F473251

General Info

Members Datasets Scaffolds Average Seq Length
659 220 1318 100

Family's Representative Sequence

Representative Sequence 3300025920|Ga0207649_10630944|Ga0207649_106309443
Length 117
Sequence VNGPTAVMLGLVIIGLPTIMIMLIANRFFKYREKKLEVEAMHAAEKAAQYASRSSELEDRVRVLEQIVTDGGAQTAAQIEALRTPSSRKPIRHPPRRLRRHPCPACMTIRCSSSASR

Samples

Sample ID Description Type Environment
1 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
156 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
157 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
158 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
159 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
166 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
217 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.77
Rhizosphere 93.93
Stem 0
Stem Tuber 0
Unclassified 10.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207649_10630944 3300025920 Bacteria 826
2 JGI24740J21852_10000529 3300001979 Bacteria 16306
3 JGI24740J21852_10180755 3300001979 Bacteria 523
4 JGI24739J22299_10023939 3300001989 Unclassified 2155
5 JGI24739J22299_10033337 3300001989 Bacteria 1763
6 JGI24737J22298_10001931 3300001990 Bacteria 7414
7 JGI24737J22298_10162738 3300001990 Bacteria 659
8 JGI24735J21928_10020396 3300002067 Bacteria 2030
9 JGI24738J21930_10012231 3300002075 Bacteria 1875
10 JGI24738J21930_10019368 3300002075 Bacteria 1419
11 rootH1_10063433 3300003323 Bacteria 1240
12 Ga0007409J51694_1038569 3300003575 Bacteria 2688
13 Ga0070658_10003538 3300005327 Bacteria 12823
14 Ga0070658_10030720 3300005327 Bacteria 4315
15 Ga0070658_10031607 3300005327 Bacteria 4251
16 Ga0070658_10049929 3300005327 Bacteria 3390
17 Ga0070658_10051723 3300005327 Bacteria 3329
18 Ga0070658_10612830 3300005327 Bacteria 944
19 Ga0070658_11513643 3300005327 Bacteria 582
20 Ga0070676_10048676 3300005328 Bacteria 2479
21 Ga0070676_10066865 3300005328 Bacteria 2148
22 Ga0070683_100005945 3300005329 Bacteria 10211
23 Ga0070683_100010252 3300005329 Bacteria 8052
24 Ga0070683_100937423 3300005329 Bacteria 831
25 Ga0070690_100007920 3300005330 Bacteria 6097
26 Ga0070690_100017039 3300005330 Bacteria 4361
27 Ga0070670_100002725 3300005331 Bacteria 14599
28 Ga0070670_100047157 3300005331 Bacteria 3707
29 Ga0070670_100434034 3300005331 Bacteria 1162
30 Ga0070666_10000623 3300005335 Bacteria 21258
31 Ga0070666_10010081 3300005335 Bacteria 5899
32 Ga0070666_10039338 3300005335 Bacteria 3151
33 Ga0070680_100014984 3300005336 Bacteria 6068
34 Ga0070680_100027340 3300005336 Bacteria 4568
35 Ga0070680_100029933 3300005336 Bacteria 4371
36 Ga0070680_100506364 3300005336 Bacteria 1033
37 Ga0068868_100003382 3300005338 Bacteria 11101
38 Ga0068868_100039161 3300005338 Bacteria 3682
39 Ga0068868_100243073 3300005338 Bacteria 1513
40 Ga0068868_101698827 3300005338 Bacteria 595
41 Ga0070660_100000560 3300005339 Bacteria 24966
42 Ga0070660_100013428 3300005339 Bacteria 5875
43 Ga0070660_100022352 3300005339 Bacteria 4675
44 Ga0070660_100090222 3300005339 Bacteria 2416
45 Ga0070660_100095812 3300005339 Bacteria 2346
46 Ga0070660_100298812 3300005339 Bacteria 1320
47 Ga0070660_100786188 3300005339 Bacteria 800
48 Ga0070689_100101498 3300005340 Bacteria 2277
49 Ga0070689_101770571 3300005340 Bacteria 563
50 Ga0070691_10513918 3300005341 Bacteria 694
51 Ga0070661_100000075 3300005344 Bacteria 79164
52 Ga0070661_100023382 3300005344 Bacteria 4429
53 Ga0070661_100033588 3300005344 Bacteria 3717
54 Ga0070661_100053435 3300005344 Bacteria 2957
55 Ga0070661_100057585 3300005344 Bacteria 2848
56 Ga0070661_100087253 3300005344 Bacteria 2308
57 Ga0070661_100193011 3300005344 Bacteria 1554
58 Ga0070661_100251981 3300005344 Unclassified 1363
59 Ga0070661_100283365 3300005344 Unclassified 1286
60 Ga0070661_100865048 3300005344 Bacteria 745
61 Ga0070692_10039400 3300005345 Bacteria 2413
62 Ga0070675_100229726 3300005354 Bacteria 1618
63 Ga0070671_100000963 3300005355 Bacteria 21072
64 Ga0070671_100031625 3300005355 Bacteria 4373
65 Ga0070671_100040800 3300005355 Bacteria 3856
66 Ga0070671_100061919 3300005355 Bacteria 3116
67 Ga0070671_100146628 3300005355 Bacteria 1992
68 Ga0070674_100005418 3300005356 Bacteria 7370
69 Ga0070674_100039907 3300005356 Bacteria 3173
70 Ga0070674_100124680 3300005356 Bacteria 1911
71 Ga0070673_100023106 3300005364 Bacteria 4539
72 Ga0070673_101098657 3300005364 Unclassified 743
73 Ga0070688_100032694 3300005365 Bacteria 3139
74 Ga0070659_100004345 3300005366 Bacteria 10118
75 Ga0070659_100063078 3300005366 Bacteria 2931
76 Ga0070659_100068069 3300005366 Bacteria 2824
77 Ga0070659_100079601 3300005366 Bacteria 2615
78 Ga0070659_100131344 3300005366 Bacteria 2034
79 Ga0070659_100189959 3300005366 Bacteria 1688
80 Ga0070659_100200192 3300005366 Bacteria 1644
81 Ga0070659_100344653 3300005366 Bacteria 1249
82 Ga0070659_100592464 3300005366 Bacteria 952
83 Ga0070659_100791778 3300005366 Bacteria 824
84 Ga0070659_100861753 3300005366 Bacteria 790
85 Ga0070667_100000764 3300005367 Bacteria 30578
86 Ga0070667_100025017 3300005367 Bacteria 4961
87 Ga0070667_100091190 3300005367 Bacteria 2620
88 Ga0070667_100384510 3300005367 Bacteria 1275
89 Ga0070709_10236104 3300005434 Bacteria 1311
90 Ga0070714_100059117 3300005435 Bacteria 3286
91 Ga0070714_100059255 3300005435 Bacteria 3282
92 Ga0070714_100106783 3300005435 Unclassified 2474
93 Ga0070714_100137572 3300005435 Bacteria 2189
94 Ga0070714_100395509 3300005435 Bacteria 1305
95 Ga0070713_100014227 3300005436 Bacteria 5899
96 Ga0070713_100147383 3300005436 Bacteria 2090
97 Ga0070711_100249282 3300005439 Bacteria 1392
98 Ga0070663_100004025 3300005455 Bacteria 8576
99 Ga0070663_100010825 3300005455 Bacteria 5698
100 Ga0070663_100038238 3300005455 Bacteria 3346
101 Ga0070663_100112161 3300005455 Bacteria 2050
102 Ga0070678_100016095 3300005456 Bacteria 4773
103 Ga0070662_100003155 3300005457 Bacteria 10241
104 Ga0070662_100043476 3300005457 Bacteria 3214
105 Ga0070662_100055181 3300005457 Bacteria 2882
106 Ga0070662_101150833 3300005457 Bacteria 666
107 Ga0070662_101429625 3300005457 Unclassified 596
108 Ga0070681_10043010 3300005458 Bacteria 4526
109 Ga0070681_10122707 3300005458 Bacteria 2531
110 Ga0070681_10244996 3300005458 Bacteria 1705
111 Ga0070681_11215127 3300005458 Unclassified 676
112 Ga0070681_11919096 3300005458 Bacteria 520
113 Ga0068867_100024750 3300005459 Bacteria 4303
114 Ga0070685_10069399 3300005466 Bacteria 2084
115 Ga0070679_100002411 3300005530 Bacteria 16949
116 Ga0070679_100111369 3300005530 Bacteria 2724
117 Ga0070679_100127930 3300005530 Bacteria 2522
118 Ga0070679_100403883 3300005530 Bacteria 1312
119 Ga0070684_100097876 3300005535 Bacteria 2617
120 Ga0070684_100214642 3300005535 Unclassified 1754
121 Ga0070684_101256445 3300005535 Bacteria 697
122 Ga0068853_100006609 3300005539 Bacteria 9230
123 Ga0068853_100049066 3300005539 Bacteria 3627
124 Ga0068853_100083512 3300005539 Bacteria 2798
125 Ga0068853_102423683 3300005539 Bacteria 508
126 Ga0070672_100004037 3300005543 Bacteria 9576
127 Ga0070672_100089143 3300005543 Bacteria 2485
128 Ga0070686_100030618 3300005544 Bacteria 3283
129 Ga0070686_100246934 3300005544 Bacteria 1302
130 Ga0070696_100881788 3300005546 Bacteria 741
131 Ga0070665_100027367 3300005548 Bacteria 5744
132 Ga0070665_100114961 3300005548 Bacteria 2693
133 Ga0070665_100823879 3300005548 Bacteria 941
134 Ga0070665_101454977 3300005548 Bacteria 694
135 Ga0068855_100002720 3300005563 Bacteria 21788
136 Ga0068855_100008542 3300005563 Bacteria 12379
137 Ga0068855_100046168 3300005563 Bacteria 5150
138 Ga0068855_100169820 3300005563 Bacteria 2471
139 Ga0068855_100236900 3300005563 Bacteria 2041
140 Ga0068855_100914783 3300005563 Bacteria 926
141 Ga0068855_101138841 3300005563 Bacteria 814
142 Ga0068855_102325416 3300005563 Bacteria 536
143 Ga0070664_100004841 3300005564 Bacteria 10784
144 Ga0070664_100012086 3300005564 Bacteria 7016
145 Ga0070664_102207276 3300005564 Unclassified 522
146 Ga0068857_100325249 3300005577 Unclassified 1421
147 Ga0068857_101513131 3300005577 Bacteria 654
148 Ga0068854_100031913 3300005578 Bacteria 3662
149 Ga0068854_100076202 3300005578 Bacteria 2464
150 Ga0068854_100116632 3300005578 Unclassified 2021
151 Ga0068854_100165774 3300005578 Bacteria 1715
152 Ga0068854_100171405 3300005578 Bacteria 1689
153 Ga0068854_100318769 3300005578 Unclassified 1263
154 Ga0068854_100616935 3300005578 Bacteria 928
155 Ga0068854_101441309 3300005578 Bacteria 624
156 Ga0068856_100000538 3300005614 Bacteria 41802
157 Ga0068856_100025534 3300005614 Bacteria 5761
158 Ga0068856_100044647 3300005614 Bacteria 4362
159 Ga0068856_100059828 3300005614 Bacteria 3763
160 Ga0068856_100073447 3300005614 Bacteria 3386
161 Ga0068856_100205080 3300005614 Bacteria 1986
162 Ga0068856_101811646 3300005614 Bacteria 622
163 Ga0068856_102433403 3300005614 Bacteria 531
164 Ga0070702_100701578 3300005615 Bacteria 771
165 Ga0068852_100001259 3300005616 Bacteria 16883
166 Ga0068852_100001353 3300005616 Bacteria 16442
167 Ga0068852_100024721 3300005616 Bacteria 4859
168 Ga0068852_100040308 3300005616 Bacteria 3939
169 Ga0068852_100048902 3300005616 Bacteria 3615
170 Ga0068852_100057579 3300005616 Bacteria 3363
171 Ga0068852_100444124 3300005616 Bacteria 1283
172 Ga0068852_100511444 3300005616 Bacteria 1197
173 Ga0068852_100878493 3300005616 Unclassified 913
174 Ga0068852_101677515 3300005616 Bacteria 658
175 Ga0068852_102086351 3300005616 Bacteria 589
176 Ga0068852_102710679 3300005616 Bacteria 515
177 Ga0068859_100023097 3300005617 Bacteria 6238
178 Ga0068859_101928411 3300005617 Unclassified 652
179 Ga0068859_102487107 3300005617 Unclassified 570
180 Ga0068864_100010872 3300005618 Bacteria 7524
181 Ga0068864_100068516 3300005618 Bacteria 3083
182 Ga0068864_100080885 3300005618 Bacteria 2847
183 Ga0068866_10003739 3300005718 Bacteria 6239
184 Ga0068861_102175712 3300005719 Bacteria 555
185 Ga0068851_10011457 3300005834 Bacteria 4159
186 Ga0068851_10024599 3300005834 Bacteria 2949
187 Ga0068851_10033091 3300005834 Bacteria 2575
188 Ga0068851_11046403 3300005834 Unclassified 516
189 Ga0068863_100085105 3300005841 Bacteria 2996
190 Ga0068863_100263529 3300005841 Unclassified 1667
191 Ga0068863_100293271 3300005841 Bacteria 1577
192 Ga0068863_100480074 3300005841 Bacteria 1222
193 Ga0068858_100000640 3300005842 Bacteria 36414
194 Ga0068858_100012514 3300005842 Bacteria 8002
195 Ga0068858_100132848 3300005842 Bacteria 2334
196 Ga0068858_100181733 3300005842 Bacteria 1986
197 Ga0068858_101370093 3300005842 Bacteria 697
198 Ga0068860_100101095 3300005843 Bacteria 2751
199 Ga0068860_100573345 3300005843 Bacteria 1132
200 Ga0068860_101104620 3300005843 Bacteria 812
201 Ga0070717_10003857 3300006028 Bacteria 10783
202 Ga0070717_10372903 3300006028 Bacteria 1279
203 Ga0070717_10550022 3300006028 Unclassified 1045
204 Ga0070717_11520863 3300006028 Unclassified 607
205 Ga0070716_100100866 3300006173 Bacteria 1769
206 Ga0070712_100268000 3300006175 Bacteria 1371
207 Ga0097621_100030726 3300006237 Bacteria 4256
208 Ga0097621_100501650 3300006237 Bacteria 1099
209 Ga0097621_100736068 3300006237 Bacteria 910
210 Ga0068871_100009938 3300006358 Bacteria 6910
211 Ga0068871_100067451 3300006358 Bacteria 2935
212 Ga0068871_101481518 3300006358 Unclassified 641
213 Ga0068865_100017772 3300006881 Bacteria 4578
214 Ga0068865_100424975 3300006881 Bacteria 1093
215 Ga0097620_100023097 3300006931 Bacteria 6238
216 Ga0097620_100469841 3300006931 Bacteria 1353
217 Ga0097620_101928009 3300006931 Unclassified 652
218 Ga0097620_102487486 3300006931 Unclassified 570
219 Ga0105240_10010272 3300009093 Bacteria 13180
220 Ga0105240_11251940 3300009093 Unclassified 784
221 Ga0105245_10030094 3300009098 Bacteria 4800
222 Ga0105245_10584046 3300009098 Bacteria 1142
223 Ga0105247_10867070 3300009101 Bacteria 694
224 Ga0105243_10018559 3300009148 Bacteria 5271
225 Ga0105241_10060615 3300009174 Bacteria 2911
226 Ga0105241_11475925 3300009174 Bacteria 654
227 Ga0105242_10020178 3300009176 Bacteria 5224
228 Ga0105248_10000443 3300009177 Bacteria 47083
229 Ga0105248_10002046 3300009177 Bacteria 22341
230 Ga0105248_10067210 3300009177 Bacteria 4024
231 Ga0105248_10347639 3300009177 Bacteria 1669
232 Ga0105248_10681596 3300009177 Bacteria 1160
233 Ga0105248_10789544 3300009177 Bacteria 1072
234 Ga0105238_10019845 3300009551 Bacteria 6841
235 Ga0105238_10143003 3300009551 Bacteria 2369
236 Ga0105238_10293971 3300009551 Unclassified 1607
237 Ga0105238_11586311 3300009551 Unclassified 684
238 Ga0105246_10556582 3300011119 Bacteria 984
239 Ga0157373_10005452 3300013100 Bacteria 9550
240 Ga0157373_10046290 3300013100 Bacteria 3103
241 Ga0157373_10047279 3300013100 Bacteria 3069
242 Ga0157373_10050093 3300013100 Bacteria 2975
243 Ga0157373_10101886 3300013100 Bacteria 2020
244 Ga0157373_10113305 3300013100 Bacteria 1906
245 Ga0157373_11452939 3300013100 Bacteria 522
246 Ga0157371_10008659 3300013102 Bacteria 8083
247 Ga0157371_10097561 3300013102 Bacteria 2083
248 Ga0157371_10131219 3300013102 Bacteria 1783
249 Ga0157371_10401864 3300013102 Bacteria 1003
250 Ga0157371_10706482 3300013102 Bacteria 755
251 Ga0157370_10014208 3300013104 Bacteria 8159
252 Ga0157370_10043843 3300013104 Bacteria 4302
253 Ga0157370_10050325 3300013104 Bacteria 3983
254 Ga0157370_10099244 3300013104 Bacteria 2729
255 Ga0157370_10124747 3300013104 Bacteria 2404
256 Ga0157370_10176867 3300013104 Bacteria 1983
257 Ga0157370_11875578 3300013104 Bacteria 538
258 Ga0157369_10035839 3300013105 Bacteria 5439
259 Ga0157369_10142024 3300013105 Bacteria 2540
260 Ga0157369_10257643 3300013105 Bacteria 1820
261 Ga0157374_10053258 3300013296 Bacteria 3772
262 Ga0157374_10078091 3300013296 Bacteria 3135
263 Ga0157374_10596427 3300013296 Bacteria 1114
264 Ga0157378_10040383 3300013297 Bacteria 4137
265 Ga0157378_10104869 3300013297 Bacteria 2584
266 Ga0157372_10090051 3300013307 Bacteria 3487
267 Ga0157372_10414471 3300013307 Unclassified 1570
268 Ga0157372_11022347 3300013307 Bacteria 957
269 Ga0157375_10037522 3300013308 Bacteria 4644
270 Ga0157375_11288820 3300013308 Bacteria 859
271 Ga0163163_10000058 3300014325 Bacteria 123478
272 Ga0163163_10116022 3300014325 Bacteria 2709
273 Ga0182008_10498946 3300014497 Bacteria 669
274 Ga0157379_10034838 3300014968 Bacteria 4489
275 Ga0157379_10041644 3300014968 Bacteria 4100
276 Ga0157379_12109998 3300014968 Unclassified 559
277 Ga0154015_1286063 3300020610 Unclassified 633
278 Ga0207697_10239607 3300025315 Bacteria 802
279 Ga0207656_10014271 3300025321 Bacteria 3056
280 Ga0207656_10041974 3300025321 Bacteria 1945
281 Ga0207656_10121976 3300025321 Bacteria 1214
282 Ga0207692_10812636 3300025898 Bacteria 612
283 Ga0207642_10017239 3300025899 Bacteria 2742
284 Ga0207688_10331221 3300025901 Bacteria 935
285 Ga0207688_10837736 3300025901 Unclassified 583
286 Ga0207680_10002423 3300025903 Bacteria 8696
287 Ga0207680_10012374 3300025903 Bacteria 4343
288 Ga0207680_10191641 3300025903 Bacteria 1388
289 Ga0207680_10218345 3300025903 Bacteria 1306
290 Ga0207647_10008618 3300025904 Bacteria 7296
291 Ga0207647_10038714 3300025904 Bacteria 3014
292 Ga0207647_10047835 3300025904 Bacteria 2658
293 Ga0207647_10088225 3300025904 Bacteria 1852
294 Ga0207647_10202976 3300025904 Bacteria 1146
295 Ga0207699_10067535 3300025906 Bacteria 2174
296 Ga0207645_10050245 3300025907 Bacteria 2662
297 Ga0207645_10071608 3300025907 Bacteria 2219
298 Ga0207705_10000529 3300025909 Bacteria 32329
299 Ga0207705_10002300 3300025909 Bacteria 14785
300 Ga0207705_10002347 3300025909 Bacteria 14636
301 Ga0207705_10022470 3300025909 Bacteria 4497
302 Ga0207705_10042975 3300025909 Bacteria 3245
303 Ga0207705_10148650 3300025909 Bacteria 1754
304 Ga0207705_10389330 3300025909 Bacteria 1077
305 Ga0207705_10408638 3300025909 Bacteria 1050
306 Ga0207705_10413538 3300025909 Bacteria 1044
307 Ga0207705_11537046 3300025909 Unclassified 503
308 Ga0207654_10069321 3300025911 Unclassified 2089
309 Ga0207707_10032886 3300025912 Bacteria 4539
310 Ga0207707_10104523 3300025912 Bacteria 2475
311 Ga0207707_10862362 3300025912 Unclassified 751
312 Ga0207707_10889580 3300025912 Bacteria 737
313 Ga0207707_11411795 3300025912 Unclassified 555
314 Ga0207695_11493968 3300025913 Unclassified 556
315 Ga0207693_10037353 3300025915 Bacteria 3828
316 Ga0207663_10150809 3300025916 Bacteria 1631
317 Ga0207660_10001957 3300025917 Bacteria 13740
318 Ga0207660_10003177 3300025917 Bacteria 10745
319 Ga0207660_10008800 3300025917 Bacteria 6526
320 Ga0207660_10013429 3300025917 Bacteria 5367
321 Ga0207660_10389625 3300025917 Bacteria 1121
322 Ga0207662_10639096 3300025918 Bacteria 743
323 Ga0207657_10000126 3300025919 Bacteria 76430
324 Ga0207657_10012934 3300025919 Bacteria 8206
325 Ga0207657_10045673 3300025919 Bacteria 3841
326 Ga0207657_10080385 3300025919 Bacteria 2740
327 Ga0207657_10098040 3300025919 Bacteria 2436
328 Ga0207657_10128352 3300025919 Bacteria 2080
329 Ga0207657_10566955 3300025919 Bacteria 887
330 Ga0207657_10662515 3300025919 Bacteria 812
331 Ga0207657_10741448 3300025919 Unclassified 761
332 Ga0207657_11251413 3300025919 Bacteria 562
333 Ga0207649_10000937 3300025920 Bacteria 18258
334 Ga0207649_10016374 3300025920 Bacteria 4179
335 Ga0207649_10035928 3300025920 Bacteria 2981
336 Ga0207649_10305160 3300025920 Unclassified 1165
337 Ga0207649_10654061 3300025920 Bacteria 812
338 Ga0207652_10000453 3300025921 Bacteria 42225
339 Ga0207652_10034753 3300025921 Bacteria 4250
340 Ga0207652_10400506 3300025921 Bacteria 1238
341 Ga0207652_11434189 3300025921 Unclassified 594
342 Ga0207694_10058218 3300025924 Bacteria 3005
343 Ga0207694_10076073 3300025924 Bacteria 2628
344 Ga0207694_10117552 3300025924 Bacteria 2120
345 Ga0207650_10003655 3300025925 Bacteria 10522
346 Ga0207650_10049706 3300025925 Bacteria 3098
347 Ga0207650_10165519 3300025925 Bacteria 1755
348 Ga0207659_10271701 3300025926 Bacteria 1383
349 Ga0207687_10110467 3300025927 Bacteria 2039
350 Ga0207687_10306554 3300025927 Bacteria 1280
351 Ga0207700_10496346 3300025928 Bacteria 1080
352 Ga0207700_10700369 3300025928 Bacteria 904
353 Ga0207664_10063721 3300025929 Bacteria 2947
354 Ga0207664_10198573 3300025929 Unclassified 1730
355 Ga0207664_10297246 3300025929 Bacteria 1420
356 Ga0207664_10297516 3300025929 Bacteria 1419
357 Ga0207664_10559003 3300025929 Bacteria 1027
358 Ga0207664_10650079 3300025929 Bacteria 948
359 Ga0207644_10012689 3300025931 Bacteria 5601
360 Ga0207644_10028517 3300025931 Bacteria 3865
361 Ga0207644_10057751 3300025931 Bacteria 2802
362 Ga0207644_10152900 3300025931 Bacteria 1787
363 Ga0207644_10286700 3300025931 Bacteria 1323
364 Ga0207690_10000106 3300025932 Bacteria 67786
365 Ga0207690_10028710 3300025932 Bacteria 3528
366 Ga0207690_10069367 3300025932 Bacteria 2425
367 Ga0207690_10074127 3300025932 Bacteria 2357
368 Ga0207690_10076697 3300025932 Bacteria 2321
369 Ga0207690_10149126 3300025932 Bacteria 1732
370 Ga0207690_10300113 3300025932 Unclassified 1257
371 Ga0207690_10432197 3300025932 Bacteria 1055
372 Ga0207706_10000151 3300025933 Bacteria 76455
373 Ga0207706_10064263 3300025933 Bacteria 3231
374 Ga0207706_10078329 3300025933 Bacteria 2907
375 Ga0207706_10584385 3300025933 Bacteria 960
376 Ga0207706_11691204 3300025933 Bacteria 510
377 Ga0207686_10010151 3300025934 Bacteria 5121
378 Ga0207709_10361719 3300025935 Bacteria 1099
379 Ga0207670_10097732 3300025936 Bacteria 2091
380 Ga0207669_10013632 3300025937 Bacteria 4046
381 Ga0207669_10032019 3300025937 Bacteria 2947
382 Ga0207669_10087672 3300025937 Bacteria 2016
383 Ga0207704_10010516 3300025938 Bacteria 4519
384 Ga0207704_10337268 3300025938 Bacteria 1169
385 Ga0207665_10095044 3300025939 Bacteria 2071
386 Ga0207665_10123086 3300025939 Bacteria 1834
387 Ga0207691_10006976 3300025940 Bacteria 10900
388 Ga0207691_10134197 3300025940 Bacteria 2185
389 Ga0207711_10000174 3300025941 Bacteria 69263
390 Ga0207711_10001912 3300025941 Bacteria 18916
391 Ga0207711_10018631 3300025941 Bacteria 5772
392 Ga0207711_10290151 3300025941 Bacteria 1508
393 Ga0207711_10576262 3300025941 Bacteria 1050
394 Ga0207711_10678646 3300025941 Bacteria 961
395 Ga0207661_10006497 3300025944 Bacteria 8265
396 Ga0207661_10007816 3300025944 Bacteria 7616
397 Ga0207661_10787718 3300025944 Bacteria 875
398 Ga0207679_10002382 3300025945 Bacteria 11568
399 Ga0207679_10036861 3300025945 Bacteria 3471
400 Ga0207679_11123339 3300025945 Bacteria 721
401 Ga0207679_12030965 3300025945 Unclassified 523
402 Ga0207667_10002108 3300025949 Bacteria 24944
403 Ga0207667_10017856 3300025949 Bacteria 7975
404 Ga0207667_10035328 3300025949 Bacteria 5362
405 Ga0207667_10361394 3300025949 Bacteria 1480
406 Ga0207667_10439383 3300025949 Bacteria 1327
407 Ga0207667_11092403 3300025949 Bacteria 781
408 Ga0207667_11819978 3300025949 Bacteria 573
409 Ga0207651_10003557 3300025960 Bacteria 7658
410 Ga0207651_10009850 3300025960 Bacteria 5259
411 Ga0207651_10764257 3300025960 Bacteria 855
412 Ga0207640_10035980 3300025981 Bacteria 3104
413 Ga0207640_10082893 3300025981 Bacteria 2197
414 Ga0207640_10087036 3300025981 Bacteria 2153
415 Ga0207640_10531466 3300025981 Bacteria 985
416 Ga0207640_10674185 3300025981 Bacteria 883
417 Ga0207640_10853425 3300025981 Bacteria 792
418 Ga0207640_11483202 3300025981 Unclassified 609
419 Ga0207658_10002624 3300025986 Bacteria 13051
420 Ga0207658_10021543 3300025986 Bacteria 4477
421 Ga0207677_10001901 3300026023 Bacteria 11024
422 Ga0207677_10020356 3300026023 Bacteria 4027
423 Ga0207677_10080035 3300026023 Bacteria 2339
424 Ga0207677_11350113 3300026023 Bacteria 656
425 Ga0207703_10001865 3300026035 Bacteria 18737
426 Ga0207703_10038037 3300026035 Bacteria 3837
427 Ga0207703_10156311 3300026035 Bacteria 1993
428 Ga0207703_10430509 3300026035 Bacteria 1229
429 Ga0207639_10000573 3300026041 Bacteria 25324
430 Ga0207639_10029388 3300026041 Bacteria 4023
431 Ga0207639_10050906 3300026041 Bacteria 3147
432 Ga0207639_10668840 3300026041 Bacteria 962
433 Ga0207639_11934991 3300026041 Bacteria 551
434 Ga0207678_10001365 3300026067 Bacteria 22501
435 Ga0207678_10010888 3300026067 Bacteria 7992
436 Ga0207678_10031414 3300026067 Bacteria 4632
437 Ga0207678_10214083 3300026067 Bacteria 1649
438 Ga0207678_11180619 3300026067 Bacteria 678
439 Ga0207702_10001045 3300026078 Bacteria 28350
440 Ga0207702_10046707 3300026078 Bacteria 3646
441 Ga0207702_10046860 3300026078 Bacteria 3641
442 Ga0207702_10110457 3300026078 Bacteria 2443
443 Ga0207702_10117705 3300026078 Bacteria 2373
444 Ga0207702_10510008 3300026078 Bacteria 1173
445 Ga0207702_11287208 3300026078 Bacteria 725
446 Ga0207702_11710267 3300026078 Bacteria 622
447 Ga0207702_12277173 3300026078 Unclassified 530
448 Ga0207641_10105719 3300026088 Bacteria 2486
449 Ga0207641_10418083 3300026088 Bacteria 1290
450 Ga0207641_10431753 3300026088 Unclassified 1270
451 Ga0207641_11429645 3300026088 Unclassified 693
452 Ga0207648_10027416 3300026089 Bacteria 5056
453 Ga0207676_10007892 3300026095 Bacteria 7571
454 Ga0207676_10015835 3300026095 Bacteria 5452
455 Ga0207676_10446445 3300026095 Bacteria 1218
456 Ga0207674_10347738 3300026116 Bacteria 1433
457 Ga0207674_10635407 3300026116 Bacteria 1031
458 Ga0207674_11103242 3300026116 Bacteria 763
459 Ga0207683_10014579 3300026121 Bacteria 6695
460 Ga0207698_10002899 3300026142 Bacteria 10260
461 Ga0207698_10010143 3300026142 Bacteria 6036
462 Ga0207698_10015069 3300026142 Bacteria 5166
463 Ga0207698_10020711 3300026142 Bacteria 4532
464 Ga0207698_10174136 3300026142 Bacteria 1898
465 Ga0207698_10221497 3300026142 Bacteria 1710
466 Ga0207698_10410291 3300026142 Bacteria 1297
467 Ga0207698_10550411 3300026142 Unclassified 1131
468 Ga0207698_10683219 3300026142 Bacteria 1020
469 Ga0207698_10915508 3300026142 Unclassified 885
470 Ga0207698_11193640 3300026142 Bacteria 775
471 Ga0268266_10017332 3300028379 Bacteria 6147
472 Ga0268266_10118868 3300028379 Bacteria 2350
473 Ga0268266_11005522 3300028379 Bacteria 807
474 Ga0268266_11372009 3300028379 Bacteria 682
475 Ga0268264_10070009 3300028381 Bacteria 2969
476 Ga0268264_10686970 3300028381 Bacteria 1016
477 Ga0268264_12006022 3300028381 Bacteria 588
478 Ga0307405_10115273 3300031731 Bacteria 1828
479 Ga0307413_10033984 3300031824 Bacteria 2909
480 Ga0307410_10015921 3300031852 Bacteria 4470
481 Ga0307410_11236440 3300031852 Bacteria 651
482 Ga0307406_11123543 3300031901 Unclassified 679
483 Ga0307407_10505877 3300031903 Bacteria 886
484 Ga0307412_10269777 3300031911 Bacteria 1331
485 Ga0307409_100680736 3300031995 Bacteria 1026
486 Ga0307416_100011123 3300032002 Bacteria 5985
487 Ga0307414_10019348 3300032004 Bacteria 4217
488 Ga0307411_10006880 3300032005 Bacteria 5733
489 Ga0307415_100001290 3300032126 Bacteria 11817
490 Ga0307415_100049467 3300032126 Bacteria 2843
491 Ga0373930_0156410 3300034816 Unclassified 574
492 Ga0373928_0195002 3300035084 Bacteria 582
493 Ga0373929_0126719 3300035085 Bacteria 666
494 Ga0373944_0231650 3300035089 Bacteria 677
495 Ga0373951_0171369 3300035091 Bacteria 619
496 Ga0373923_0069876 3300035111 Bacteria 1506
497 Ga0373932_0250607 3300035112 Unclassified 646
498 Ga0373939_0027810 3300035114 Bacteria 1605
499 Ga0373941_0166730 3300035115 Bacteria 818
500 Ga0373945_0274054 3300035116 Bacteria 717
501 Ga0373957_0168310 3300035120 Bacteria 905
502 Ga0373960_0025800 3300035121 Bacteria 1601
503 Ga0373960_0311978 3300035121 Bacteria 587
504 Ga0373943_0007352 3300035170 Bacteria 4945
505 Ga0373943_0663316 3300035170 Bacteria 617
506 Ga0373946_0016959 3300035171 Bacteria 2781
507 Ga0373946_0530279 3300035171 Bacteria 606
508 Ga0373955_0097542 3300035172 Bacteria 1683
509 Ga0373961_0113944 3300035241 Bacteria 889
510 Ga0373961_0280989 3300035241 Bacteria 611
511 Ga0373931_0020691 3300035691 Bacteria 3294
512 Ga0373931_0773436 3300035691 Bacteria 639
513 Ga0373935_0012856 3300035692 Bacteria 5042
514 Ga0373927_0057767 3300035695 Bacteria 2509
515 Ga0373933_0005622 3300035724 Bacteria 6831
516 Ga0373937_0110855 3300036401 Unclassified 2552
517 Ga0373937_0413015 3300036401 Bacteria 1281
518 Ga0373925_0033179 3300037068 Bacteria 3805
519 Ga0395899_0001848 3300037312 Bacteria 17528
520 Ga0395899_0029616 3300037312 Bacteria 4118
521 Ga0395899_0047099 3300037312 Bacteria 3210
522 Ga0395899_0054789 3300037312 Bacteria 2950
523 Ga0395899_0098701 3300037312 Bacteria 2110
524 Ga0395899_0903253 3300037312 Bacteria 538
525 Ga0395900_0001041 3300037418 Bacteria 35559
526 Ga0395900_0007724 3300037418 Bacteria 11091
527 Ga0395900_0013518 3300037418 Bacteria 8341
528 Ga0395900_0051163 3300037418 Bacteria 4256
529 Ga0395900_0063304 3300037418 Bacteria 3802
530 Ga0395900_0074368 3300037418 Bacteria 3493
531 Ga0395900_0242765 3300037418 Bacteria 1806
532 Ga0395900_0283108 3300037418 Bacteria 1649
533 Ga0395900_0298224 3300037418 Bacteria 1599
534 Ga0395900_0387596 3300037418 Unclassified 1364
535 Ga0395900_0549705 3300037418 Bacteria 1099
536 Ga0395900_0661492 3300037418 Bacteria 980
537 Ga0395900_0862364 3300037418 Bacteria 830
538 Ga0395898_0000274 3300037466 Bacteria 125922
539 Ga0395898_0004671 3300037466 Bacteria 14928
540 Ga0395898_0008927 3300037466 Bacteria 10558
541 Ga0395898_0157678 3300037466 Bacteria 2171
542 Ga0395898_0159986 3300037466 Bacteria 2154
543 Ga0395905_0000006 3300037471 Bacteria 549428
544 Ga0395905_0008263 3300037471 Bacteria 10278
545 Ga0395905_0015874 3300037471 Bacteria 7154
546 Ga0395905_0027324 3300037471 Bacteria 5381
547 Ga0395905_0032174 3300037471 Bacteria 4934
548 Ga0395905_0034161 3300037471 Bacteria 4774
549 Ga0395905_0058199 3300037471 Bacteria 3614
550 Ga0395905_0130751 3300037471 Bacteria 2361
551 Ga0395905_0138199 3300037471 Bacteria 2292
552 Ga0395905_0161942 3300037471 Bacteria 2102
553 Ga0395905_0422649 3300037471 Bacteria 1229
554 Ga0395905_0677424 3300037471 Bacteria 933
555 Ga0395905_1141411 3300037471 Unclassified 683
556 Ga0395901_0025512 3300038443 Bacteria 6068
557 Ga0395901_0049173 3300038443 Bacteria 4380
558 Ga0395901_0050529 3300038443 Bacteria 4319
559 Ga0395901_0056121 3300038443 Bacteria 4097
560 Ga0395901_0348018 3300038443 Bacteria 1530
561 Ga0395901_0626016 3300038443 Bacteria 1082
562 Ga0395901_0731424 3300038443 Bacteria 984
563 Ga0395901_0846077 3300038443 Bacteria 900
564 Ga0395901_0846690 3300038443 Unclassified 900
565 Ga0395901_1094988 3300038443 Bacteria 767
566 Ga0395901_1473541 3300038443 Unclassified 637
567 Ga0395901_1521828 3300038443 Unclassified 624
568 Ga0395901_1698835 3300038443 Bacteria 582
569 Ga0436363_0382019 3300039450 Unclassified 504
570 Ga0466972_0150061 3300044658 Bacteria 1096
571 Ga0466966_0128969 3300044684 Bacteria 1549
572 Ga0466966_0170268 3300044684 Bacteria 1324
573 Ga0466961_0082294 3300044693 Bacteria 2036
574 Ga0466963_0015617 3300044694 Bacteria 4707
575 Ga0466963_0093176 3300044694 Bacteria 2053
576 Ga0466963_0112317 3300044694 Bacteria 1871
577 Ga0466963_0209080 3300044694 Bacteria 1365
578 Ga0466963_0343234 3300044694 Bacteria 1051
579 Ga0466963_0746279 3300044694 Unclassified 690
580 Ga0466964_0038931 3300044706 Bacteria 1913
581 Ga0466964_0042675 3300044706 Bacteria 1838
582 Ga0466968_0006697 3300044735 Bacteria 4353
583 Ga0466970_0044992 3300044765 Bacteria 2350
584 Ga0466970_0144796 3300044765 Bacteria 1310
585 Ga0466957_0004523 3300044842 Bacteria 7760
586 Ga0466957_0101132 3300044842 Bacteria 1817
587 Ga0466957_0749967 3300044842 Unclassified 691
588 Ga0466957_1244039 3300044842 Bacteria 539
589 Ga0466960_1022302 3300044901 Bacteria 508
590 Ga0466959_0023122 3300045049 Bacteria 4598
591 Ga0466959_0099480 3300045049 Bacteria 2082
592 Ga0466959_0411598 3300045049 Unclassified 918
593 Ga0451576_1582164 3300045051 Bacteria 680
594 Ga0466958_0003161 3300045836 Bacteria 8477
595 Ga0466958_0218153 3300045836 Bacteria 1216
596 Ga0466958_0419012 3300045836 Bacteria 865
597 Ga0466967_0015138 3300045976 Bacteria 6037
598 Ga0466967_0015299 3300045976 Bacteria 6011
599 Ga0466967_0022072 3300045976 Bacteria 5186
600 Ga0466967_0034921 3300045976 Bacteria 4273
601 Ga0466967_0049306 3300045976 Bacteria 3681
602 Ga0466967_0186458 3300045976 Bacteria 1959
603 Ga0466967_0287381 3300045976 Bacteria 1579
604 Ga0466967_0340566 3300045976 Bacteria 1450
605 Ga0466967_0423108 3300045976 Bacteria 1298
606 Ga0466967_0685732 3300045976 Bacteria 1014
607 Ga0466967_0969153 3300045976 Unclassified 846
608 Ga0466967_1042935 3300045976 Unclassified 814
609 Ga0466967_1445394 3300045976 Bacteria 685
610 Ga0466967_1961937 3300045976 Unclassified 582
611 Ga0466967_2469637 3300045976 Bacteria 515
612 Ga0495621_0379223 3300046539 Bacteria 597
613 Ga0495668_0048570 3300046616 Bacteria 2354
614 Ga0495669_0132754 3300046684 Bacteria 1172
615 Ga0495602_0082886 3300048088 Bacteria 2689
616 Ga0496100_0007068 3300048903 Bacteria 6160
617 Ga0496101_0013088 3300048904 Bacteria 5549
618 Ga0496101_1115756 3300048904 Unclassified 619
619 Ga0496102_0248494 3300048905 Bacteria 1677
620 Ga0496103_0014763 3300048906 Bacteria 4643
621 Ga0496104_0043261 3300048907 Bacteria 4231
622 Ga0496104_0721619 3300048907 Bacteria 904
623 Ga0496104_1026656 3300048907 Unclassified 728
624 Ga0496105_0308738 3300048908 Bacteria 1270
625 Ga0496106_0362990 3300048909 Bacteria 1163
626 Ga0496107_0039520 3300048910 Bacteria 3384
627 Ga0496107_0186800 3300048910 Bacteria 1539
628 Ga0496107_0322574 3300048910 Bacteria 1149
629 Ga0496107_0721599 3300048910 Bacteria 732
630 Ga0496108_0041963 3300048911 Bacteria 3818
631 Ga0496108_0145985 3300048911 Bacteria 2040
632 Ga0496109_0147753 3300048912 Bacteria 2199
633 Ga0496109_0440564 3300048912 Bacteria 1231
634 Ga0496109_1011095 3300048912 Unclassified 769
635 Ga0496109_1162091 3300048912 Unclassified 709
636 Ga0496110_0050395 3300048913 Bacteria 3655
637 Ga0496110_0102725 3300048913 Bacteria 2564
638 Ga0496110_0398044 3300048913 Bacteria 1255
639 Ga0496111_0049058 3300048914 Bacteria 3043
640 Ga0496111_0158133 3300048914 Bacteria 1682
641 Ga0496112_0067920 3300048915 Bacteria 3519
642 Ga0496112_0097756 3300048915 Bacteria 2906
643 Ga0496112_0240194 3300048915 Bacteria 1764
644 Ga0496112_0456321 3300048915 Bacteria 1216
645 Ga0496112_0475772 3300048915 Unclassified 1186
646 Ga0496112_1369920 3300048915 Unclassified 622
647 Ga0496113_0033561 3300048916 Bacteria 3738
648 Ga0496113_0187171 3300048916 Bacteria 1642
649 Ga0496113_0495759 3300048916 Bacteria 981
650 Ga0496113_0538176 3300048916 Unclassified 937
651 Ga0496114_0055395 3300048917 Bacteria 3307
652 Ga0496114_0105518 3300048917 Bacteria 2410
653 Ga0496115_0000742 3300048918 Bacteria 24098
654 Ga0495612_0607720 3300053078 Unclassified 505
655 Ga0587073_0292546 3300059492 Archaea 527
656 Ga0587067_207555 3300059640 Bacteria 524
657 Ga0587071_130967 3300060344 Bacteria 608
658 Ga0466962_0047959 3300061719 Bacteria 2041
659 Ga0466962_0122783 3300061719 Bacteria 1253
660 Ga0207649_10630944
661 JGI24740J21852_10000529
662 JGI24740J21852_10180755
663 JGI24739J22299_10023939
664 JGI24739J22299_10033337
665 JGI24737J22298_10001931
666 JGI24737J22298_10162738
667 JGI24735J21928_10020396
668 JGI24738J21930_10012231
669 JGI24738J21930_10019368
670 rootH1_10063433
671 Ga0007409J51694_1038569
672 Ga0070658_10003538
673 Ga0070658_10030720
674 Ga0070658_10031607
675 Ga0070658_10049929
676 Ga0070658_10051723
677 Ga0070658_10612830
678 Ga0070658_11513643
679 Ga0070676_10048676
680 Ga0070676_10066865
681 Ga0070683_100005945
682 Ga0070683_100010252
683 Ga0070683_100937423
684 Ga0070690_100007920
685 Ga0070690_100017039
686 Ga0070670_100002725
687 Ga0070670_100047157
688 Ga0070670_100434034
689 Ga0070666_10000623
690 Ga0070666_10010081
691 Ga0070666_10039338
692 Ga0070680_100014984
693 Ga0070680_100027340
694 Ga0070680_100029933
695 Ga0070680_100506364
696 Ga0068868_100003382
697 Ga0068868_100039161
698 Ga0068868_100243073
699 Ga0068868_101698827
700 Ga0070660_100000560
701 Ga0070660_100013428
702 Ga0070660_100022352
703 Ga0070660_100090222
704 Ga0070660_100095812
705 Ga0070660_100298812
706 Ga0070660_100786188
707 Ga0070689_100101498
708 Ga0070689_101770571
709 Ga0070691_10513918
710 Ga0070661_100000075
711 Ga0070661_100023382
712 Ga0070661_100033588
713 Ga0070661_100053435
714 Ga0070661_100057585
715 Ga0070661_100087253
716 Ga0070661_100193011
717 Ga0070661_100251981
718 Ga0070661_100283365
719 Ga0070661_100865048
720 Ga0070692_10039400
721 Ga0070675_100229726
722 Ga0070671_100000963
723 Ga0070671_100031625
724 Ga0070671_100040800
725 Ga0070671_100061919
726 Ga0070671_100146628
727 Ga0070674_100005418
728 Ga0070674_100039907
729 Ga0070674_100124680
730 Ga0070673_100023106
731 Ga0070673_101098657
732 Ga0070688_100032694
733 Ga0070659_100004345
734 Ga0070659_100063078
735 Ga0070659_100068069
736 Ga0070659_100079601
737 Ga0070659_100131344
738 Ga0070659_100189959
739 Ga0070659_100200192
740 Ga0070659_100344653
741 Ga0070659_100592464
742 Ga0070659_100791778
743 Ga0070659_100861753
744 Ga0070667_100000764
745 Ga0070667_100025017
746 Ga0070667_100091190
747 Ga0070667_100384510
748 Ga0070709_10236104
749 Ga0070714_100059117
750 Ga0070714_100059255
751 Ga0070714_100106783
752 Ga0070714_100137572
753 Ga0070714_100395509
754 Ga0070713_100014227
755 Ga0070713_100147383
756 Ga0070711_100249282
757 Ga0070663_100004025
758 Ga0070663_100010825
759 Ga0070663_100038238
760 Ga0070663_100112161
761 Ga0070678_100016095
762 Ga0070662_100003155
763 Ga0070662_100043476
764 Ga0070662_100055181
765 Ga0070662_101150833
766 Ga0070662_101429625
767 Ga0070681_10043010
768 Ga0070681_10122707
769 Ga0070681_10244996
770 Ga0070681_11215127
771 Ga0070681_11919096
772 Ga0068867_100024750
773 Ga0070685_10069399
774 Ga0070679_100002411
775 Ga0070679_100111369
776 Ga0070679_100127930
777 Ga0070679_100403883
778 Ga0070684_100097876
779 Ga0070684_100214642
780 Ga0070684_101256445
781 Ga0068853_100006609
782 Ga0068853_100049066
783 Ga0068853_100083512
784 Ga0068853_102423683
785 Ga0070672_100004037
786 Ga0070672_100089143
787 Ga0070686_100030618
788 Ga0070686_100246934
789 Ga0070696_100881788
790 Ga0070665_100027367
791 Ga0070665_100114961
792 Ga0070665_100823879
793 Ga0070665_101454977
794 Ga0068855_100002720
795 Ga0068855_100008542
796 Ga0068855_100046168
797 Ga0068855_100169820
798 Ga0068855_100236900
799 Ga0068855_100914783
800 Ga0068855_101138841
801 Ga0068855_102325416
802 Ga0070664_100004841
803 Ga0070664_100012086
804 Ga0070664_102207276
805 Ga0068857_100325249
806 Ga0068857_101513131
807 Ga0068854_100031913
808 Ga0068854_100076202
809 Ga0068854_100116632
810 Ga0068854_100165774
811 Ga0068854_100171405
812 Ga0068854_100318769
813 Ga0068854_100616935
814 Ga0068854_101441309
815 Ga0068856_100000538
816 Ga0068856_100025534
817 Ga0068856_100044647
818 Ga0068856_100059828
819 Ga0068856_100073447
820 Ga0068856_100205080
821 Ga0068856_101811646
822 Ga0068856_102433403
823 Ga0070702_100701578
824 Ga0068852_100001259
825 Ga0068852_100001353
826 Ga0068852_100024721
827 Ga0068852_100040308
828 Ga0068852_100048902
829 Ga0068852_100057579
830 Ga0068852_100444124
831 Ga0068852_100511444
832 Ga0068852_100878493
833 Ga0068852_101677515
834 Ga0068852_102086351
835 Ga0068852_102710679
836 Ga0068859_100023097
837 Ga0068859_101928411
838 Ga0068859_102487107
839 Ga0068864_100010872
840 Ga0068864_100068516
841 Ga0068864_100080885
842 Ga0068866_10003739
843 Ga0068861_102175712
844 Ga0068851_10011457
845 Ga0068851_10024599
846 Ga0068851_10033091
847 Ga0068851_11046403
848 Ga0068863_100085105
849 Ga0068863_100263529
850 Ga0068863_100293271
851 Ga0068863_100480074
852 Ga0068858_100000640
853 Ga0068858_100012514
854 Ga0068858_100132848
855 Ga0068858_100181733
856 Ga0068858_101370093
857 Ga0068860_100101095
858 Ga0068860_100573345
859 Ga0068860_101104620
860 Ga0070717_10003857
861 Ga0070717_10372903
862 Ga0070717_10550022
863 Ga0070717_11520863
864 Ga0070716_100100866
865 Ga0070712_100268000
866 Ga0097621_100030726
867 Ga0097621_100501650
868 Ga0097621_100736068
869 Ga0068871_100009938
870 Ga0068871_100067451
871 Ga0068871_101481518
872 Ga0068865_100017772
873 Ga0068865_100424975
874 Ga0097620_100023097
875 Ga0097620_100469841
876 Ga0097620_101928009
877 Ga0097620_102487486
878 Ga0105240_10010272
879 Ga0105240_11251940
880 Ga0105245_10030094
881 Ga0105245_10584046
882 Ga0105247_10867070
883 Ga0105243_10018559
884 Ga0105241_10060615
885 Ga0105241_11475925
886 Ga0105242_10020178
887 Ga0105248_10000443
888 Ga0105248_10002046
889 Ga0105248_10067210
890 Ga0105248_10347639
891 Ga0105248_10681596
892 Ga0105248_10789544
893 Ga0105238_10019845
894 Ga0105238_10143003
895 Ga0105238_10293971
896 Ga0105238_11586311
897 Ga0105246_10556582
898 Ga0157373_10005452
899 Ga0157373_10046290
900 Ga0157373_10047279
901 Ga0157373_10050093
902 Ga0157373_10101886
903 Ga0157373_10113305
904 Ga0157373_11452939
905 Ga0157371_10008659
906 Ga0157371_10097561
907 Ga0157371_10131219
908 Ga0157371_10401864
909 Ga0157371_10706482
910 Ga0157370_10014208
911 Ga0157370_10043843
912 Ga0157370_10050325
913 Ga0157370_10099244
914 Ga0157370_10124747
915 Ga0157370_10176867
916 Ga0157370_11875578
917 Ga0157369_10035839
918 Ga0157369_10142024
919 Ga0157369_10257643
920 Ga0157374_10053258
921 Ga0157374_10078091
922 Ga0157374_10596427
923 Ga0157378_10040383
924 Ga0157378_10104869
925 Ga0157372_10090051
926 Ga0157372_10414471
927 Ga0157372_11022347
928 Ga0157375_10037522
929 Ga0157375_11288820
930 Ga0163163_10000058
931 Ga0163163_10116022
932 Ga0182008_10498946
933 Ga0157379_10034838
934 Ga0157379_10041644
935 Ga0157379_12109998
936 Ga0154015_1286063
937 Ga0207697_10239607
938 Ga0207656_10014271
939 Ga0207656_10041974
940 Ga0207656_10121976
941 Ga0207692_10812636
942 Ga0207642_10017239
943 Ga0207688_10331221
944 Ga0207688_10837736
945 Ga0207680_10002423
946 Ga0207680_10012374
947 Ga0207680_10191641
948 Ga0207680_10218345
949 Ga0207647_10008618
950 Ga0207647_10038714
951 Ga0207647_10047835
952 Ga0207647_10088225
953 Ga0207647_10202976
954 Ga0207699_10067535
955 Ga0207645_10050245
956 Ga0207645_10071608
957 Ga0207705_10000529
958 Ga0207705_10002300
959 Ga0207705_10002347
960 Ga0207705_10022470
961 Ga0207705_10042975
962 Ga0207705_10148650
963 Ga0207705_10389330
964 Ga0207705_10408638
965 Ga0207705_10413538
966 Ga0207705_11537046
967 Ga0207654_10069321
968 Ga0207707_10032886
969 Ga0207707_10104523
970 Ga0207707_10862362
971 Ga0207707_10889580
972 Ga0207707_11411795
973 Ga0207695_11493968
974 Ga0207693_10037353
975 Ga0207663_10150809
976 Ga0207660_10001957
977 Ga0207660_10003177
978 Ga0207660_10008800
979 Ga0207660_10013429
980 Ga0207660_10389625
981 Ga0207662_10639096
982 Ga0207657_10000126
983 Ga0207657_10012934
984 Ga0207657_10045673
985 Ga0207657_10080385
986 Ga0207657_10098040
987 Ga0207657_10128352
988 Ga0207657_10566955
989 Ga0207657_10662515
990 Ga0207657_10741448
991 Ga0207657_11251413
992 Ga0207649_10000937
993 Ga0207649_10016374
994 Ga0207649_10035928
995 Ga0207649_10305160
996 Ga0207649_10654061
997 Ga0207652_10000453
998 Ga0207652_10034753
999 Ga0207652_10400506
1000 Ga0207652_11434189
1001 Ga0207694_10058218
1002 Ga0207694_10076073
1003 Ga0207694_10117552
1004 Ga0207650_10003655
1005 Ga0207650_10049706
1006 Ga0207650_10165519
1007 Ga0207659_10271701
1008 Ga0207687_10110467
1009 Ga0207687_10306554
1010 Ga0207700_10496346
1011 Ga0207700_10700369
1012 Ga0207664_10063721
1013 Ga0207664_10198573
1014 Ga0207664_10297246
1015 Ga0207664_10297516
1016 Ga0207664_10559003
1017 Ga0207664_10650079
1018 Ga0207644_10012689
1019 Ga0207644_10028517
1020 Ga0207644_10057751
1021 Ga0207644_10152900
1022 Ga0207644_10286700
1023 Ga0207690_10000106
1024 Ga0207690_10028710
1025 Ga0207690_10069367
1026 Ga0207690_10074127
1027 Ga0207690_10076697
1028 Ga0207690_10149126
1029 Ga0207690_10300113
1030 Ga0207690_10432197
1031 Ga0207706_10000151
1032 Ga0207706_10064263
1033 Ga0207706_10078329
1034 Ga0207706_10584385
1035 Ga0207706_11691204
1036 Ga0207686_10010151
1037 Ga0207709_10361719
1038 Ga0207670_10097732
1039 Ga0207669_10013632
1040 Ga0207669_10032019
1041 Ga0207669_10087672
1042 Ga0207704_10010516
1043 Ga0207704_10337268
1044 Ga0207665_10095044
1045 Ga0207665_10123086
1046 Ga0207691_10006976
1047 Ga0207691_10134197
1048 Ga0207711_10000174
1049 Ga0207711_10001912
1050 Ga0207711_10018631
1051 Ga0207711_10290151
1052 Ga0207711_10576262
1053 Ga0207711_10678646
1054 Ga0207661_10006497
1055 Ga0207661_10007816
1056 Ga0207661_10787718
1057 Ga0207679_10002382
1058 Ga0207679_10036861
1059 Ga0207679_11123339
1060 Ga0207679_12030965
1061 Ga0207667_10002108
1062 Ga0207667_10017856
1063 Ga0207667_10035328
1064 Ga0207667_10361394
1065 Ga0207667_10439383
1066 Ga0207667_11092403
1067 Ga0207667_11819978
1068 Ga0207651_10003557
1069 Ga0207651_10009850
1070 Ga0207651_10764257
1071 Ga0207640_10035980
1072 Ga0207640_10082893
1073 Ga0207640_10087036
1074 Ga0207640_10531466
1075 Ga0207640_10674185
1076 Ga0207640_10853425
1077 Ga0207640_11483202
1078 Ga0207658_10002624
1079 Ga0207658_10021543
1080 Ga0207677_10001901
1081 Ga0207677_10020356
1082 Ga0207677_10080035
1083 Ga0207677_11350113
1084 Ga0207703_10001865
1085 Ga0207703_10038037
1086 Ga0207703_10156311
1087 Ga0207703_10430509
1088 Ga0207639_10000573
1089 Ga0207639_10029388
1090 Ga0207639_10050906
1091 Ga0207639_10668840
1092 Ga0207639_11934991
1093 Ga0207678_10001365
1094 Ga0207678_10010888
1095 Ga0207678_10031414
1096 Ga0207678_10214083
1097 Ga0207678_11180619
1098 Ga0207702_10001045
1099 Ga0207702_10046707
1100 Ga0207702_10046860
1101 Ga0207702_10110457
1102 Ga0207702_10117705
1103 Ga0207702_10510008
1104 Ga0207702_11287208
1105 Ga0207702_11710267
1106 Ga0207702_12277173
1107 Ga0207641_10105719
1108 Ga0207641_10418083
1109 Ga0207641_10431753
1110 Ga0207641_11429645
1111 Ga0207648_10027416
1112 Ga0207676_10007892
1113 Ga0207676_10015835
1114 Ga0207676_10446445
1115 Ga0207674_10347738
1116 Ga0207674_10635407
1117 Ga0207674_11103242
1118 Ga0207683_10014579
1119 Ga0207698_10002899
1120 Ga0207698_10010143
1121 Ga0207698_10015069
1122 Ga0207698_10020711
1123 Ga0207698_10174136
1124 Ga0207698_10221497
1125 Ga0207698_10410291
1126 Ga0207698_10550411
1127 Ga0207698_10683219
1128 Ga0207698_10915508
1129 Ga0207698_11193640
1130 Ga0268266_10017332
1131 Ga0268266_10118868
1132 Ga0268266_11005522
1133 Ga0268266_11372009
1134 Ga0268264_10070009
1135 Ga0268264_10686970
1136 Ga0268264_12006022
1137 Ga0307405_10115273
1138 Ga0307413_10033984
1139 Ga0307410_10015921
1140 Ga0307410_11236440
1141 Ga0307406_11123543
1142 Ga0307407_10505877
1143 Ga0307412_10269777
1144 Ga0307409_100680736
1145 Ga0307416_100011123
1146 Ga0307414_10019348
1147 Ga0307411_10006880
1148 Ga0307415_100001290
1149 Ga0307415_100049467
1150 Ga0373930_0156410
1151 Ga0373928_0195002
1152 Ga0373929_0126719
1153 Ga0373944_0231650
1154 Ga0373951_0171369
1155 Ga0373923_0069876
1156 Ga0373932_0250607
1157 Ga0373939_0027810
1158 Ga0373941_0166730
1159 Ga0373945_0274054
1160 Ga0373957_0168310
1161 Ga0373960_0025800
1162 Ga0373960_0311978
1163 Ga0373943_0007352
1164 Ga0373943_0663316
1165 Ga0373946_0016959
1166 Ga0373946_0530279
1167 Ga0373955_0097542
1168 Ga0373961_0113944
1169 Ga0373961_0280989
1170 Ga0373931_0020691
1171 Ga0373931_0773436
1172 Ga0373935_0012856
1173 Ga0373927_0057767
1174 Ga0373933_0005622
1175 Ga0373937_0110855
1176 Ga0373937_0413015
1177 Ga0373925_0033179
1178 Ga0395899_0001848
1179 Ga0395899_0029616
1180 Ga0395899_0047099
1181 Ga0395899_0054789
1182 Ga0395899_0098701
1183 Ga0395899_0903253
1184 Ga0395900_0001041
1185 Ga0395900_0007724
1186 Ga0395900_0013518
1187 Ga0395900_0051163
1188 Ga0395900_0063304
1189 Ga0395900_0074368
1190 Ga0395900_0242765
1191 Ga0395900_0283108
1192 Ga0395900_0298224
1193 Ga0395900_0387596
1194 Ga0395900_0549705
1195 Ga0395900_0661492
1196 Ga0395900_0862364
1197 Ga0395898_0000274
1198 Ga0395898_0004671
1199 Ga0395898_0008927
1200 Ga0395898_0157678
1201 Ga0395898_0159986
1202 Ga0395905_0000006
1203 Ga0395905_0008263
1204 Ga0395905_0015874
1205 Ga0395905_0027324
1206 Ga0395905_0032174
1207 Ga0395905_0034161
1208 Ga0395905_0058199
1209 Ga0395905_0130751
1210 Ga0395905_0138199
1211 Ga0395905_0161942
1212 Ga0395905_0422649
1213 Ga0395905_0677424
1214 Ga0395905_1141411
1215 Ga0395901_0025512
1216 Ga0395901_0049173
1217 Ga0395901_0050529
1218 Ga0395901_0056121
1219 Ga0395901_0348018
1220 Ga0395901_0626016
1221 Ga0395901_0731424
1222 Ga0395901_0846077
1223 Ga0395901_0846690
1224 Ga0395901_1094988
1225 Ga0395901_1473541
1226 Ga0395901_1521828
1227 Ga0395901_1698835
1228 Ga0436363_0382019
1229 Ga0466972_0150061
1230 Ga0466966_0128969
1231 Ga0466966_0170268
1232 Ga0466961_0082294
1233 Ga0466963_0015617
1234 Ga0466963_0093176
1235 Ga0466963_0112317
1236 Ga0466963_0209080
1237 Ga0466963_0343234
1238 Ga0466963_0746279
1239 Ga0466964_0038931
1240 Ga0466964_0042675
1241 Ga0466968_0006697
1242 Ga0466970_0044992
1243 Ga0466970_0144796
1244 Ga0466957_0004523
1245 Ga0466957_0101132
1246 Ga0466957_0749967
1247 Ga0466957_1244039
1248 Ga0466960_1022302
1249 Ga0466959_0023122
1250 Ga0466959_0099480
1251 Ga0466959_0411598
1252 Ga0451576_1582164
1253 Ga0466958_0003161
1254 Ga0466958_0218153
1255 Ga0466958_0419012
1256 Ga0466967_0015138
1257 Ga0466967_0015299
1258 Ga0466967_0022072
1259 Ga0466967_0034921
1260 Ga0466967_0049306
1261 Ga0466967_0186458
1262 Ga0466967_0287381
1263 Ga0466967_0340566
1264 Ga0466967_0423108
1265 Ga0466967_0685732
1266 Ga0466967_0969153
1267 Ga0466967_1042935
1268 Ga0466967_1445394
1269 Ga0466967_1961937
1270 Ga0466967_2469637
1271 Ga0495621_0379223
1272 Ga0495668_0048570
1273 Ga0495669_0132754
1274 Ga0495602_0082886
1275 Ga0496100_0007068
1276 Ga0496101_0013088
1277 Ga0496101_1115756
1278 Ga0496102_0248494
1279 Ga0496103_0014763
1280 Ga0496104_0043261
1281 Ga0496104_0721619
1282 Ga0496104_1026656
1283 Ga0496105_0308738
1284 Ga0496106_0362990
1285 Ga0496107_0039520
1286 Ga0496107_0186800
1287 Ga0496107_0322574
1288 Ga0496107_0721599
1289 Ga0496108_0041963
1290 Ga0496108_0145985
1291 Ga0496109_0147753
1292 Ga0496109_0440564
1293 Ga0496109_1011095
1294 Ga0496109_1162091
1295 Ga0496110_0050395
1296 Ga0496110_0102725
1297 Ga0496110_0398044
1298 Ga0496111_0049058
1299 Ga0496111_0158133
1300 Ga0496112_0067920
1301 Ga0496112_0097756
1302 Ga0496112_0240194
1303 Ga0496112_0456321
1304 Ga0496112_0475772
1305 Ga0496112_1369920
1306 Ga0496113_0033561
1307 Ga0496113_0187171
1308 Ga0496113_0495759
1309 Ga0496113_0538176
1310 Ga0496114_0055395
1311 Ga0496114_0105518
1312 Ga0496115_0000742
1313 Ga0495612_0607720
1314 Ga0587073_0292546
1315 Ga0587067_207555
1316 Ga0587071_130967
1317 Ga0466962_0047959
1318 Ga0466962_0122783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map