F473261

General Info

Members Datasets Scaffolds Average Seq Length
659 297 1318 329

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0087050|Ga0373937_0087050_421_1602
Length 393
Sequence VAADRVPLDRTAQPRTPVFEWACCSARRRGAGAPGGVFSYCLLSTTCGVQPAATTAQKEEYMMSKISSFFAFAAIAILLSAPADAQVTMRASHQFPGGKGDVRDDMVQMIAKDVGAANVGLTIQVYPGASLFKPNDQWNAIVNGQLDITLFPLDYASGKVPVFSATLMPGLIRSQDRAKRINNSPFMTDVRAEIEKHGAIVLSDAWFAGGVAAKGGCIVHPSDMKGRKLRAAGPTFAAMWESAGASIVSPPSNEIYNAFQSGVVNGTDTSLGTFQSMRLYEVTDCLTAPGNNALWFMYEPVLMSKKSFDKLNKAQQDAIIAAGKKAQAYYEGKADEVNKEAIKAFEDHKVKVVSLSDADYQAWLEVARKSSYAKFAQDVPNGQKLIDEALAVK

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
12 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
162 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
163 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
164 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
165 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
166 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
167 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
168 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
169 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
170 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
171 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
177 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
185 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
186 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
230 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
284 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
288 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
289 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
290 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
293 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
296 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
297 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 3.34
Rhizosphere 95.3
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0087050 3300036401 Bacteria 2891
2 2214911869 2209111006 Bacteria 6786
3 ARcpr5oldR_c000029 3300000041 Bacteria 29077
4 ARSoilYngRDRAFT_c00072 3300000042 Bacteria 16897
5 ARcpr5yngRDRAFT_c000051 3300000043 Bacteria 18515
6 ARSoilOldRDRAFT_c000078 3300000044 Bacteria 18538
7 ARCol0oldRDRAFT_c00459 3300000045 Bacteria 3845
8 ARCol0yngRDRAFT_1000056 3300000652 Bacteria 20075
9 JGI24737J22298_10012020 3300001990 Bacteria 2827
10 JGI25405J52794_10017317 3300003911 Bacteria 1430
11 Ga0065717_1002104 3300005276 Bacteria 2915
12 Ga0065716_1002476 3300005277 Bacteria 1756
13 Ga0065704_10083802 3300005289 Bacteria 3415
14 Ga0065715_10106453 3300005293 Bacteria 2829
15 Ga0070658_10012028 3300005327 Bacteria 6951
16 Ga0070658_10089225 3300005327 Bacteria 2539
17 Ga0070658_10147435 3300005327 Bacteria 1968
18 Ga0070676_10147513 3300005328 Bacteria 1503
19 Ga0070683_100029663 3300005329 Bacteria 4957
20 Ga0070683_100035510 3300005329 Bacteria 4556
21 Ga0070683_100096539 3300005329 Bacteria 2780
22 Ga0070680_100029424 3300005336 Bacteria 4413
23 Ga0070680_100069612 3300005336 Bacteria 2889
24 Ga0070680_100290154 3300005336 Bacteria 1387
25 Ga0068868_100074621 3300005338 Bacteria 2709
26 Ga0070660_100007264 3300005339 Bacteria 7714
27 Ga0070660_100144635 3300005339 Bacteria 1909
28 Ga0070691_10041412 3300005341 Bacteria 2178
29 Ga0070661_100000534 3300005344 Bacteria 29159
30 Ga0070661_100013055 3300005344 Bacteria 5825
31 Ga0070692_10010043 3300005345 Bacteria 4294
32 Ga0070692_10070074 3300005345 Bacteria 1866
33 Ga0070669_100028908 3300005353 Bacteria 3994
34 Ga0070675_100039583 3300005354 Bacteria 3847
35 Ga0070688_100016727 3300005365 Bacteria 4199
36 Ga0070688_100135663 3300005365 Bacteria 1666
37 Ga0070659_100094240 3300005366 Bacteria 2404
38 Ga0070667_100021395 3300005367 Bacteria 5371
39 Ga0070667_100142260 3300005367 Bacteria 2102
40 Ga0070703_10009780 3300005406 Bacteria 2703
41 Ga0070709_10008931 3300005434 Bacteria 5517
42 Ga0070709_10144689 3300005434 Bacteria 1636
43 Ga0070714_100004852 3300005435 Bacteria 10210
44 Ga0070714_100071605 3300005435 Bacteria 2998
45 Ga0070714_100075499 3300005435 Bacteria 2924
46 Ga0070714_100245884 3300005435 Bacteria 1653
47 Ga0070713_100015251 3300005436 Bacteria 5734
48 Ga0070713_100035154 3300005436 Bacteria 4031
49 Ga0070713_100043614 3300005436 Bacteria 3668
50 Ga0070713_100165511 3300005436 Bacteria 1977
51 Ga0070713_100233619 3300005436 Bacteria 1672
52 Ga0070710_10043415 3300005437 Bacteria 2490
53 Ga0070710_10257431 3300005437 Bacteria 1124
54 Ga0070711_100021985 3300005439 Bacteria 4130
55 Ga0070711_100046980 3300005439 Bacteria 2944
56 Ga0070711_100048137 3300005439 Bacteria 2913
57 Ga0070694_100102197 3300005444 Bacteria 2029
58 Ga0070663_100069216 3300005455 Bacteria 2563
59 Ga0070681_10004821 3300005458 Bacteria 12928
60 Ga0070681_10060239 3300005458 Bacteria 3774
61 Ga0070681_10066993 3300005458 Bacteria 3559
62 Ga0070681_10104672 3300005458 Bacteria 2772
63 Ga0074259_12105788 3300005507 Bacteria 1310
64 Ga0070699_100015846 3300005518 Bacteria 6470
65 Ga0070679_100011066 3300005530 Bacteria 8583
66 Ga0070679_100016685 3300005530 Bacteria 7093
67 Ga0070679_100017604 3300005530 Bacteria 6917
68 Ga0070679_100065636 3300005530 Bacteria 3617
69 Ga0070679_100111202 3300005530 Bacteria 2726
70 Ga0070679_100186321 3300005530 Bacteria 2046
71 Ga0070684_100008632 3300005535 Bacteria 7983
72 Ga0070684_100022129 3300005535 Bacteria 5299
73 Ga0070684_100076053 3300005535 Bacteria 2963
74 Ga0068853_100004769 3300005539 Bacteria 10539
75 Ga0068853_100010929 3300005539 Bacteria 7359
76 Ga0070672_100073562 3300005543 Bacteria 2724
77 Ga0070672_100342037 3300005543 Bacteria 1274
78 Ga0070686_100034533 3300005544 Bacteria 3117
79 Ga0070695_100002680 3300005545 Bacteria 10305
80 Ga0070696_100001722 3300005546 Bacteria 14339
81 Ga0070696_100027300 3300005546 Bacteria 3888
82 Ga0070696_100094394 3300005546 Bacteria 2135
83 Ga0070704_100019446 3300005549 Bacteria 4363
84 Ga0068855_100007766 3300005563 Bacteria 12955
85 Ga0068855_100008252 3300005563 Bacteria 12590
86 Ga0068855_100069930 3300005563 Bacteria 4084
87 Ga0068855_100073898 3300005563 Bacteria 3960
88 Ga0068855_100192890 3300005563 Bacteria 2297
89 Ga0068855_100217464 3300005563 Bacteria 2144
90 Ga0070664_100001929 3300005564 Bacteria 16665
91 Ga0068857_100001319 3300005577 Bacteria 19521
92 Ga0068857_100115620 3300005577 Bacteria 2413
93 Ga0068857_100117321 3300005577 Bacteria 2395
94 Ga0068857_100254726 3300005577 Bacteria 1610
95 Ga0068854_100016881 3300005578 Bacteria 4875
96 Ga0068854_100050830 3300005578 Bacteria 2968
97 Ga0068854_100170336 3300005578 Bacteria 1694
98 Ga0068856_100003061 3300005614 Bacteria 17098
99 Ga0068856_100138006 3300005614 Bacteria 2444
100 Ga0068856_100177033 3300005614 Bacteria 2146
101 Ga0070702_100025455 3300005615 Bacteria 3171
102 Ga0068852_100000554 3300005616 Bacteria 24527
103 Ga0068852_100002959 3300005616 Bacteria 11801
104 Ga0068852_100004557 3300005616 Bacteria 9813
105 Ga0068852_100083301 3300005616 Bacteria 2844
106 Ga0068852_100086236 3300005616 Bacteria 2798
107 Ga0068852_100233337 3300005616 Bacteria 1755
108 Ga0068859_100291001 3300005617 Bacteria 1726
109 Ga0068861_100019068 3300005719 Bacteria 4897
110 Ga0068851_10008121 3300005834 Bacteria 4844
111 Ga0068863_100301324 3300005841 Bacteria 1555
112 Ga0068858_100024666 3300005842 Bacteria 5600
113 Ga0068858_100140765 3300005842 Bacteria 2265
114 Ga0068860_100034634 3300005843 Bacteria 4844
115 Ga0068862_100016334 3300005844 Bacteria 6178
116 Ga0081455_10010000 3300005937 Bacteria 9697
117 Ga0081540_1003907 3300005983 Bacteria 11608
118 Ga0075365_10025911 3300006038 Bacteria 3716
119 Ga0075364_10148885 3300006051 Bacteria 1577
120 Ga0075432_10055282 3300006058 Bacteria 1406
121 Ga0070715_10118308 3300006163 Bacteria 1260
122 Ga0070712_100014927 3300006175 Bacteria 4994
123 Ga0097621_100040496 3300006237 Bacteria 3746
124 Ga0097621_100097801 3300006237 Bacteria 2465
125 Ga0075370_10038270 3300006353 Bacteria 2699
126 Ga0068871_100009241 3300006358 Bacteria 7130
127 Ga0068871_100028870 3300006358 Bacteria 4353
128 Ga0097620_100291019 3300006931 Bacteria 1726
129 Ga0105240_10002585 3300009093 Bacteria 28988
130 Ga0105240_10007789 3300009093 Bacteria 15482
131 Ga0105240_10026466 3300009093 Bacteria 7611
132 Ga0105240_10053422 3300009093 Bacteria 5070
133 Ga0111539_10007739 3300009094 Bacteria 13721
134 Ga0105245_10102254 3300009098 Bacteria 2654
135 Ga0105247_10013648 3300009101 Bacteria 4873
136 Ga0105247_10047888 3300009101 Bacteria 2626
137 Ga0105243_10009481 3300009148 Bacteria 7411
138 Ga0105241_10013737 3300009174 Bacteria 5931
139 Ga0105241_10033974 3300009174 Bacteria 3831
140 Ga0105242_10003746 3300009176 Bacteria 11815
141 Ga0105248_10008602 3300009177 Bacteria 11211
142 Ga0105237_10162124 3300009545 Bacteria 2235
143 Ga0105238_10005650 3300009551 Bacteria 12365
144 Ga0105238_10009355 3300009551 Bacteria 9813
145 Ga0105238_10018906 3300009551 Bacteria 7017
146 Ga0105238_10156841 3300009551 Bacteria 2251
147 Ga0105238_10198599 3300009551 Bacteria 1981
148 Ga0105238_10266416 3300009551 Bacteria 1693
149 Ga0105249_10006636 3300009553 Bacteria 10070
150 Ga0105246_10014859 3300011119 Bacteria 4904
151 Ga0157315_1000484 3300012508 Bacteria 1851
152 Ga0157373_10091002 3300013100 Bacteria 2148
153 Ga0157373_10119000 3300013100 Bacteria 1856
154 Ga0157371_10019442 3300013102 Bacteria 5010
155 Ga0157371_10041023 3300013102 Bacteria 3304
156 Ga0157371_10102975 3300013102 Bacteria 2026
157 Ga0157370_10001270 3300013104 Bacteria 31545
158 Ga0157370_10003871 3300013104 Bacteria 17431
159 Ga0157370_10009975 3300013104 Bacteria 10050
160 Ga0157370_10020607 3300013104 Bacteria 6582
161 Ga0157370_10061699 3300013104 Bacteria 3558
162 Ga0157370_10136016 3300013104 Bacteria 2291
163 Ga0157370_10160929 3300013104 Bacteria 2089
164 Ga0157370_10238178 3300013104 Bacteria 1684
165 Ga0157369_10000895 3300013105 Bacteria 38049
166 Ga0157369_10002601 3300013105 Bacteria 21597
167 Ga0157369_10113846 3300013105 Bacteria 2873
168 Ga0157369_10196083 3300013105 Bacteria 2121
169 Ga0157369_10399800 3300013105 Bacteria 1425
170 Ga0157374_10081300 3300013296 Bacteria 3075
171 Ga0157374_10154841 3300013296 Bacteria 2230
172 Ga0157378_10302397 3300013297 Bacteria 1548
173 Ga0163162_10021249 3300013306 Bacteria 6388
174 Ga0163162_10056217 3300013306 Bacteria 3964
175 Ga0163162_10114262 3300013306 Bacteria 2799
176 Ga0163162_10241467 3300013306 Bacteria 1937
177 Ga0157372_10004580 3300013307 Bacteria 14701
178 Ga0157372_10022454 3300013307 Bacteria 6829
179 Ga0157372_10027347 3300013307 Bacteria 6210
180 Ga0157372_10034933 3300013307 Bacteria 5532
181 Ga0157372_10126363 3300013307 Bacteria 2940
182 Ga0157372_10232687 3300013307 Bacteria 2136
183 Ga0157375_10015977 3300013308 Bacteria 6733
184 Ga0157375_10154689 3300013308 Bacteria 2431
185 Ga0163163_10000757 3300014325 Bacteria 27476
186 Ga0163163_10001222 3300014325 Bacteria 21707
187 Ga0157380_10038881 3300014326 Bacteria 3696
188 Ga0157377_10030644 3300014745 Bacteria 2916
189 Ga0157377_10169037 3300014745 Bacteria 1366
190 Ga0157379_10134030 3300014968 Bacteria 2231
191 Ga0157379_10245781 3300014968 Bacteria 1623
192 Ga0157376_10041184 3300014969 Bacteria 3781
193 Ga0157376_10247744 3300014969 Bacteria 1663
194 Ga0207666_1000343 3300025271 Bacteria 6396
195 Ga0207697_10007410 3300025315 Bacteria 4897
196 Ga0207656_10088259 3300025321 Bacteria 1404
197 Ga0207692_10004582 3300025898 Bacteria 5481
198 Ga0207688_10004300 3300025901 Bacteria 7767
199 Ga0207680_10266326 3300025903 Bacteria 1187
200 Ga0207647_10047471 3300025904 Bacteria 2671
201 Ga0207699_10052120 3300025906 Bacteria 2421
202 Ga0207645_10040159 3300025907 Bacteria 2997
203 Ga0207705_10016504 3300025909 Bacteria 5290
204 Ga0207705_10019680 3300025909 Bacteria 4827
205 Ga0207705_10060216 3300025909 Bacteria 2742
206 Ga0207705_10102758 3300025909 Bacteria 2104
207 Ga0207654_10023112 3300025911 Bacteria 3326
208 Ga0207654_10023523 3300025911 Bacteria 3301
209 Ga0207654_10128529 3300025911 Bacteria 1601
210 Ga0207707_10011542 3300025912 Bacteria 7692
211 Ga0207707_10028062 3300025912 Bacteria 4920
212 Ga0207707_10194815 3300025912 Bacteria 1768
213 Ga0207707_10264712 3300025912 Bacteria 1491
214 Ga0207707_10457711 3300025912 Bacteria 1091
215 Ga0207695_10004433 3300025913 Bacteria 19160
216 Ga0207695_10017259 3300025913 Bacteria 8404
217 Ga0207695_10032370 3300025913 Bacteria 5722
218 Ga0207695_10096789 3300025913 Bacteria 2953
219 Ga0207695_10130049 3300025913 Bacteria 2476
220 Ga0207671_10060402 3300025914 Bacteria 2812
221 Ga0207693_10026873 3300025915 Bacteria 4552
222 Ga0207663_10108042 3300025916 Bacteria 1883
223 Ga0207660_10047796 3300025917 Bacteria 3027
224 Ga0207660_10195634 3300025917 Bacteria 1577
225 Ga0207660_10223221 3300025917 Bacteria 1479
226 Ga0207662_10208455 3300025918 Bacteria 1268
227 Ga0207657_10009889 3300025919 Bacteria 9548
228 Ga0207657_10133464 3300025919 Bacteria 2033
229 Ga0207657_10262520 3300025919 Bacteria 1374
230 Ga0207649_10002364 3300025920 Bacteria 10572
231 Ga0207649_10019384 3300025920 Bacteria 3887
232 Ga0207649_10032953 3300025920 Bacteria 3092
233 Ga0207652_10008705 3300025921 Bacteria 8168
234 Ga0207652_10041447 3300025921 Bacteria 3914
235 Ga0207652_10062760 3300025921 Bacteria 3211
236 Ga0207652_10070843 3300025921 Bacteria 3028
237 Ga0207652_10092261 3300025921 Bacteria 2664
238 Ga0207646_10077035 3300025922 Bacteria 2980
239 Ga0207681_10066864 3300025923 Bacteria 2489
240 Ga0207681_10319148 3300025923 Bacteria 1235
241 Ga0207694_10002378 3300025924 Bacteria 15389
242 Ga0207694_10014709 3300025924 Bacteria 5900
243 Ga0207694_10035460 3300025924 Bacteria 3827
244 Ga0207694_10058866 3300025924 Bacteria 2988
245 Ga0207694_10085831 3300025924 Bacteria 2478
246 Ga0207659_10065689 3300025926 Bacteria 2630
247 Ga0207687_10022697 3300025927 Bacteria 4179
248 Ga0207687_10233088 3300025927 Bacteria 1455
249 Ga0207700_10137977 3300025928 Bacteria 2000
250 Ga0207700_10212529 3300025928 Bacteria 1636
251 Ga0207664_10003344 3300025929 Bacteria 10662
252 Ga0207664_10007925 3300025929 Bacteria 7381
253 Ga0207664_10023865 3300025929 Bacteria 4589
254 Ga0207690_10094227 3300025932 Bacteria 2124
255 Ga0207690_10107839 3300025932 Bacteria 2001
256 Ga0207690_10136275 3300025932 Bacteria 1803
257 Ga0207706_10007810 3300025933 Bacteria 9874
258 Ga0207686_10017403 3300025934 Bacteria 4050
259 Ga0207686_10064900 3300025934 Bacteria 2326
260 Ga0207686_10241750 3300025934 Bacteria 1314
261 Ga0207709_10092973 3300025935 Bacteria 1976
262 Ga0207665_10242423 3300025939 Bacteria 1329
263 Ga0207711_10067338 3300025941 Bacteria 3099
264 Ga0207711_10116633 3300025941 Bacteria 2381
265 Ga0207661_10081182 3300025944 Bacteria 2678
266 Ga0207661_10259003 3300025944 Bacteria 1549
267 Ga0207667_10001311 3300025949 Bacteria 31212
268 Ga0207667_10018592 3300025949 Bacteria 7788
269 Ga0207667_10038687 3300025949 Bacteria 5090
270 Ga0207667_10048328 3300025949 Bacteria 4499
271 Ga0207667_10065695 3300025949 Bacteria 3783
272 Ga0207667_10070130 3300025949 Bacteria 3648
273 Ga0207667_10142924 3300025949 Bacteria 2464
274 Ga0207667_10152458 3300025949 Bacteria 2378
275 Ga0207668_10140812 3300025972 Bacteria 1855
276 Ga0207640_10042585 3300025981 Bacteria 2896
277 Ga0207640_10154434 3300025981 Bacteria 1690
278 Ga0207658_10011174 3300025986 Bacteria 6116
279 Ga0207658_10112167 3300025986 Bacteria 2158
280 Ga0207703_10047022 3300026035 Bacteria 3478
281 Ga0207703_10108888 3300026035 Bacteria 2360
282 Ga0207703_10390416 3300026035 Bacteria 1289
283 Ga0207639_10016878 3300026041 Bacteria 5173
284 Ga0207639_10132234 3300026041 Bacteria 2067
285 Ga0207639_10225641 3300026041 Bacteria 1621
286 Ga0207678_10012696 3300026067 Bacteria 7399
287 Ga0207708_10004283 3300026075 Bacteria 10507
288 Ga0207702_10002277 3300026078 Bacteria 18412
289 Ga0207702_10105381 3300026078 Bacteria 2497
290 Ga0207641_10193239 3300026088 Bacteria 1872
291 Ga0207674_10000039 3300026116 Bacteria 131096
292 Ga0207674_10092964 3300026116 Bacteria 3005
293 Ga0207674_10146800 3300026116 Bacteria 2317
294 Ga0207675_100015653 3300026118 Bacteria 7073
295 Ga0207698_10003989 3300026142 Bacteria 8953
296 Ga0207698_10011251 3300026142 Bacteria 5792
297 Ga0207698_10019968 3300026142 Bacteria 4601
298 Ga0207698_10405485 3300026142 Bacteria 1304
299 Ga0209966_1002877 3300027695 Bacteria 2886
300 Ga0209998_10000758 3300027717 Bacteria 8460
301 Ga0207428_10014000 3300027907 Bacteria 6986
302 Ga0268264_10069274 3300028381 Bacteria 2983
303 Ga0265338_10033308 3300028800 Bacteria 5002
304 Ga0265338_10098428 3300028800 Bacteria 2393
305 Ga0265325_10000004 3300031241 Bacteria 347347
306 Ga0265325_10034833 3300031241 Bacteria 2676
307 Ga0265325_10043495 3300031241 Bacteria 2343
308 Ga0265325_10048228 3300031241 Bacteria 2202
309 Ga0265325_10086133 3300031241 Bacteria 1555
310 Ga0265340_10025334 3300031247 Bacteria 3004
311 Ga0265339_10010467 3300031249 Bacteria 5761
312 Ga0265316_10066828 3300031344 Bacteria 2781
313 Ga0265313_10009264 3300031595 Bacteria 6412
314 Ga0265313_10048143 3300031595 Bacteria 2059
315 Ga0265314_10016876 3300031711 Bacteria 5752
316 Ga0265342_10000182 3300031712 Bacteria 70252
317 Ga0307405_10072929 3300031731 Bacteria 2215
318 Ga0373930_0000532 3300034816 Bacteria 5242
319 Ga0373948_0000419 3300034817 Bacteria 5248
320 Ga0373950_0000167 3300034818 Bacteria 9380
321 Ga0373958_0002350 3300034819 Bacteria 2638
322 Ga0373938_0000028 3300034957 Bacteria 18996
323 Ga0373928_0000334 3300035084 Bacteria 9420
324 Ga0373929_0001866 3300035085 Bacteria 3948
325 Ga0373934_0001517 3300035086 Bacteria 8514
326 Ga0373934_0005199 3300035086 Bacteria 4815
327 Ga0373934_0012356 3300035086 Bacteria 3224
328 Ga0373934_0013164 3300035086 Bacteria 3124
329 Ga0373949_0001620 3300035090 Bacteria 6293
330 Ga0373951_0000666 3300035091 Bacteria 9448
331 Ga0373952_0000851 3300035092 Bacteria 5544
332 Ga0373923_0024586 3300035111 Bacteria 2378
333 Ga0373923_0049411 3300035111 Bacteria 1759
334 Ga0373932_0000749 3300035112 Bacteria 9676
335 Ga0373936_0005568 3300035113 Bacteria 4751
336 Ga0373939_0001838 3300035114 Bacteria 5105
337 Ga0373939_0016499 3300035114 Bacteria 1948
338 Ga0373941_0000671 3300035115 Bacteria 6933
339 Ga0373941_0005651 3300035115 Bacteria 2960
340 Ga0373945_0053045 3300035116 Bacteria 1496
341 Ga0373945_0097102 3300035116 Bacteria 1149
342 Ga0373953_0008219 3300035117 Bacteria 3533
343 Ga0373953_0012296 3300035117 Bacteria 3027
344 Ga0373953_0019942 3300035117 Bacteria 2501
345 Ga0373954_0000002 3300035118 Bacteria 147478
346 Ga0373954_0003738 3300035118 Bacteria 6489
347 Ga0373954_0006044 3300035118 Bacteria 5266
348 Ga0373954_0007284 3300035118 Bacteria 4836
349 Ga0373954_0014031 3300035118 Bacteria 3571
350 Ga0373956_0000945 3300035119 Bacteria 12079
351 Ga0373956_0002179 3300035119 Bacteria 8087
352 Ga0373956_0019484 3300035119 Bacteria 2877
353 Ga0373956_0107005 3300035119 Bacteria 1300
354 Ga0373957_0000339 3300035120 Bacteria 11828
355 Ga0373957_0002968 3300035120 Bacteria 4921
356 Ga0373957_0003036 3300035120 Bacteria 4882
357 Ga0373957_0024413 3300035120 Bacteria 2171
358 Ga0373960_0000599 3300035121 Bacteria 7394
359 Ga0373955_0001962 3300035172 Bacteria 8862
360 Ga0373955_0014629 3300035172 Bacteria 3822
361 Ga0373955_0028909 3300035172 Bacteria 2878
362 Ga0373955_0034110 3300035172 Bacteria 2684
363 Ga0373955_0064377 3300035172 Bacteria 2032
364 Ga0373955_0081179 3300035172 Bacteria 1833
365 Ga0373942_0005239 3300035207 Bacteria 3003
366 Ga0373961_0000433 3300035241 Bacteria 17272
367 Ga0373962_0000881 3300035242 Bacteria 6853
368 Ga0373924_0004417 3300035410 Bacteria 4909
369 Ga0373924_0025366 3300035410 Bacteria 2344
370 Ga0373924_0057243 3300035410 Bacteria 1625
371 Ga0373924_0117377 3300035410 Bacteria 1153
372 Ga0373935_0026607 3300035692 Bacteria 3572
373 Ga0373935_0057754 3300035692 Bacteria 2476
374 Ga0373935_0157622 3300035692 Bacteria 1545
375 Ga0373935_0296636 3300035692 Bacteria 1141
376 Ga0373927_0003675 3300035695 Bacteria 10916
377 Ga0373927_0093708 3300035695 Bacteria 1951
378 Ga0373927_0288887 3300035695 Bacteria 1079
379 Ga0373933_0000890 3300035724 Bacteria 18271
380 Ga0373933_0001687 3300035724 Bacteria 12853
381 Ga0373933_0001764 3300035724 Bacteria 12529
382 Ga0373933_0002111 3300035724 Bacteria 11412
383 Ga0373933_0005461 3300035724 Bacteria 6922
384 Ga0373933_0011582 3300035724 Bacteria 4865
385 Ga0373933_0041104 3300035724 Bacteria 2728
386 Ga0373933_0042536 3300035724 Bacteria 2685
387 Ga0373947_0063299 3300035725 Bacteria 2253
388 Ga0373947_0100781 3300035725 Bacteria 1815
389 Ga0373947_0115514 3300035725 Bacteria 1701
390 Ga0373947_0195698 3300035725 Unclassified 1321
391 Ga0373947_0203572 3300035725 Bacteria 1296
392 Ga0373937_0001304 3300036401 Bacteria 20884
393 Ga0373937_0001794 3300036401 Bacteria 18033
394 Ga0373937_0004227 3300036401 Bacteria 12173
395 Ga0373937_0005332 3300036401 Bacteria 10992
396 Ga0373937_0006421 3300036401 Bacteria 10147
397 Ga0373937_0007322 3300036401 Bacteria 9554
398 Ga0373937_0009035 3300036401 Bacteria 8651
399 Ga0373937_0027575 3300036401 Bacteria 5136
400 Ga0373937_0035972 3300036401 Bacteria 4510
401 Ga0373937_0197854 3300036401 Bacteria 1889
402 Ga0439465_0047164 3300041413 Bacteria 1404
403 Ga0451853_1695856 3300041512 Bacteria 1978
404 Ga0453684_0140242 3300044712 Bacteria 2888
405 Ga0451576_0065472 3300045051 Bacteria 3784
406 Ga0495617_024276 3300046452 Bacteria 2046
407 Ga0495592_0000589 3300046454 Bacteria 25846
408 Ga0495592_0002245 3300046454 Bacteria 13625
409 Ga0495592_0028842 3300046454 Bacteria 4200
410 Ga0495592_0040216 3300046454 Bacteria 3509
411 Ga0495592_0075908 3300046454 Bacteria 2440
412 Ga0495603_0020971 3300046455 Bacteria 3957
413 Ga0495629_0013396 3300046459 Bacteria 5917
414 Ga0495651_0003925 3300046462 Bacteria 11374
415 Ga0495651_0021054 3300046462 Bacteria 5064
416 Ga0495651_0031350 3300046462 Bacteria 4145
417 Ga0495651_0037541 3300046462 Bacteria 3772
418 Ga0495651_0050023 3300046462 Bacteria 3225
419 Ga0495651_0115579 3300046462 Bacteria 1978
420 Ga0495651_0118498 3300046462 Bacteria 1948
421 Ga0495653_0001655 3300046463 Bacteria 17515
422 Ga0495653_0004752 3300046463 Bacteria 10998
423 Ga0495653_0059041 3300046463 Bacteria 2913
424 Ga0495653_0061026 3300046463 Bacteria 2854
425 Ga0495580_0050116 3300046472 Bacteria 2953
426 Ga0495582_0083300 3300046473 Bacteria 1777
427 Ga0495639_0007311 3300046475 Bacteria 4737
428 Ga0495662_0032507 3300046476 Bacteria 2520
429 Ga0495664_0005496 3300046477 Bacteria 6958
430 Ga0495664_0151611 3300046477 Bacteria 1406
431 Ga0495585_0008414 3300046492 Bacteria 6254
432 Ga0495594_0127852 3300046499 Bacteria 1438
433 Ga0495583_0083296 3300046506 Unclassified 1387
434 Ga0495608_0001793 3300046511 Bacteria 15332
435 Ga0495608_0001817 3300046511 Bacteria 15244
436 Ga0495608_0005922 3300046511 Bacteria 8694
437 Ga0495608_0021073 3300046511 Bacteria 4476
438 Ga0495608_0044062 3300046511 Bacteria 2979
439 Ga0495608_0072761 3300046511 Bacteria 2242
440 Ga0495608_0084732 3300046511 Bacteria 2055
441 Ga0495618_0008159 3300046514 Bacteria 6345
442 Ga0495618_0018196 3300046514 Bacteria 4314
443 Ga0495618_0072351 3300046514 Bacteria 2194
444 Ga0495618_0157805 3300046514 Bacteria 1447
445 Ga0495628_0004889 3300046516 Bacteria 11794
446 Ga0495628_0009824 3300046516 Bacteria 8149
447 Ga0495628_0014727 3300046516 Bacteria 6547
448 Ga0495628_0159097 3300046516 Bacteria 1717
449 Ga0495630_0027998 3300046517 Bacteria 4187
450 Ga0495630_0041594 3300046517 Bacteria 3432
451 Ga0495630_0122574 3300046517 Bacteria 1972
452 Ga0495630_0134107 3300046517 Bacteria 1881
453 Ga0495644_0014794 3300046523 Bacteria 2988
454 Ga0495652_0010464 3300046529 Bacteria 8406
455 Ga0495652_0013953 3300046529 Bacteria 7223
456 Ga0495652_0089741 3300046529 Bacteria 2516
457 Ga0495665_0069040 3300046531 Bacteria 1863
458 Ga0495640_0005362 3300046533 Bacteria 10199
459 Ga0495640_0013444 3300046533 Bacteria 6218
460 Ga0495640_0027536 3300046533 Bacteria 4098
461 Ga0495640_0041299 3300046533 Bacteria 3224
462 Ga0495586_0003545 3300046535 Bacteria 8364
463 Ga0495587_0002845 3300046536 Bacteria 11595
464 Ga0495587_0092504 3300046536 Bacteria 1746
465 Ga0495645_0002386 3300046543 Bacteria 12748
466 Ga0495645_0008213 3300046543 Bacteria 7280
467 Ga0495645_0109269 3300046543 Bacteria 1958
468 Ga0495633_0019628 3300046558 Bacteria 3416
469 Ga0495667_0013127 3300046559 Bacteria 5609
470 Ga0495667_0041422 3300046559 Bacteria 3055
471 Ga0495667_0045655 3300046559 Bacteria 2899
472 Ga0495667_0049843 3300046559 Bacteria 2764
473 Ga0495667_0257424 3300046559 Bacteria 1110
474 Ga0495656_0004034 3300046615 Bacteria 4992
475 Ga0495634_0013078 3300046642 Bacteria 6002
476 Ga0495634_0015313 3300046642 Bacteria 5513
477 Ga0495634_0023688 3300046642 Bacteria 4313
478 Ga0495634_0047376 3300046642 Bacteria 2897
479 Ga0495634_0067106 3300046642 Bacteria 2373
480 Ga0495635_0002748 3300046663 Bacteria 12065
481 Ga0495635_0004972 3300046663 Bacteria 9257
482 Ga0495635_0026001 3300046663 Bacteria 4076
483 Ga0495635_0038825 3300046663 Bacteria 3296
484 Ga0495659_0007696 3300046664 Bacteria 3415
485 Ga0495657_0001218 3300046675 Bacteria 22573
486 Ga0495657_0019008 3300046675 Bacteria 4964
487 Ga0495657_0058481 3300046675 Bacteria 2560
488 Ga0495657_0156584 3300046675 Bacteria 1411
489 Ga0495599_0000531 3300046678 Bacteria 21912
490 Ga0495599_0000970 3300046678 Bacteria 16055
491 Ga0495599_0007730 3300046678 Bacteria 6528
492 Ga0495599_0009604 3300046678 Bacteria 5919
493 Ga0495599_0017496 3300046678 Bacteria 4456
494 Ga0495599_0024588 3300046678 Bacteria 3766
495 Ga0495623_0000758 3300046679 Bacteria 21662
496 Ga0495623_0004324 3300046679 Bacteria 9345
497 Ga0495623_0050543 3300046679 Bacteria 2632
498 Ga0495623_0104799 3300046679 Bacteria 1719
499 Ga0495646_0000300 3300046680 Bacteria 25296
500 Ga0495646_0048164 3300046680 Bacteria 2591
501 Ga0495647_0003976 3300046681 Bacteria 4771
502 Ga0495658_0087110 3300046683 Bacteria 1844
503 Ga0495613_0035336 3300046689 Bacteria 3709
504 Ga0495624_0168486 3300046690 Bacteria 1336
505 Ga0495670_0001321 3300046691 Bacteria 12084
506 Ga0495600_0017662 3300046809 Bacteria 4539
507 Ga0495600_0019250 3300046809 Bacteria 4358
508 Ga0495600_0064413 3300046809 Bacteria 2396
509 Ga0495600_0087418 3300046809 Bacteria 2033
510 Ga0495604_0001425 3300047317 Bacteria 19626
511 Ga0495604_0015363 3300047317 Bacteria 6109
512 Ga0495604_0024413 3300047317 Bacteria 4823
513 Ga0495674_0005874 3300047319 Bacteria 11776
514 Ga0495674_0037354 3300047319 Bacteria 4364
515 Ga0495674_0054172 3300047319 Bacteria 3523
516 Ga0495674_0055682 3300047319 Bacteria 3467
517 Ga0495674_0069114 3300047319 Bacteria 3055
518 Ga0495680_0002651 3300047322 Bacteria 18113
519 Ga0495680_0007953 3300047322 Bacteria 9672
520 Ga0495680_0009557 3300047322 Bacteria 8711
521 Ga0495680_0016011 3300047322 Bacteria 6451
522 Ga0495680_0036732 3300047322 Bacteria 3930
523 Ga0495680_0057461 3300047322 Bacteria 3009
524 Ga0495680_0125557 3300047322 Bacteria 1890
525 Ga0495675_0001056 3300047444 Bacteria 16742
526 Ga0495675_0018474 3300047444 Bacteria 4425
527 Ga0495675_0021903 3300047444 Bacteria 4071
528 Ga0495684_0006100 3300047471 Bacteria 9377
529 Ga0495684_0019131 3300047471 Bacteria 5272
530 Ga0495684_0048498 3300047471 Bacteria 3247
531 Ga0495684_0097874 3300047471 Bacteria 2219
532 Ga0495684_0112796 3300047471 Bacteria 2050
533 Ga0495684_0116479 3300047471 Bacteria 2014
534 Ga0495593_0009724 3300047673 Bacteria 5579
535 Ga0495602_0003273 3300048088 Bacteria 16731
536 Ga0495602_0017308 3300048088 Bacteria 7227
537 Ga0495602_0037956 3300048088 Bacteria 4461
538 Ga0496101_0195827 3300048904 Bacteria 1561
539 Ga0496102_0210499 3300048905 Bacteria 1833
540 Ga0496103_0081016 3300048906 Bacteria 2042
541 Ga0496104_0000515 3300048907 Bacteria 33122
542 Ga0496104_0067549 3300048907 Bacteria 3396
543 Ga0496104_0080380 3300048907 Bacteria 3108
544 Ga0496105_0244461 3300048908 Bacteria 1455
545 Ga0496106_0015310 3300048909 Bacteria 5674
546 Ga0496106_0158605 3300048909 Bacteria 1788
547 Ga0496107_0015088 3300048910 Bacteria 5413
548 Ga0496107_0090827 3300048910 Bacteria 2231
549 Ga0496108_0008991 3300048911 Bacteria 8095
550 Ga0496109_0001064 3300048912 Bacteria 22726
551 Ga0496109_0113508 3300048912 Bacteria 2520
552 Ga0496110_0193022 3300048913 Bacteria 1849
553 Ga0496111_0055737 3300048914 Bacteria 2859
554 Ga0496111_0081328 3300048914 Bacteria 2365
555 Ga0496111_0148541 3300048914 Bacteria 1738
556 Ga0496112_0075018 3300048915 Bacteria 3344
557 Ga0496113_0004800 3300048916 Bacteria 8356
558 Ga0496115_0045598 3300048918 Bacteria 3500
559 Ga0496115_0138609 3300048918 Bacteria 2006
560 Ga0501031_0001427 3300049568 Bacteria 14803
561 Ga0501032_0002436 3300049569 Bacteria 14522
562 Ga0501032_0062303 3300049569 Bacteria 2499
563 Ga0501033_0000244 3300049570 Bacteria 52231
564 Ga0501033_0013241 3300049570 Bacteria 6285
565 Ga0501034_0000159 3300049571 Bacteria 127397
566 Ga0501034_0031979 3300049571 Bacteria 5345
567 Ga0501034_0046375 3300049571 Bacteria 4391
568 Ga0501034_0187526 3300049571 Bacteria 2031
569 Ga0501036_0000039 3300049572 Bacteria 83065
570 Ga0501036_0079493 3300049572 Bacteria 2773
571 Ga0501037_0003835 3300049573 Bacteria 10914
572 Ga0501038_0001751 3300049574 Bacteria 20170
573 Ga0501038_0062161 3300049574 Bacteria 3191
574 Ga0501038_0265310 3300049574 Bacteria 1355
575 Ga0501039_0001324 3300049575 Bacteria 18083
576 Ga0501039_0101558 3300049575 Bacteria 2245
577 Ga0501042_0064050 3300049578 Bacteria 2627
578 Ga0501043_0030468 3300049579 Bacteria 4240
579 Ga0501046_0000185 3300049580 Bacteria 63459
580 Ga0501047_0000385 3300049581 Bacteria 49635
581 Ga0501047_0010053 3300049581 Bacteria 8943
582 Ga0501047_0133021 3300049581 Bacteria 2367
583 Ga0501047_0157297 3300049581 Bacteria 2146
584 Ga0501047_0315416 3300049581 Bacteria 1404
585 Ga0501048_0007283 3300049582 Bacteria 8389
586 Ga0501048_0335808 3300049582 Bacteria 1077
587 Ga0501067_0000513 3300049583 Bacteria 21187
588 Ga0501068_0001337 3300049584 Bacteria 13064
589 Ga0501068_0026119 3300049584 Bacteria 3438
590 Ga0501069_0006089 3300049585 Bacteria 6296
591 Ga0501069_0149490 3300049585 Bacteria 1342
592 Ga0501070_0003256 3300049586 Bacteria 14098
593 Ga0501070_0008612 3300049586 Bacteria 8626
594 Ga0501070_0010383 3300049586 Bacteria 7871
595 Ga0501070_0112369 3300049586 Bacteria 2251
596 Ga0501072_0001656 3300049588 Bacteria 16623
597 Ga0501072_0038222 3300049588 Bacteria 3766
598 Ga0501072_0106012 3300049588 Bacteria 2235
599 Ga0501073_0000374 3300049589 Bacteria 30124
600 Ga0501073_0000702 3300049589 Bacteria 23614
601 Ga0501073_0025314 3300049589 Bacteria 4257
602 Ga0501073_0045790 3300049589 Bacteria 3080
603 Ga0501073_0115244 3300049589 Bacteria 1863
604 Ga0501074_0000125 3300049590 Bacteria 39203
605 Ga0501074_0001567 3300049590 Bacteria 15466
606 Ga0501074_0148255 3300049590 Bacteria 1678
607 Ga0501079_0026149 3300049741 Bacteria 4475
608 Ga0501079_0085132 3300049741 Bacteria 2446
609 Ga0501080_0000380 3300049742 Bacteria 34213
610 Ga0501080_0001529 3300049742 Bacteria 19540
611 Ga0501080_0007162 3300049742 Bacteria 10065
612 Ga0501080_0227275 3300049742 Bacteria 1706
613 Ga0501080_0287175 3300049742 Bacteria 1494
614 Ga0501083_0001646 3300049744 Bacteria 15245
615 Ga0501083_0004058 3300049744 Bacteria 10302
616 Ga0501083_0017169 3300049744 Bacteria 5048
617 Ga0501035_0001985 3300049822 Bacteria 20460
618 Ga0501035_0026028 3300049822 Bacteria 5358
619 Ga0501035_0045442 3300049822 Bacteria 3951
620 Ga0501035_0059100 3300049822 Bacteria 3414
621 Ga0501035_0306211 3300049822 Bacteria 1338
622 Ga0501044_0001993 3300049823 Bacteria 23587
623 Ga0501044_0171954 3300049823 Bacteria 2137
624 Ga0501044_0172377 3300049823 Bacteria 2134
625 Ga0501044_0475538 3300049823 Bacteria 1153
626 nmdc:mga0yw44_56609_c1 3300050492 Bacteria 2390
627 nmdc:mga07m45_24106_c2 3300050496 Bacteria 2611
628 nmdc:mga08y16_14377_c1 3300050511 Bacteria 8332
629 nmdc:mga0n895_41223_c1 3300050512 Bacteria 4487
630 nmdc:mga0a205_65088_c1 3300050515 Bacteria 3521
631 Ga0495601_0000731 3300053077 Bacteria 17670
632 Ga0495601_0001011 3300053077 Bacteria 15401
633 Ga0495601_0005133 3300053077 Bacteria 7610
634 Ga0495601_0006865 3300053077 Bacteria 6668
635 Ga0495601_0010360 3300053077 Bacteria 5545
636 Ga0495601_0011836 3300053077 Bacteria 5232
637 Ga0495601_0012932 3300053077 Bacteria 5011
638 Ga0495612_0006577 3300053078 Bacteria 4768
639 Ga0495612_0007659 3300053078 Bacteria 4411
640 Ga0495595_0000356 3300053084 Bacteria 17378
641 Ga0495595_0001701 3300053084 Bacteria 8618
642 Ga0495595_0001936 3300053084 Bacteria 8032
643 Ga0495595_0002476 3300053084 Bacteria 7225
644 Ga0495619_0001094 3300053085 Bacteria 17821
645 Ga0495619_0010836 3300053085 Bacteria 5737
646 Ga0495619_0013399 3300053085 Bacteria 5167
647 Ga0495619_0030417 3300053085 Bacteria 3496
648 Ga0495619_0034502 3300053085 Bacteria 3289
649 Ga0495619_0105669 3300053085 Bacteria 1920
650 Ga0495619_0243271 3300053085 Bacteria 1247
651 Ga0500652_004490 3300053131 Bacteria 4324
652 Ga0501084_0023641 3300054114 Bacteria 5125
653 Ga0501082_0000570 3300060353 Bacteria 32833
654 Ga0501082_0026405 3300060353 Bacteria 5004
655 Ga0501082_0086600 3300060353 Bacteria 2702
656 Ga0501082_0173828 3300060353 Bacteria 1873
657 Ga0530510_0149019 3300061734 Bacteria 1727
658 2643754663 2643221547 Bacteria 4740017
659 2643838558 2643221564 Bacteria 4193379
660 Ga0373937_0087050
661 2214911869
662 ARcpr5oldR_c000029
663 ARSoilYngRDRAFT_c00072
664 ARcpr5yngRDRAFT_c000051
665 ARSoilOldRDRAFT_c000078
666 ARCol0oldRDRAFT_c00459
667 ARCol0yngRDRAFT_1000056
668 JGI24737J22298_10012020
669 JGI25405J52794_10017317
670 Ga0065717_1002104
671 Ga0065716_1002476
672 Ga0065704_10083802
673 Ga0065715_10106453
674 Ga0070658_10012028
675 Ga0070658_10089225
676 Ga0070658_10147435
677 Ga0070676_10147513
678 Ga0070683_100029663
679 Ga0070683_100035510
680 Ga0070683_100096539
681 Ga0070680_100029424
682 Ga0070680_100069612
683 Ga0070680_100290154
684 Ga0068868_100074621
685 Ga0070660_100007264
686 Ga0070660_100144635
687 Ga0070691_10041412
688 Ga0070661_100000534
689 Ga0070661_100013055
690 Ga0070692_10010043
691 Ga0070692_10070074
692 Ga0070669_100028908
693 Ga0070675_100039583
694 Ga0070688_100016727
695 Ga0070688_100135663
696 Ga0070659_100094240
697 Ga0070667_100021395
698 Ga0070667_100142260
699 Ga0070703_10009780
700 Ga0070709_10008931
701 Ga0070709_10144689
702 Ga0070714_100004852
703 Ga0070714_100071605
704 Ga0070714_100075499
705 Ga0070714_100245884
706 Ga0070713_100015251
707 Ga0070713_100035154
708 Ga0070713_100043614
709 Ga0070713_100165511
710 Ga0070713_100233619
711 Ga0070710_10043415
712 Ga0070710_10257431
713 Ga0070711_100021985
714 Ga0070711_100046980
715 Ga0070711_100048137
716 Ga0070694_100102197
717 Ga0070663_100069216
718 Ga0070681_10004821
719 Ga0070681_10060239
720 Ga0070681_10066993
721 Ga0070681_10104672
722 Ga0074259_12105788
723 Ga0070699_100015846
724 Ga0070679_100011066
725 Ga0070679_100016685
726 Ga0070679_100017604
727 Ga0070679_100065636
728 Ga0070679_100111202
729 Ga0070679_100186321
730 Ga0070684_100008632
731 Ga0070684_100022129
732 Ga0070684_100076053
733 Ga0068853_100004769
734 Ga0068853_100010929
735 Ga0070672_100073562
736 Ga0070672_100342037
737 Ga0070686_100034533
738 Ga0070695_100002680
739 Ga0070696_100001722
740 Ga0070696_100027300
741 Ga0070696_100094394
742 Ga0070704_100019446
743 Ga0068855_100007766
744 Ga0068855_100008252
745 Ga0068855_100069930
746 Ga0068855_100073898
747 Ga0068855_100192890
748 Ga0068855_100217464
749 Ga0070664_100001929
750 Ga0068857_100001319
751 Ga0068857_100115620
752 Ga0068857_100117321
753 Ga0068857_100254726
754 Ga0068854_100016881
755 Ga0068854_100050830
756 Ga0068854_100170336
757 Ga0068856_100003061
758 Ga0068856_100138006
759 Ga0068856_100177033
760 Ga0070702_100025455
761 Ga0068852_100000554
762 Ga0068852_100002959
763 Ga0068852_100004557
764 Ga0068852_100083301
765 Ga0068852_100086236
766 Ga0068852_100233337
767 Ga0068859_100291001
768 Ga0068861_100019068
769 Ga0068851_10008121
770 Ga0068863_100301324
771 Ga0068858_100024666
772 Ga0068858_100140765
773 Ga0068860_100034634
774 Ga0068862_100016334
775 Ga0081455_10010000
776 Ga0081540_1003907
777 Ga0075365_10025911
778 Ga0075364_10148885
779 Ga0075432_10055282
780 Ga0070715_10118308
781 Ga0070712_100014927
782 Ga0097621_100040496
783 Ga0097621_100097801
784 Ga0075370_10038270
785 Ga0068871_100009241
786 Ga0068871_100028870
787 Ga0097620_100291019
788 Ga0105240_10002585
789 Ga0105240_10007789
790 Ga0105240_10026466
791 Ga0105240_10053422
792 Ga0111539_10007739
793 Ga0105245_10102254
794 Ga0105247_10013648
795 Ga0105247_10047888
796 Ga0105243_10009481
797 Ga0105241_10013737
798 Ga0105241_10033974
799 Ga0105242_10003746
800 Ga0105248_10008602
801 Ga0105237_10162124
802 Ga0105238_10005650
803 Ga0105238_10009355
804 Ga0105238_10018906
805 Ga0105238_10156841
806 Ga0105238_10198599
807 Ga0105238_10266416
808 Ga0105249_10006636
809 Ga0105246_10014859
810 Ga0157315_1000484
811 Ga0157373_10091002
812 Ga0157373_10119000
813 Ga0157371_10019442
814 Ga0157371_10041023
815 Ga0157371_10102975
816 Ga0157370_10001270
817 Ga0157370_10003871
818 Ga0157370_10009975
819 Ga0157370_10020607
820 Ga0157370_10061699
821 Ga0157370_10136016
822 Ga0157370_10160929
823 Ga0157370_10238178
824 Ga0157369_10000895
825 Ga0157369_10002601
826 Ga0157369_10113846
827 Ga0157369_10196083
828 Ga0157369_10399800
829 Ga0157374_10081300
830 Ga0157374_10154841
831 Ga0157378_10302397
832 Ga0163162_10021249
833 Ga0163162_10056217
834 Ga0163162_10114262
835 Ga0163162_10241467
836 Ga0157372_10004580
837 Ga0157372_10022454
838 Ga0157372_10027347
839 Ga0157372_10034933
840 Ga0157372_10126363
841 Ga0157372_10232687
842 Ga0157375_10015977
843 Ga0157375_10154689
844 Ga0163163_10000757
845 Ga0163163_10001222
846 Ga0157380_10038881
847 Ga0157377_10030644
848 Ga0157377_10169037
849 Ga0157379_10134030
850 Ga0157379_10245781
851 Ga0157376_10041184
852 Ga0157376_10247744
853 Ga0207666_1000343
854 Ga0207697_10007410
855 Ga0207656_10088259
856 Ga0207692_10004582
857 Ga0207688_10004300
858 Ga0207680_10266326
859 Ga0207647_10047471
860 Ga0207699_10052120
861 Ga0207645_10040159
862 Ga0207705_10016504
863 Ga0207705_10019680
864 Ga0207705_10060216
865 Ga0207705_10102758
866 Ga0207654_10023112
867 Ga0207654_10023523
868 Ga0207654_10128529
869 Ga0207707_10011542
870 Ga0207707_10028062
871 Ga0207707_10194815
872 Ga0207707_10264712
873 Ga0207707_10457711
874 Ga0207695_10004433
875 Ga0207695_10017259
876 Ga0207695_10032370
877 Ga0207695_10096789
878 Ga0207695_10130049
879 Ga0207671_10060402
880 Ga0207693_10026873
881 Ga0207663_10108042
882 Ga0207660_10047796
883 Ga0207660_10195634
884 Ga0207660_10223221
885 Ga0207662_10208455
886 Ga0207657_10009889
887 Ga0207657_10133464
888 Ga0207657_10262520
889 Ga0207649_10002364
890 Ga0207649_10019384
891 Ga0207649_10032953
892 Ga0207652_10008705
893 Ga0207652_10041447
894 Ga0207652_10062760
895 Ga0207652_10070843
896 Ga0207652_10092261
897 Ga0207646_10077035
898 Ga0207681_10066864
899 Ga0207681_10319148
900 Ga0207694_10002378
901 Ga0207694_10014709
902 Ga0207694_10035460
903 Ga0207694_10058866
904 Ga0207694_10085831
905 Ga0207659_10065689
906 Ga0207687_10022697
907 Ga0207687_10233088
908 Ga0207700_10137977
909 Ga0207700_10212529
910 Ga0207664_10003344
911 Ga0207664_10007925
912 Ga0207664_10023865
913 Ga0207690_10094227
914 Ga0207690_10107839
915 Ga0207690_10136275
916 Ga0207706_10007810
917 Ga0207686_10017403
918 Ga0207686_10064900
919 Ga0207686_10241750
920 Ga0207709_10092973
921 Ga0207665_10242423
922 Ga0207711_10067338
923 Ga0207711_10116633
924 Ga0207661_10081182
925 Ga0207661_10259003
926 Ga0207667_10001311
927 Ga0207667_10018592
928 Ga0207667_10038687
929 Ga0207667_10048328
930 Ga0207667_10065695
931 Ga0207667_10070130
932 Ga0207667_10142924
933 Ga0207667_10152458
934 Ga0207668_10140812
935 Ga0207640_10042585
936 Ga0207640_10154434
937 Ga0207658_10011174
938 Ga0207658_10112167
939 Ga0207703_10047022
940 Ga0207703_10108888
941 Ga0207703_10390416
942 Ga0207639_10016878
943 Ga0207639_10132234
944 Ga0207639_10225641
945 Ga0207678_10012696
946 Ga0207708_10004283
947 Ga0207702_10002277
948 Ga0207702_10105381
949 Ga0207641_10193239
950 Ga0207674_10000039
951 Ga0207674_10092964
952 Ga0207674_10146800
953 Ga0207675_100015653
954 Ga0207698_10003989
955 Ga0207698_10011251
956 Ga0207698_10019968
957 Ga0207698_10405485
958 Ga0209966_1002877
959 Ga0209998_10000758
960 Ga0207428_10014000
961 Ga0268264_10069274
962 Ga0265338_10033308
963 Ga0265338_10098428
964 Ga0265325_10000004
965 Ga0265325_10034833
966 Ga0265325_10043495
967 Ga0265325_10048228
968 Ga0265325_10086133
969 Ga0265340_10025334
970 Ga0265339_10010467
971 Ga0265316_10066828
972 Ga0265313_10009264
973 Ga0265313_10048143
974 Ga0265314_10016876
975 Ga0265342_10000182
976 Ga0307405_10072929
977 Ga0373930_0000532
978 Ga0373948_0000419
979 Ga0373950_0000167
980 Ga0373958_0002350
981 Ga0373938_0000028
982 Ga0373928_0000334
983 Ga0373929_0001866
984 Ga0373934_0001517
985 Ga0373934_0005199
986 Ga0373934_0012356
987 Ga0373934_0013164
988 Ga0373949_0001620
989 Ga0373951_0000666
990 Ga0373952_0000851
991 Ga0373923_0024586
992 Ga0373923_0049411
993 Ga0373932_0000749
994 Ga0373936_0005568
995 Ga0373939_0001838
996 Ga0373939_0016499
997 Ga0373941_0000671
998 Ga0373941_0005651
999 Ga0373945_0053045
1000 Ga0373945_0097102
1001 Ga0373953_0008219
1002 Ga0373953_0012296
1003 Ga0373953_0019942
1004 Ga0373954_0000002
1005 Ga0373954_0003738
1006 Ga0373954_0006044
1007 Ga0373954_0007284
1008 Ga0373954_0014031
1009 Ga0373956_0000945
1010 Ga0373956_0002179
1011 Ga0373956_0019484
1012 Ga0373956_0107005
1013 Ga0373957_0000339
1014 Ga0373957_0002968
1015 Ga0373957_0003036
1016 Ga0373957_0024413
1017 Ga0373960_0000599
1018 Ga0373955_0001962
1019 Ga0373955_0014629
1020 Ga0373955_0028909
1021 Ga0373955_0034110
1022 Ga0373955_0064377
1023 Ga0373955_0081179
1024 Ga0373942_0005239
1025 Ga0373961_0000433
1026 Ga0373962_0000881
1027 Ga0373924_0004417
1028 Ga0373924_0025366
1029 Ga0373924_0057243
1030 Ga0373924_0117377
1031 Ga0373935_0026607
1032 Ga0373935_0057754
1033 Ga0373935_0157622
1034 Ga0373935_0296636
1035 Ga0373927_0003675
1036 Ga0373927_0093708
1037 Ga0373927_0288887
1038 Ga0373933_0000890
1039 Ga0373933_0001687
1040 Ga0373933_0001764
1041 Ga0373933_0002111
1042 Ga0373933_0005461
1043 Ga0373933_0011582
1044 Ga0373933_0041104
1045 Ga0373933_0042536
1046 Ga0373947_0063299
1047 Ga0373947_0100781
1048 Ga0373947_0115514
1049 Ga0373947_0195698
1050 Ga0373947_0203572
1051 Ga0373937_0001304
1052 Ga0373937_0001794
1053 Ga0373937_0004227
1054 Ga0373937_0005332
1055 Ga0373937_0006421
1056 Ga0373937_0007322
1057 Ga0373937_0009035
1058 Ga0373937_0027575
1059 Ga0373937_0035972
1060 Ga0373937_0197854
1061 Ga0439465_0047164
1062 Ga0451853_1695856
1063 Ga0453684_0140242
1064 Ga0451576_0065472
1065 Ga0495617_024276
1066 Ga0495592_0000589
1067 Ga0495592_0002245
1068 Ga0495592_0028842
1069 Ga0495592_0040216
1070 Ga0495592_0075908
1071 Ga0495603_0020971
1072 Ga0495629_0013396
1073 Ga0495651_0003925
1074 Ga0495651_0021054
1075 Ga0495651_0031350
1076 Ga0495651_0037541
1077 Ga0495651_0050023
1078 Ga0495651_0115579
1079 Ga0495651_0118498
1080 Ga0495653_0001655
1081 Ga0495653_0004752
1082 Ga0495653_0059041
1083 Ga0495653_0061026
1084 Ga0495580_0050116
1085 Ga0495582_0083300
1086 Ga0495639_0007311
1087 Ga0495662_0032507
1088 Ga0495664_0005496
1089 Ga0495664_0151611
1090 Ga0495585_0008414
1091 Ga0495594_0127852
1092 Ga0495583_0083296
1093 Ga0495608_0001793
1094 Ga0495608_0001817
1095 Ga0495608_0005922
1096 Ga0495608_0021073
1097 Ga0495608_0044062
1098 Ga0495608_0072761
1099 Ga0495608_0084732
1100 Ga0495618_0008159
1101 Ga0495618_0018196
1102 Ga0495618_0072351
1103 Ga0495618_0157805
1104 Ga0495628_0004889
1105 Ga0495628_0009824
1106 Ga0495628_0014727
1107 Ga0495628_0159097
1108 Ga0495630_0027998
1109 Ga0495630_0041594
1110 Ga0495630_0122574
1111 Ga0495630_0134107
1112 Ga0495644_0014794
1113 Ga0495652_0010464
1114 Ga0495652_0013953
1115 Ga0495652_0089741
1116 Ga0495665_0069040
1117 Ga0495640_0005362
1118 Ga0495640_0013444
1119 Ga0495640_0027536
1120 Ga0495640_0041299
1121 Ga0495586_0003545
1122 Ga0495587_0002845
1123 Ga0495587_0092504
1124 Ga0495645_0002386
1125 Ga0495645_0008213
1126 Ga0495645_0109269
1127 Ga0495633_0019628
1128 Ga0495667_0013127
1129 Ga0495667_0041422
1130 Ga0495667_0045655
1131 Ga0495667_0049843
1132 Ga0495667_0257424
1133 Ga0495656_0004034
1134 Ga0495634_0013078
1135 Ga0495634_0015313
1136 Ga0495634_0023688
1137 Ga0495634_0047376
1138 Ga0495634_0067106
1139 Ga0495635_0002748
1140 Ga0495635_0004972
1141 Ga0495635_0026001
1142 Ga0495635_0038825
1143 Ga0495659_0007696
1144 Ga0495657_0001218
1145 Ga0495657_0019008
1146 Ga0495657_0058481
1147 Ga0495657_0156584
1148 Ga0495599_0000531
1149 Ga0495599_0000970
1150 Ga0495599_0007730
1151 Ga0495599_0009604
1152 Ga0495599_0017496
1153 Ga0495599_0024588
1154 Ga0495623_0000758
1155 Ga0495623_0004324
1156 Ga0495623_0050543
1157 Ga0495623_0104799
1158 Ga0495646_0000300
1159 Ga0495646_0048164
1160 Ga0495647_0003976
1161 Ga0495658_0087110
1162 Ga0495613_0035336
1163 Ga0495624_0168486
1164 Ga0495670_0001321
1165 Ga0495600_0017662
1166 Ga0495600_0019250
1167 Ga0495600_0064413
1168 Ga0495600_0087418
1169 Ga0495604_0001425
1170 Ga0495604_0015363
1171 Ga0495604_0024413
1172 Ga0495674_0005874
1173 Ga0495674_0037354
1174 Ga0495674_0054172
1175 Ga0495674_0055682
1176 Ga0495674_0069114
1177 Ga0495680_0002651
1178 Ga0495680_0007953
1179 Ga0495680_0009557
1180 Ga0495680_0016011
1181 Ga0495680_0036732
1182 Ga0495680_0057461
1183 Ga0495680_0125557
1184 Ga0495675_0001056
1185 Ga0495675_0018474
1186 Ga0495675_0021903
1187 Ga0495684_0006100
1188 Ga0495684_0019131
1189 Ga0495684_0048498
1190 Ga0495684_0097874
1191 Ga0495684_0112796
1192 Ga0495684_0116479
1193 Ga0495593_0009724
1194 Ga0495602_0003273
1195 Ga0495602_0017308
1196 Ga0495602_0037956
1197 Ga0496101_0195827
1198 Ga0496102_0210499
1199 Ga0496103_0081016
1200 Ga0496104_0000515
1201 Ga0496104_0067549
1202 Ga0496104_0080380
1203 Ga0496105_0244461
1204 Ga0496106_0015310
1205 Ga0496106_0158605
1206 Ga0496107_0015088
1207 Ga0496107_0090827
1208 Ga0496108_0008991
1209 Ga0496109_0001064
1210 Ga0496109_0113508
1211 Ga0496110_0193022
1212 Ga0496111_0055737
1213 Ga0496111_0081328
1214 Ga0496111_0148541
1215 Ga0496112_0075018
1216 Ga0496113_0004800
1217 Ga0496115_0045598
1218 Ga0496115_0138609
1219 Ga0501031_0001427
1220 Ga0501032_0002436
1221 Ga0501032_0062303
1222 Ga0501033_0000244
1223 Ga0501033_0013241
1224 Ga0501034_0000159
1225 Ga0501034_0031979
1226 Ga0501034_0046375
1227 Ga0501034_0187526
1228 Ga0501036_0000039
1229 Ga0501036_0079493
1230 Ga0501037_0003835
1231 Ga0501038_0001751
1232 Ga0501038_0062161
1233 Ga0501038_0265310
1234 Ga0501039_0001324
1235 Ga0501039_0101558
1236 Ga0501042_0064050
1237 Ga0501043_0030468
1238 Ga0501046_0000185
1239 Ga0501047_0000385
1240 Ga0501047_0010053
1241 Ga0501047_0133021
1242 Ga0501047_0157297
1243 Ga0501047_0315416
1244 Ga0501048_0007283
1245 Ga0501048_0335808
1246 Ga0501067_0000513
1247 Ga0501068_0001337
1248 Ga0501068_0026119
1249 Ga0501069_0006089
1250 Ga0501069_0149490
1251 Ga0501070_0003256
1252 Ga0501070_0008612
1253 Ga0501070_0010383
1254 Ga0501070_0112369
1255 Ga0501072_0001656
1256 Ga0501072_0038222
1257 Ga0501072_0106012
1258 Ga0501073_0000374
1259 Ga0501073_0000702
1260 Ga0501073_0025314
1261 Ga0501073_0045790
1262 Ga0501073_0115244
1263 Ga0501074_0000125
1264 Ga0501074_0001567
1265 Ga0501074_0148255
1266 Ga0501079_0026149
1267 Ga0501079_0085132
1268 Ga0501080_0000380
1269 Ga0501080_0001529
1270 Ga0501080_0007162
1271 Ga0501080_0227275
1272 Ga0501080_0287175
1273 Ga0501083_0001646
1274 Ga0501083_0004058
1275 Ga0501083_0017169
1276 Ga0501035_0001985
1277 Ga0501035_0026028
1278 Ga0501035_0045442
1279 Ga0501035_0059100
1280 Ga0501035_0306211
1281 Ga0501044_0001993
1282 Ga0501044_0171954
1283 Ga0501044_0172377
1284 Ga0501044_0475538
1285 nmdc:mga0yw44_56609_c1
1286 nmdc:mga07m45_24106_c2
1287 nmdc:mga08y16_14377_c1
1288 nmdc:mga0n895_41223_c1
1289 nmdc:mga0a205_65088_c1
1290 Ga0495601_0000731
1291 Ga0495601_0001011
1292 Ga0495601_0005133
1293 Ga0495601_0006865
1294 Ga0495601_0010360
1295 Ga0495601_0011836
1296 Ga0495601_0012932
1297 Ga0495612_0006577
1298 Ga0495612_0007659
1299 Ga0495595_0000356
1300 Ga0495595_0001701
1301 Ga0495595_0001936
1302 Ga0495595_0002476
1303 Ga0495619_0001094
1304 Ga0495619_0010836
1305 Ga0495619_0013399
1306 Ga0495619_0030417
1307 Ga0495619_0034502
1308 Ga0495619_0105669
1309 Ga0495619_0243271
1310 Ga0500652_004490
1311 Ga0501084_0023641
1312 Ga0501082_0000570
1313 Ga0501082_0026405
1314 Ga0501082_0086600
1315 Ga0501082_0173828
1316 Ga0530510_0149019
1317 2643754663
1318 2643838558

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

100

378

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p47-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from ochrobactrum anthropi (oant_4429), target efi-510151, c-termius bound in ligand binding pocket 0.9177 8 315
4mev-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from rhodoferax ferrireducens (rfer_1840), target efi-510211, with bound malonate, space group i422 0.9139 11 317
4mev-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from rhodoferax ferrireducens (rfer_1840), target efi-510211, with bound malonate, space group i422 0.9001 11 317
3gyy-assembly1.cif.gz_A the ectoine binding protein of the teaabc trap transporter teaa in the apo-state 0.8913 12 315
4pf8-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. nas-14.1 (target efi-510299) with bound beta-d-galacturonate 0.8893 13 314
ID Description Score Start End Superfamily
4p47A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9177 8 315 3.40.190.170
4mevA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9139 11 317 3.40.190.170
4mevA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9001 11 317 3.40.190.170
3gyyA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.8913 12 315 3.40.190.170
4p1eA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.8834 11 317 3.40.190.170
ID Description Score Start End GO Terms
AF-A0A6N6T2D2-F1-model_v4 C4-dicarboxylate ABC transporter 0.9291 1 314 GO:0015740
GO:0055085
AF-A0A7S7SU36-F1-model_v4 TRAP transporter substrate-binding protein DctP 0.918 9 313 GO:0015740
GO:0055085
AF-A0A6N6T2D2-F1-model_v4 C4-dicarboxylate ABC transporter 0.9179 1 314 GO:0015740
GO:0055085
AF-A0A850MZ18-F1-model_v4 deleted 0.9157 10 317
AF-A0A8A7T859-F1-model_v4 deleted 0.9114 10 314

Map