, space group i422 | 0.9001 | 11 | 317 |
| 3gyy-assembly1.cif.gz_A | the ectoine binding protein of the teaabc trap transporter teaa in the apo-state | 0.8913 | 12 | 315 |
| 4pf8-assembly1.cif.gz_A | crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. nas-14.1 (target efi-510299) with bound beta-d-galacturonate | 0.8893 | 13 | 314 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4p47A00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9177 | 8 | 315 | 3.40.190.170 |
| 4mevA00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9139 | 11 | 317 | 3.40.190.170 |
| 4mevA00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9001 | 11 | 317 | 3.40.190.170 |
| 3gyyA00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.8913 | 12 | 315 | 3.40.190.170 |
| 4p1eA00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.8834 | 11 | 317 | 3.40.190.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N6T2D2-F1-model_v4 | C4-dicarboxylate ABC transporter | 0.9291 | 1 | 314 |
GO:0015740
GO:0055085 |
| AF-A0A7S7SU36-F1-model_v4 | TRAP transporter substrate-binding protein DctP | 0.918 | 9 | 313 |
GO:0015740
GO:0055085 |
| AF-A0A6N6T2D2-F1-model_v4 | C4-dicarboxylate ABC transporter | 0.9179 | 1 | 314 |
GO:0015740
GO:0055085 |
| AF-A0A850MZ18-F1-model_v4 | deleted | 0.9157 | 10 | 317 |
|
| AF-A0A8A7T859-F1-model_v4 | deleted | 0.9114 | 10 | 314 |
|