F473105

General Info

Members Datasets Scaffolds Average Seq Length
657 243 657 75

Family's Representative Sequence

Representative Sequence 3300030760|Ga0265762_1000835|Ga0265762_10008352
Length 84
Sequence MVITRRRSAGVELKVRKFGNSLGVVLAKEVINRLHTRDGEPLFLIEASVGGCRLTPYGPRFQEKMAKAEDIISRYRNTLHVLAK

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
157 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
173 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
174 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
191 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
232 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
242 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 1.37
Rhizosphere 96.35
Stem 0
Stem Tuber 0
Unclassified 1.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10914189 3300005327 Unclassified 763
2 Ga0070676_10290716 3300005328 Bacteria 1104
3 Ga0070683_100046315 3300005329 Bacteria 4017
4 Ga0070683_100289932 3300005329 Bacteria 1557
5 Ga0070683_100530195 3300005329 Bacteria 1125
6 Ga0070690_100982218 3300005330 Unclassified 664
7 Ga0068869_100045007 3300005334 Bacteria 3176
8 Ga0070680_101035862 3300005336 Bacteria 709
9 Ga0070682_100199002 3300005337 Bacteria 1412
10 Ga0070682_101134394 3300005337 Bacteria 656
11 Ga0070682_101556405 3300005337 Unclassified 570
12 Ga0070682_101658180 3300005337 Unclassified 554
13 Ga0068868_100002894 3300005338 Bacteria 11912
14 Ga0068868_100008897 3300005338 Bacteria 7197
15 Ga0068868_100031351 3300005338 Bacteria 4082
16 Ga0070660_100587429 3300005339 Unclassified 931
17 Ga0070660_100626889 3300005339 Bacteria 900
18 Ga0070660_100765003 3300005339 Unclassified 811
19 Ga0070660_100825399 3300005339 Unclassified 780
20 Ga0070691_10342842 3300005341 Unclassified 827
21 Ga0070661_100289876 3300005344 Bacteria 1272
22 Ga0070661_100730120 3300005344 Unclassified 809
23 Ga0070661_101273512 3300005344 Unclassified 616
24 Ga0070668_100347110 3300005347 Bacteria 1255
25 Ga0070675_100074237 3300005354 Bacteria 2825
26 Ga0070673_100138140 3300005364 Bacteria 2053
27 Ga0070688_100606648 3300005365 Bacteria 838
28 Ga0070659_100027419 3300005366 Bacteria 4389
29 Ga0070659_100027609 3300005366 Bacteria 4376
30 Ga0070659_100437803 3300005366 Unclassified 1107
31 Ga0070659_102160572 3300005366 Unclassified 501
32 Ga0070667_100043424 3300005367 Bacteria 3773
33 Ga0070709_10074290 3300005434 Bacteria 2203
34 Ga0070709_10240932 3300005434 Unclassified 1299
35 Ga0070714_100016706 3300005435 Bacteria 5933
36 Ga0070714_100018479 3300005435 Bacteria 5663
37 Ga0070714_100091382 3300005435 Bacteria 2667
38 Ga0070714_100551728 3300005435 Unclassified 1103
39 Ga0070713_100000442 3300005436 Bacteria 26498
40 Ga0070713_100049952 3300005436 Plasmid 3453
41 Ga0070713_100218376 3300005436 Unclassified 1729
42 Ga0070713_100489869 3300005436 Unclassified 1159
43 Ga0070713_100687579 3300005436 Bacteria 976
44 Ga0070713_101078419 3300005436 Unclassified 776
45 Ga0070713_101403893 3300005436 Bacteria 677
46 Ga0070710_10038252 3300005437 Bacteria 2634
47 Ga0070710_10042607 3300005437 Bacteria 2511
48 Ga0070710_10074960 3300005437 Unclassified 1959
49 Ga0070710_10615813 3300005437 Unclassified 757
50 Ga0070711_100011992 3300005439 Bacteria 5399
51 Ga0070711_100164006 3300005439 Unclassified 1687
52 Ga0070711_100463306 3300005439 Bacteria 1039
53 Ga0070705_100285962 3300005440 Bacteria 1175
54 Ga0070705_100831355 3300005440 Unclassified 737
55 Ga0070694_100687126 3300005444 Bacteria 831
56 Ga0070708_100029368 3300005445 Bacteria 4741
57 Ga0070708_100051011 3300005445 Bacteria 3665
58 Ga0070708_100554293 3300005445 Bacteria 1084
59 Ga0070708_100840789 3300005445 Bacteria 862
60 Ga0070708_100953837 3300005445 Bacteria 805
61 Ga0070708_101661630 3300005445 Unclassified 594
62 Ga0070708_101837183 3300005445 Unclassified 562
63 Ga0070678_100912872 3300005456 Bacteria 803
64 Ga0070678_101193405 3300005456 Unclassified 705
65 Ga0070678_101356973 3300005456 Bacteria 663
66 Ga0070681_10017399 3300005458 Bacteria 7184
67 Ga0070681_10040972 3300005458 Bacteria 4640
68 Ga0070681_10124471 3300005458 Bacteria 2511
69 Ga0070681_10217021 3300005458 Bacteria 1828
70 Ga0070681_10357559 3300005458 Bacteria 1370
71 Ga0070681_10869929 3300005458 Unclassified 819
72 Ga0068867_100014039 3300005459 Bacteria 5674
73 Ga0068867_100065104 3300005459 Bacteria 2712
74 Ga0068867_101279304 3300005459 Bacteria 676
75 Ga0070706_100030200 3300005467 Bacteria 4992
76 Ga0070706_100764144 3300005467 Bacteria 895
77 Ga0070706_100903580 3300005467 Bacteria 816
78 Ga0070707_100026849 3300005468 Bacteria 5471
79 Ga0070707_100219347 3300005468 Bacteria 1853
80 Ga0070707_100336510 3300005468 Bacteria 1467
81 Ga0070707_100713878 3300005468 Bacteria 965
82 Ga0070707_100893429 3300005468 Bacteria 853
83 Ga0070698_100220888 3300005471 Bacteria 1828
84 Ga0070698_101127260 3300005471 Bacteria 733
85 Ga0070699_100020359 3300005518 Bacteria 5722
86 Ga0070699_100099460 3300005518 Bacteria 2549
87 Ga0070679_100044393 3300005530 Bacteria 4428
88 Ga0070679_100064064 3300005530 Bacteria 3663
89 Ga0070679_100475327 3300005530 Bacteria 1194
90 Ga0070679_100476535 3300005530 Bacteria 1192
91 Ga0070679_101080353 3300005530 Unclassified 747
92 Ga0070679_101362109 3300005530 Bacteria 655
93 Ga0070679_101562226 3300005530 Unclassified 607
94 Ga0070684_100063847 3300005535 Bacteria 3229
95 Ga0070684_100078087 3300005535 Bacteria 2924
96 Ga0070684_100249738 3300005535 Bacteria 1621
97 Ga0070684_100449837 3300005535 Bacteria 1190
98 Ga0070697_100021516 3300005536 Bacteria 5110
99 Ga0070697_101735891 3300005536 Unclassified 558
100 Ga0068853_100034312 3300005539 Bacteria 4307
101 Ga0068853_100289835 3300005539 Bacteria 1511
102 Ga0068853_100350912 3300005539 Bacteria 1372
103 Ga0068853_100678418 3300005539 Archaea 982
104 Ga0070672_100149102 3300005543 Bacteria 1934
105 Ga0070695_100310138 3300005545 Unclassified 1169
106 Ga0070695_100472129 3300005545 Bacteria 965
107 Ga0070693_101312816 3300005547 Bacteria 560
108 Ga0070665_100031090 3300005548 Bacteria 5373
109 Ga0070665_100036584 3300005548 Bacteria 4937
110 Ga0070665_100148815 3300005548 Bacteria 2344
111 Ga0070665_100431283 3300005548 Bacteria 1327
112 Ga0070665_100678888 3300005548 Unclassified 1043
113 Ga0070704_102228388 3300005549 Unclassified 509
114 Ga0068855_100002351 3300005563 Bacteria 23338
115 Ga0068855_100071998 3300005563 Bacteria 4018
116 Ga0068855_100228334 3300005563 Bacteria 2085
117 Ga0068855_100319183 3300005563 Bacteria 1717
118 Ga0068855_100474705 3300005563 Unclassified 1362
119 Ga0068855_100970121 3300005563 Unclassified 894
120 Ga0068855_102529176 3300005563 Bacteria 510
121 Ga0070664_100002308 3300005564 Bacteria 15323
122 Ga0070664_100032319 3300005564 Bacteria 4376
123 Ga0070664_100499123 3300005564 Unclassified 1121
124 Ga0070664_100927158 3300005564 Archaea 817
125 Ga0068857_100001625 3300005577 Bacteria 18054
126 Ga0068857_100009294 3300005577 Bacteria 8530
127 Ga0068857_100017654 3300005577 Bacteria 6256
128 Ga0068857_100017799 3300005577 Bacteria 6230
129 Ga0068857_100299249 3300005577 Bacteria 1483
130 Ga0068854_100000550 3300005578 Bacteria 22638
131 Ga0068854_100107531 3300005578 Bacteria 2100
132 Ga0068854_100813515 3300005578 Archaea 815
133 Ga0068856_100012294 3300005614 Bacteria 8289
134 Ga0068856_100020440 3300005614 Bacteria 6430
135 Ga0068856_100208256 3300005614 Bacteria 1970
136 Ga0068856_100210529 3300005614 Unclassified 1959
137 Ga0068856_100516595 3300005614 Unclassified 1215
138 Ga0068856_100622509 3300005614 Unclassified 1100
139 Ga0068856_101355646 3300005614 Bacteria 726
140 Ga0068856_102409072 3300005614 Unclassified 534
141 Ga0070702_100118126 3300005615 Bacteria 1656
142 Ga0068852_100014168 3300005616 Bacteria 6124
143 Ga0068852_101298438 3300005616 Unclassified 749
144 Ga0068852_102599165 3300005616 Unclassified 526
145 Ga0068859_100019717 3300005617 Bacteria 6772
146 Ga0068859_100149235 3300005617 Bacteria 2413
147 Ga0068859_100951382 3300005617 Unclassified 942
148 Ga0068864_100000254 3300005618 Bacteria 47729
149 Ga0068864_101111067 3300005618 Unclassified 787
150 Ga0068866_10002768 3300005718 Bacteria 7233
151 Ga0068866_10034683 3300005718 Bacteria 2459
152 Ga0068861_100302605 3300005719 Bacteria 1386
153 Ga0068851_10978202 3300005834 Unclassified 533
154 Ga0068863_100038545 3300005841 Bacteria 4547
155 Ga0068858_100008626 3300005842 Bacteria 9792
156 Ga0068858_100040847 3300005842 Bacteria 4303
157 Ga0068858_101591650 3300005842 Unclassified 645
158 Ga0068860_100030407 3300005843 Bacteria 5194
159 Ga0068860_100364616 3300005843 Bacteria 1424
160 Ga0068860_100501062 3300005843 Bacteria 1212
161 Ga0068860_100748227 3300005843 Unclassified 989
162 Ga0068860_101346582 3300005843 Bacteria 735
163 Ga0068862_102398101 3300005844 Unclassified 539
164 Ga0070717_10007014 3300006028 Bacteria 8339
165 Ga0070717_10027062 3300006028 Bacteria 4581
166 Ga0070717_10030846 3300006028 Bacteria 4308
167 Ga0070717_10137584 3300006028 Bacteria 2104
168 Ga0070717_10144510 3300006028 Unclassified 2054
169 Ga0070717_10332521 3300006028 Bacteria 1355
170 Ga0070717_10793686 3300006028 Unclassified 861
171 Ga0070717_10995017 3300006028 Bacteria 764
172 Ga0070717_11067185 3300006028 Unclassified 736
173 Ga0070717_11198346 3300006028 Unclassified 691
174 Ga0070717_12133576 3300006028 Unclassified 504
175 Ga0070715_10001048 3300006163 Bacteria 7808
176 Ga0070715_10421996 3300006163 Unclassified 746
177 Ga0070716_100004491 3300006173 Bacteria 6676
178 Ga0070712_100000284 3300006175 Bacteria 28610
179 Ga0070712_100341313 3300006175 Bacteria 1223
180 Ga0070712_100639590 3300006175 Unclassified 903
181 Ga0070712_100894110 3300006175 Unclassified 765
182 Ga0097621_100007110 3300006237 Bacteria 7980
183 Ga0097621_100020116 3300006237 Bacteria 5140
184 Ga0097621_100039367 3300006237 Bacteria 3797
185 Ga0097621_100095177 3300006237 Bacteria 2497
186 Ga0097621_100289518 3300006237 Unclassified 1444
187 Ga0097621_100295478 3300006237 Unclassified 1429
188 Ga0097621_100443815 3300006237 Bacteria 1168
189 Ga0097621_100448768 3300006237 Bacteria 1162
190 Ga0097621_100482910 3300006237 Bacteria 1120
191 Ga0068871_100010030 3300006358 Bacteria 6887
192 Ga0068871_100013601 3300006358 Bacteria 6043
193 Ga0068871_100034909 3300006358 Bacteria 3994
194 Ga0068871_100123609 3300006358 Bacteria 2188
195 Ga0068871_100715884 3300006358 Bacteria 918
196 Ga0068871_100785617 3300006358 Unclassified 877
197 Ga0068871_101894123 3300006358 Unclassified 567
198 Ga0068871_102053230 3300006358 Unclassified 544
199 Ga0068871_102106200 3300006358 Bacteria 537
200 Ga0075431_101353023 3300006847 Bacteria 672
201 Ga0075433_10550598 3300006852 Unclassified 1014
202 Ga0075434_100005411 3300006871 Bacteria 11618
203 Ga0068865_100002578 3300006881 Bacteria 10756
204 Ga0068865_100083878 3300006881 Bacteria 2295
205 Ga0068865_100452674 3300006881 Bacteria 1062
206 Ga0068865_100772114 3300006881 Bacteria 827
207 Ga0075436_100039741 3300006914 Bacteria 3246
208 Ga0075436_100281517 3300006914 Unclassified 1189
209 Ga0097620_100019718 3300006931 Bacteria 6772
210 Ga0097620_100149240 3300006931 Bacteria 2413
211 Ga0097620_100951363 3300006931 Unclassified 942
212 Ga0075435_100278980 3300007076 Unclassified 1426
213 Ga0105240_10076808 3300009093 Plasmid 4116
214 Ga0105240_10259598 3300009093 Bacteria 2005
215 Ga0105240_10465872 3300009093 Bacteria 1411
216 Ga0105240_10625084 3300009093 Bacteria 1183
217 Ga0105240_10627410 3300009093 Bacteria 1180
218 Ga0105240_10758786 3300009093 Unclassified 1054
219 Ga0105240_11210389 3300009093 Unclassified 799
220 Ga0105240_11442731 3300009093 Bacteria 723
221 Ga0105240_11469862 3300009093 Unclassified 715
222 Ga0111539_11802959 3300009094 Unclassified 710
223 Ga0105245_10011028 3300009098 Bacteria 7866
224 Ga0105245_10017355 3300009098 Bacteria 6279
225 Ga0105245_10091863 3300009098 Bacteria 2794
226 Ga0105245_10362579 3300009098 Archaea 1438
227 Ga0105245_10817623 3300009098 Bacteria 970
228 Ga0105245_11119170 3300009098 Unclassified 834
229 Ga0105245_11382564 3300009098 Bacteria 754
230 Ga0105243_11402929 3300009148 Bacteria 719
231 Ga0105241_10008917 3300009174 Bacteria 7373
232 Ga0105241_10113823 3300009174 Bacteria 2169
233 Ga0105241_10242262 3300009174 Bacteria 1525
234 Ga0105241_10388839 3300009174 Bacteria 1221
235 Ga0105241_10439830 3300009174 Unclassified 1151
236 Ga0105241_10625054 3300009174 Unclassified 975
237 Ga0105241_10822327 3300009174 Unclassified 857
238 Ga0105241_11322356 3300009174 Unclassified 687
239 Ga0105242_10010190 3300009176 Bacteria 7201
240 Ga0105242_10053036 3300009176 Bacteria 3310
241 Ga0105242_10110145 3300009176 Bacteria 2345
242 Ga0105242_10195919 3300009176 Unclassified 1792
243 Ga0105242_10208502 3300009176 Unclassified 1740
244 Ga0105242_10238308 3300009176 Bacteria 1634
245 Ga0105242_10948377 3300009176 Bacteria 864
246 Ga0105242_11905767 3300009176 Unclassified 635
247 Ga0105248_10013796 3300009177 Bacteria 8893
248 Ga0105248_10059685 3300009177 Bacteria 4285
249 Ga0105248_10356946 3300009177 Bacteria 1646
250 Ga0105248_11366544 3300009177 Bacteria 801
251 Ga0105237_10025507 3300009545 Bacteria 6046
252 Ga0105237_10027372 3300009545 Bacteria 5820
253 Ga0105237_10065137 3300009545 Bacteria 3640
254 Ga0105237_10074855 3300009545 Unclassified 3378
255 Ga0105237_10376230 3300009545 Bacteria 1425
256 Ga0105237_10380322 3300009545 Unclassified 1417
257 Ga0105237_10583079 3300009545 Unclassified 1125
258 Ga0105237_10944154 3300009545 Unclassified 869
259 Ga0105237_11033942 3300009545 Unclassified 828
260 Ga0105237_11978616 3300009545 Unclassified 591
261 Ga0105238_10003228 3300009551 Bacteria 16291
262 Ga0105238_10018824 3300009551 Bacteria 7029
263 Ga0105238_10088384 3300009551 Bacteria 3085
264 Ga0105238_10167710 3300009551 Bacteria 2172
265 Ga0105238_10168302 3300009551 Bacteria 2168
266 Ga0105238_10299853 3300009551 Bacteria 1590
267 Ga0105238_10556495 3300009551 Unclassified 1152
268 Ga0105238_10746944 3300009551 Bacteria 992
269 Ga0105249_11318991 3300009553 Bacteria 793
270 Ga0105239_10009183 3300010375 Bacteria 11181
271 Ga0105239_10027061 3300010375 Bacteria 6313
272 Ga0105239_10147659 3300010375 Bacteria 2623
273 Ga0105239_10226706 3300010375 Bacteria 2096
274 Ga0105239_10227980 3300010375 Unclassified 2090
275 Ga0105239_10381904 3300010375 Bacteria 1593
276 Ga0105239_11716092 3300010375 Bacteria 727
277 Ga0105239_12277922 3300010375 Unclassified 630
278 Ga0105246_10132961 3300011119 Bacteria 1861
279 Ga0105246_10315388 3300011119 Unclassified 1268
280 Ga0105246_10634397 3300011119 Bacteria 928
281 Ga0157373_10043557 3300013100 Bacteria 3206
282 Ga0157373_10181387 3300013100 Bacteria 1482
283 Ga0157373_10386962 3300013100 Bacteria 1001
284 Ga0157373_11453867 3300013100 Unclassified 522
285 Ga0157371_10114140 3300013102 Bacteria 1918
286 Ga0157370_10202492 3300013104 Bacteria 1841
287 Ga0157370_10295190 3300013104 Bacteria 1497
288 Ga0157370_10481625 3300013104 Unclassified 1140
289 Ga0157370_10778484 3300013104 Unclassified 871
290 Ga0157370_11940508 3300013104 Unclassified 528
291 Ga0157369_10135547 3300013105 Bacteria 2607
292 Ga0157369_10211676 3300013105 Bacteria 2031
293 Ga0157369_10213815 3300013105 Bacteria 2020
294 Ga0157369_11070884 3300013105 Unclassified 824
295 Ga0157369_11301759 3300013105 Bacteria 741
296 Ga0157374_10000623 3300013296 Bacteria 31137
297 Ga0157374_10014478 3300013296 Bacteria 6902
298 Ga0157374_10401862 3300013296 Unclassified 1367
299 Ga0157374_10519896 3300013296 Unclassified 1196
300 Ga0157378_10000217 3300013297 Bacteria 55710
301 Ga0157378_10043628 3300013297 Bacteria 3982
302 Ga0157378_10245971 3300013297 Bacteria 1710
303 Ga0157378_10246598 3300013297 Unclassified 1708
304 Ga0157378_10628435 3300013297 Bacteria 1088
305 Ga0157378_10654888 3300013297 Unclassified 1066
306 Ga0157378_11273735 3300013297 Unclassified 776
307 Ga0157378_11468052 3300013297 Unclassified 726
308 Ga0163162_10029610 3300013306 Bacteria 5419
309 Ga0163162_10056432 3300013306 Bacteria 3955
310 Ga0163162_10102308 3300013306 Unclassified 2958
311 Ga0163162_11358051 3300013306 Bacteria 808
312 Ga0163162_12069787 3300013306 Unclassified 653
313 Ga0157372_10001157 3300013307 Bacteria 28525
314 Ga0157372_10016198 3300013307 Bacteria 7998
315 Ga0157372_10034062 3300013307 Bacteria 5596
316 Ga0157372_10182241 3300013307 Bacteria 2431
317 Ga0157372_10212186 3300013307 Bacteria 2244
318 Ga0157372_10299874 3300013307 Unclassified 1869
319 Ga0157372_10306503 3300013307 Bacteria 1848
320 Ga0157372_10354734 3300013307 Unclassified 1709
321 Ga0157372_11380829 3300013307 Unclassified 812
322 Ga0157372_12032048 3300013307 Unclassified 660
323 Ga0157372_12203935 3300013307 Unclassified 633
324 Ga0157375_11271556 3300013308 Unclassified 864
325 Ga0163163_10035576 3300014325 Bacteria 4832
326 Ga0163163_10493854 3300014325 Bacteria 1286
327 Ga0163163_10699046 3300014325 Bacteria 1077
328 Ga0163163_11615594 3300014325 Bacteria 709
329 Ga0163163_12377630 3300014325 Unclassified 588
330 Ga0157377_10078427 3300014745 Bacteria 1925
331 Ga0157376_10025238 3300014969 Bacteria 4679
332 Ga0157376_11001275 3300014969 Bacteria 858
333 Ga0157376_12239593 3300014969 Bacteria 585
334 Ga0157376_12388023 3300014969 Unclassified 568
335 Ga0213873_10041902 3300021358 Unclassified 1182
336 Ga0213874_10057501 3300021377 Bacteria 1210
337 Ga0213875_10081610 3300021388 Bacteria 1508
338 Ga0213875_10670822 3300021388 Bacteria 503
339 Ga0207656_10236796 3300025321 Bacteria 891
340 Ga0207692_10056007 3300025898 Bacteria 2021
341 Ga0207692_10124495 3300025898 Unclassified 1448
342 Ga0207642_10047698 3300025899 Bacteria 1916
343 Ga0207642_10050242 3300025899 Bacteria 1880
344 Ga0207647_10047576 3300025904 Bacteria 2667
345 Ga0207647_10341482 3300025904 Bacteria 849
346 Ga0207685_10000448 3300025905 Bacteria 6876
347 Ga0207699_10246559 3300025906 Bacteria 1229
348 Ga0207699_10268892 3300025906 Bacteria 1181
349 Ga0207699_10346453 3300025906 Unclassified 1048
350 Ga0207645_10280625 3300025907 Bacteria 1106
351 Ga0207705_10214797 3300025909 Bacteria 1459
352 Ga0207684_10009193 3300025910 Bacteria 8741
353 Ga0207684_10708183 3300025910 Bacteria 855
354 Ga0207654_10071561 3300025911 Bacteria 2062
355 Ga0207654_10258359 3300025911 Bacteria 1170
356 Ga0207654_11107052 3300025911 Unclassified 577
357 Ga0207707_10009951 3300025912 Bacteria 8246
358 Ga0207707_10013326 3300025912 Bacteria 7166
359 Ga0207707_10175973 3300025912 Bacteria 1869
360 Ga0207707_10692770 3300025912 Archaea 856
361 Ga0207707_10936347 3300025912 Unclassified 714
362 Ga0207695_10010580 3300025913 Bacteria 11277
363 Ga0207695_10028548 3300025913 Bacteria 6184
364 Ga0207695_10058596 3300025913 Plasmid 3997
365 Ga0207695_10130146 3300025913 Bacteria 2475
366 Ga0207695_10225422 3300025913 Unclassified 1781
367 Ga0207695_10621039 3300025913 Unclassified 962
368 Ga0207695_11138730 3300025913 Unclassified 660
369 Ga0207695_11405328 3300025913 Unclassified 578
370 Ga0207671_10060624 3300025914 Bacteria 2807
371 Ga0207671_10212739 3300025914 Bacteria 1513
372 Ga0207671_10469652 3300025914 Unclassified 1002
373 Ga0207671_10618316 3300025914 Unclassified 863
374 Ga0207671_10692228 3300025914 Bacteria 811
375 Ga0207693_10000038 3300025915 Bacteria 109225
376 Ga0207693_10542464 3300025915 Unclassified 907
377 Ga0207663_10000445 3300025916 Bacteria 17932
378 Ga0207663_10463694 3300025916 Bacteria 979
379 Ga0207663_11549430 3300025916 Unclassified 533
380 Ga0207660_10481556 3300025917 Bacteria 1006
381 Ga0207660_11042990 3300025917 Unclassified 667
382 Ga0207657_10282475 3300025919 Bacteria 1317
383 Ga0207657_10943993 3300025919 Bacteria 663
384 Ga0207657_10963403 3300025919 Unclassified 655
385 Ga0207649_10103521 3300025920 Bacteria 1889
386 Ga0207649_10301361 3300025920 Bacteria 1172
387 Ga0207649_11192634 3300025920 Unclassified 601
388 Ga0207652_10041168 3300025921 Bacteria 3926
389 Ga0207652_10091447 3300025921 Unclassified 2676
390 Ga0207652_10230846 3300025921 Bacteria 1668
391 Ga0207652_11262756 3300025921 Unclassified 641
392 Ga0207646_10003637 3300025922 Bacteria 17242
393 Ga0207646_10170975 3300025922 Bacteria 1962
394 Ga0207646_10302474 3300025922 Bacteria 1445
395 Ga0207646_10331749 3300025922 Bacteria 1374
396 Ga0207646_10916682 3300025922 Bacteria 777
397 Ga0207694_10054836 3300025924 Bacteria 3094
398 Ga0207694_10101130 3300025924 Bacteria 2284
399 Ga0207694_10171115 3300025924 Bacteria 1759
400 Ga0207694_10454459 3300025924 Unclassified 1069
401 Ga0207694_10741720 3300025924 Unclassified 829
402 Ga0207659_11907120 3300025926 Bacteria 503
403 Ga0207687_10010819 3300025927 Bacteria 5963
404 Ga0207687_10067701 3300025927 Bacteria 2541
405 Ga0207687_10327913 3300025927 Unclassified 1241
406 Ga0207687_10340170 3300025927 Bacteria 1220
407 Ga0207687_10876735 3300025927 Unclassified 767
408 Ga0207687_11681716 3300025927 Unclassified 544
409 Ga0207700_10013866 3300025928 Bacteria 5263
410 Ga0207700_10026719 3300025928 Bacteria 4029
411 Ga0207700_10042606 3300025928 Plasmid 3329
412 Ga0207700_10128601 3300025928 Unclassified 2065
413 Ga0207700_10589345 3300025928 Bacteria 989
414 Ga0207700_11323385 3300025928 Unclassified 642
415 Ga0207700_11356207 3300025928 Bacteria 633
416 Ga0207664_10010919 3300025929 Bacteria 6432
417 Ga0207664_10039862 3300025929 Bacteria 3648
418 Ga0207664_10291058 3300025929 Unclassified 1435
419 Ga0207664_10444997 3300025929 Unclassified 1156
420 Ga0207690_10063398 3300025932 Bacteria 2520
421 Ga0207690_10897882 3300025932 Unclassified 735
422 Ga0207690_10965163 3300025932 Bacteria 708
423 Ga0207690_10970591 3300025932 Unclassified 706
424 Ga0207706_10082985 3300025933 Bacteria 2817
425 Ga0207706_11390545 3300025933 Unclassified 577
426 Ga0207686_10022758 3300025934 Bacteria 3612
427 Ga0207686_10035947 3300025934 Unclassified 2977
428 Ga0207686_10097331 3300025934 Bacteria 1957
429 Ga0207686_10167876 3300025934 Bacteria 1545
430 Ga0207686_10442897 3300025934 Bacteria 998
431 Ga0207686_10647161 3300025934 Bacteria 836
432 Ga0207686_11464945 3300025934 Unclassified 562
433 Ga0207709_10153194 3300025935 Unclassified 1599
434 Ga0207709_11735119 3300025935 Bacteria 519
435 Ga0207704_10398093 3300025938 Bacteria 1086
436 Ga0207704_11918911 3300025938 Unclassified 509
437 Ga0207665_10003824 3300025939 Bacteria 10060
438 Ga0207665_10065768 3300025939 Bacteria 2466
439 Ga0207665_10087981 3300025939 Unclassified 2148
440 Ga0207665_10673484 3300025939 Unclassified 812
441 Ga0207691_11531844 3300025940 Bacteria 544
442 Ga0207711_10027274 3300025941 Bacteria 4797
443 Ga0207711_10310864 3300025941 Bacteria 1455
444 Ga0207711_10433695 3300025941 Unclassified 1223
445 Ga0207689_10011972 3300025942 Bacteria 7435
446 Ga0207661_10074157 3300025944 Bacteria 2789
447 Ga0207661_10174234 3300025944 Bacteria 1874
448 Ga0207661_10209225 3300025944 Bacteria 1718
449 Ga0207661_10396357 3300025944 Bacteria 1251
450 Ga0207679_10005250 3300025945 Bacteria 8119
451 Ga0207679_10976622 3300025945 Unclassified 776
452 Ga0207679_11357273 3300025945 Bacteria 652
453 Ga0207667_10005709 3300025949 Bacteria 15179
454 Ga0207667_10184517 3300025949 Bacteria 2142
455 Ga0207667_10190325 3300025949 Bacteria 2105
456 Ga0207667_10385912 3300025949 Unclassified 1427
457 Ga0207667_10737712 3300025949 Unclassified 985
458 Ga0207667_10918413 3300025949 Unclassified 866
459 Ga0207667_11171767 3300025949 Unclassified 749
460 Ga0207651_10495988 3300025960 Bacteria 1055
461 Ga0207712_10874758 3300025961 Bacteria 793
462 Ga0207668_10644339 3300025972 Unclassified 927
463 Ga0207640_10003176 3300025981 Bacteria 8848
464 Ga0207658_10229592 3300025986 Bacteria 1566
465 Ga0207677_10009222 3300026023 Bacteria 5542
466 Ga0207677_10083528 3300026023 Bacteria 2299
467 Ga0207703_10011649 3300026035 Bacteria 6839
468 Ga0207703_10609417 3300026035 Bacteria 1033
469 Ga0207703_11473114 3300026035 Unclassified 655
470 Ga0207639_10572421 3300026041 Unclassified 1039
471 Ga0207639_11685758 3300026041 Bacteria 594
472 Ga0207639_12074888 3300026041 Bacteria 530
473 Ga0207702_10037217 3300026078 Bacteria 4072
474 Ga0207702_10269803 3300026078 Bacteria 1604
475 Ga0207702_10313003 3300026078 Unclassified 1493
476 Ga0207702_10336646 3300026078 Unclassified 1441
477 Ga0207702_10946513 3300026078 Unclassified 854
478 Ga0207702_11124948 3300026078 Archaea 779
479 Ga0207641_11103024 3300026088 Bacteria 792
480 Ga0207641_11222269 3300026088 Unclassified 751
481 Ga0207648_10012998 3300026089 Bacteria 7767
482 Ga0207648_10102624 3300026089 Bacteria 2507
483 Ga0207676_10028737 3300026095 Bacteria 4157
484 Ga0207676_11021215 3300026095 Unclassified 815
485 Ga0207674_10000257 3300026116 Bacteria 66462
486 Ga0207674_10042637 3300026116 Bacteria 4684
487 Ga0207674_10045452 3300026116 Bacteria 4517
488 Ga0207674_10050783 3300026116 Bacteria 4235
489 Ga0207674_10122853 3300026116 Bacteria 2562
490 Ga0207675_100430899 3300026118 Bacteria 1304
491 Ga0207683_10227717 3300026121 Bacteria 1699
492 Ga0207683_10365165 3300026121 Bacteria 1326
493 Ga0207683_11500205 3300026121 Unclassified 622
494 Ga0207698_10415064 3300026142 Bacteria 1290
495 Ga0207698_10502181 3300026142 Unclassified 1180
496 Ga0207428_11085072 3300027907 Bacteria 560
497 Ga0265357_1025794 3300028023 Unclassified 659
498 Ga0268266_10002897 3300028379 Bacteria 17780
499 Ga0268266_10099235 3300028379 Bacteria 2563
500 Ga0268266_10242658 3300028379 Unclassified 1663
501 Ga0268266_10607042 3300028379 Unclassified 1051
502 Ga0268266_11985222 3300028379 Bacteria 555
503 Ga0268266_12275162 3300028379 Bacteria 514
504 Ga0268264_10551288 3300028381 Bacteria 1131
505 Ga0268264_10837193 3300028381 Bacteria 921
506 Ga0268264_10940444 3300028381 Unclassified 869
507 Ga0268264_11617293 3300028381 Unclassified 658
508 Ga0265338_10015795 3300028800 Bacteria 8267
509 Ga0265338_10314876 3300028800 Unclassified 1134
510 Ga0265324_10071639 3300029957 Unclassified 1181
511 Ga0265762_1000835 3300030760 Bacteria 5469
512 Ga0265762_1015837 3300030760 Bacteria 1365
513 Ga0265760_10003536 3300031090 Bacteria 4535
514 Ga0265760_10151697 3300031090 Bacteria 760
515 Ga0265760_10180275 3300031090 Unclassified 705
516 Ga0265332_10355274 3300031238 Unclassified 605
517 Ga0265325_10157650 3300031241 Bacteria 1070
518 Ga0265340_10064148 3300031247 Bacteria 1752
519 Ga0265340_10488634 3300031247 Unclassified 542
520 Ga0265340_10559492 3300031247 Unclassified 503
521 Ga0265339_10031642 3300031249 Unclassified 2988
522 Ga0265339_10084081 3300031249 Bacteria 1678
523 Ga0265331_10384131 3300031250 Unclassified 629
524 Ga0265316_10003152 3300031344 Bacteria 16788
525 Ga0265316_11057881 3300031344 Unclassified 564
526 Ga0265313_10024891 3300031595 Unclassified 3185
527 Ga0265314_10001555 3300031711 Bacteria 25292
528 Ga0265314_10072115 3300031711 Bacteria 2308
529 Ga0265314_10197520 3300031711 Bacteria 1192
530 Ga0265314_10704304 3300031711 Unclassified 510
531 Ga0307516_10003420 3300031730 Bacteria 20401
532 Ga0307413_11376731 3300031824 Unclassified 620
533 Ga0307409_101176570 3300031995 Unclassified 790
534 Ga0373926_0273403 3300035083 Unclassified 657
535 Ga0373936_0119123 3300035113 Bacteria 1126
536 Ga0373941_0380671 3300035115 Bacteria 580
537 Ga0373945_0034297 3300035116 Bacteria 1808
538 Ga0373960_0131559 3300035121 Bacteria 840
539 Ga0373943_0158856 3300035170 Bacteria 1229
540 Ga0373946_0198704 3300035171 Bacteria 959
541 Ga0373935_0090979 3300035692 Bacteria 1998
542 Ga0373935_0378526 3300035692 Unclassified 1013
543 Ga0373927_0294475 3300035695 Bacteria 1068
544 Ga0373947_0119034 3300035725 Bacteria 1676
545 Ga0373947_0220747 3300035725 Bacteria 1246
546 Ga0373937_0126692 3300036401 Unclassified 2383
547 Ga0373925_0001347 3300037068 Bacteria 21411
548 Ga0373925_0017618 3300037068 Bacteria 5182
549 Ga0373925_1353511 3300037068 Bacteria 584
550 Ga0395899_0103624 3300037312 Bacteria 2052
551 Ga0395900_0011767 3300037418 Bacteria 8947
552 Ga0436364_0196890 3300037853 Unclassified 1272
553 Ga0436364_0619394 3300037853 Bacteria 504
554 Ga0436364_0752135 3300037853 Bacteria 2048
555 Ga0436364_0818917 3300037853 Unclassified 543
556 Ga0436364_1148362 3300037853 Bacteria 1306
557 Ga0395901_0002017 3300038443 Bacteria 20892
558 Ga0436365_0535589 3300039437 Bacteria 1509
559 Ga0436360_0193073 3300039438 Bacteria 1694
560 Ga0436361_0410353 3300039447 Bacteria 1065
561 Ga0436363_1167321 3300039450 Unclassified 602
562 Ga0436363_1325016 3300039450 Bacteria 5069
563 Ga0436362_0461317 3300039453 Unclassified 1643
564 Ga0436362_0554361 3300039453 Bacteria 1219
565 Ga0439439_0129405 3300041406 Unclassified 708
566 Ga0466961_0011063 3300044693 Bacteria 5767
567 Ga0466963_0175031 3300044694 Unclassified 1497
568 Ga0466963_0281212 3300044694 Unclassified 1169
569 Ga0466964_0239003 3300044706 Unclassified 890
570 Ga0466971_0087345 3300044719 Bacteria 1426
571 Ga0466970_0348604 3300044765 Bacteria 840
572 Ga0466958_0214639 3300045836 Unclassified 1227
573 Ga0466958_0458552 3300045836 Unclassified 826
574 Ga0466967_0001421 3300045976 Bacteria 13862
575 Ga0466967_0430875 3300045976 Bacteria 1286
576 Ga0495629_0118858 3300046459 Bacteria 1841
577 Ga0495653_0261535 3300046463 Unclassified 1144
578 Ga0495580_0000798 3300046472 Bacteria 27239
579 Ga0495580_0543819 3300046472 Bacteria 772
580 Ga0495580_0619788 3300046472 Unclassified 714
581 Ga0495580_1105985 3300046472 Bacteria 501
582 Ga0495582_0024473 3300046473 Bacteria 3304
583 Ga0495594_0377887 3300046499 Bacteria 806
584 Ga0495623_0260879 3300046679 Unclassified 971
585 Ga0495658_0106168 3300046683 Bacteria 1683
586 Ga0495669_0137851 3300046684 Unclassified 1151
587 Ga0495581_0248192 3300047315 Bacteria 1041
588 Ga0495684_0406906 3300047471 Unclassified 954
589 Ga0495593_0233808 3300047673 Bacteria 921
590 Ga0495602_0707789 3300048088 Unclassified 683
591 Ga0496100_0067036 3300048903 Bacteria 2383
592 Ga0496102_1232163 3300048905 Unclassified 668
593 Ga0496102_1664110 3300048905 Archaea 556
594 Ga0496104_0066133 3300048907 Bacteria 3432
595 Ga0496104_0072229 3300048907 Bacteria 3281
596 Ga0496110_1733965 3300048913 Bacteria 535
597 Ga0496112_1618076 3300048915 Unclassified 561
598 Ga0496114_0684998 3300048917 Bacteria 900
599 Ga0496115_0034645 3300048918 Bacteria 3990
600 Ga0501031_0062891 3300049568 Bacteria 2418
601 Ga0501032_0041923 3300049569 Bacteria 3106
602 Ga0501032_0138183 3300049569 Bacteria 1605
603 Ga0501032_0158509 3300049569 Bacteria 1486
604 Ga0501032_0388158 3300049569 Unclassified 897
605 Ga0501033_0040142 3300049570 Bacteria 3494
606 Ga0501033_0090141 3300049570 Bacteria 2243
607 Ga0501033_0198553 3300049570 Bacteria 1433
608 Ga0501033_0242516 3300049570 Unclassified 1278
609 Ga0501033_0594288 3300049570 Bacteria 759
610 Ga0501034_0000778 3300049571 Bacteria 47744
611 Ga0501034_0085510 3300049571 Bacteria 3155
612 Ga0501034_0185782 3300049571 Bacteria 2042
613 Ga0501034_0233221 3300049571 Bacteria 1789
614 Ga0501036_0008377 3300049572 Bacteria 8475
615 Ga0501036_0195775 3300049572 Bacteria 1700
616 Ga0501036_0386102 3300049572 Unclassified 1168
617 Ga0501037_0004949 3300049573 Bacteria 9689
618 Ga0501037_0301753 3300049573 Bacteria 1112
619 Ga0501037_0322924 3300049573 Bacteria 1068
620 Ga0501037_0904404 3300049573 Unclassified 578
621 Ga0501038_0152306 3300049574 Bacteria 1884
622 Ga0501038_0439908 3300049574 Bacteria 1004
623 Ga0501039_0164309 3300049575 Bacteria 1745
624 Ga0501039_0656785 3300049575 Bacteria 821
625 Ga0501040_0180109 3300049576 Bacteria 1498
626 Ga0501043_0125140 3300049579 Bacteria 2015
627 Ga0501043_0152295 3300049579 Bacteria 1809
628 Ga0501043_0553222 3300049579 Bacteria 854
629 Ga0501046_0058561 3300049580 Bacteria 3019
630 Ga0501046_0302697 3300049580 Bacteria 1167
631 Ga0501047_0133728 3300049581 Bacteria 2360
632 Ga0501047_0140719 3300049581 Bacteria 2291
633 Ga0501047_0656246 3300049581 Bacteria 868
634 Ga0501048_0942009 3300049582 Unclassified 621
635 Ga0501070_0084865 3300049586 Bacteria 2622
636 Ga0501257_000588 3300049686 Bacteria 7187
637 Ga0501035_0000386 3300049822 Bacteria 50709
638 Ga0501035_0350821 3300049822 Bacteria 1234
639 Ga0501035_0387735 3300049822 Unclassified 1164
640 Ga0501044_0004473 3300049823 Bacteria 15631
641 Ga0501044_0129884 3300049823 Bacteria 2514
642 Ga0501044_0166866 3300049823 Bacteria 2175
643 Ga0501044_0171915 3300049823 Bacteria 2138
644 Ga0501044_0381224 3300049823 Unclassified 1325
645 Ga0501044_0588185 3300049823 Bacteria 1007
646 Ga0501044_1058709 3300049823 Unclassified 681
647 nmdc:mga06r32_1509110_c1 3300050510 Bacteria 612
648 nmdc:mga08y16_1439571_c1 3300050511 Bacteria 651
649 nmdc:mga0n895_4119_c1 3300050512 Bacteria 11850
650 nmdc:mga0rr50_199678_c1 3300050513 Unclassified 1643
651 nmdc:mga08x19_1278777_c1 3300050514 Unclassified 520
652 nmdc:mga08x19_28256_c1 3300050514 Bacteria 3512
653 nmdc:mga08x19_93699_c1 3300050514 Unclassified 1985
654 nmdc:mga0a205_418568_c1 3300050515 Unclassified 1202
655 Ga0500595_043391 3300053119 Bacteria 1432
656 Ga0500568_0387741 3300053139 Bacteria 506
657 Ga0500616_0043063 3300053153 Bacteria 2414

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_101403893 Ga0070713_1014038931 74
2 3300005437 Ga0070710_10615813 Ga0070710_106158132 74
3 3300005439 Ga0070711_100463306 Ga0070711_1004633062 74
4 3300025916 Ga0207663_10463694 Ga0207663_104636942 74
5 3300025928 Ga0207700_11356207 Ga0207700_113562072 74
6 3300005327 Ga0070658_10914189 Ga0070658_109141892 75
7 3300005328 Ga0070676_10290716 Ga0070676_102907162 75
8 3300005329 Ga0070683_100046315 Ga0070683_1000463154 75
9 3300005329 Ga0070683_100289932 Ga0070683_1002899322 75
10 3300005329 Ga0070683_100530195 Ga0070683_1005301951 75
11 3300005330 Ga0070690_100982218 Ga0070690_1009822182 75
12 3300005334 Ga0068869_100045007 Ga0068869_1000450072 75
13 3300005336 Ga0070680_101035862 Ga0070680_1010358622 75
14 3300005337 Ga0070682_100199002 Ga0070682_1001990022 75
15 3300005337 Ga0070682_101134394 Ga0070682_1011343942 75
16 3300005337 Ga0070682_101556405 Ga0070682_1015564052 75
17 3300005337 Ga0070682_101658180 Ga0070682_1016581802 75
18 3300005338 Ga0068868_100002894 Ga0068868_1000028944 75
19 3300005338 Ga0068868_100008897 Ga0068868_1000088972 75
20 3300005338 Ga0068868_100031351 Ga0068868_1000313512 75
21 3300005339 Ga0070660_100587429 Ga0070660_1005874292 75
22 3300005339 Ga0070660_100626889 Ga0070660_1006268892 75
23 3300005339 Ga0070660_100765003 Ga0070660_1007650032 75
24 3300005339 Ga0070660_100825399 Ga0070660_1008253991 75
25 3300005341 Ga0070691_10342842 Ga0070691_103428422 75
26 3300005344 Ga0070661_100289876 Ga0070661_1002898762 75
27 3300005344 Ga0070661_100730120 Ga0070661_1007301202 75
28 3300005344 Ga0070661_101273512 Ga0070661_1012735121 75
29 3300005347 Ga0070668_100347110 Ga0070668_1003471103 75
30 3300005354 Ga0070675_100074237 Ga0070675_1000742373 75
31 3300005364 Ga0070673_100138140 Ga0070673_1001381403 75
32 3300005365 Ga0070688_100606648 Ga0070688_1006066482 75
33 3300005366 Ga0070659_100027419 Ga0070659_1000274192 75
34 3300005366 Ga0070659_100027609 Ga0070659_1000276094 75
35 3300005366 Ga0070659_100437803 Ga0070659_1004378032 75
36 3300005366 Ga0070659_102160572 Ga0070659_1021605721 75
37 3300005367 Ga0070667_100043424 Ga0070667_1000434245 75
38 3300005434 Ga0070709_10074290 Ga0070709_100742904 75
39 3300005434 Ga0070709_10240932 Ga0070709_102409322 75
40 3300005435 Ga0070714_100016706 Ga0070714_1000167068 75
41 3300005435 Ga0070714_100018479 Ga0070714_1000184793 75
42 3300005435 Ga0070714_100091382 Ga0070714_1000913823 75
43 3300005435 Ga0070714_100551728 Ga0070714_1005517282 75
44 3300005436 Ga0070713_100000442 Ga0070713_1000004424 75
45 3300005436 Ga0070713_100049952 Ga0070713_1000499523 75
46 3300005436 Ga0070713_100218376 Ga0070713_1002183763 75
47 3300005436 Ga0070713_100489869 Ga0070713_1004898691 75
48 3300005436 Ga0070713_100687579 Ga0070713_1006875792 75
49 3300005436 Ga0070713_101078419 Ga0070713_1010784191 75
50 3300005437 Ga0070710_10038252 Ga0070710_100382524 75
51 3300005437 Ga0070710_10042607 Ga0070710_100426072 75
52 3300005437 Ga0070710_10074960 Ga0070710_100749602 75
53 3300005439 Ga0070711_100011992 Ga0070711_1000119923 75
54 3300005439 Ga0070711_100164006 Ga0070711_1001640063 75
55 3300005440 Ga0070705_100285962 Ga0070705_1002859623 75
56 3300005440 Ga0070705_100831355 Ga0070705_1008313551 75
57 3300005444 Ga0070694_100687126 Ga0070694_1006871262 75
58 3300005445 Ga0070708_100029368 Ga0070708_1000293687 75
59 3300005445 Ga0070708_100051011 Ga0070708_1000510113 75
60 3300005445 Ga0070708_100554293 Ga0070708_1005542933 75
61 3300005445 Ga0070708_100840789 Ga0070708_1008407891 75
62 3300005445 Ga0070708_100953837 Ga0070708_1009538372 75
63 3300005445 Ga0070708_101661630 Ga0070708_1016616302 75
64 3300005445 Ga0070708_101837183 Ga0070708_1018371832 75
65 3300005456 Ga0070678_100912872 Ga0070678_1009128721 75
66 3300005456 Ga0070678_101193405 Ga0070678_1011934052 75
67 3300005456 Ga0070678_101356973 Ga0070678_1013569732 75
68 3300005458 Ga0070681_10017399 Ga0070681_100173992 75
69 3300005458 Ga0070681_10040972 Ga0070681_100409723 75
70 3300005458 Ga0070681_10124471 Ga0070681_101244713 75
71 3300005458 Ga0070681_10217021 Ga0070681_102170214 75
72 3300005458 Ga0070681_10357559 Ga0070681_103575592 75
73 3300005458 Ga0070681_10869929 Ga0070681_108699291 75
74 3300005459 Ga0068867_100014039 Ga0068867_1000140394 75
75 3300005459 Ga0068867_100065104 Ga0068867_1000651043 75
76 3300005459 Ga0068867_101279304 Ga0068867_1012793042 75
77 3300005467 Ga0070706_100030200 Ga0070706_1000302001 75
78 3300005467 Ga0070706_100764144 Ga0070706_1007641441 75
79 3300005467 Ga0070706_100903580 Ga0070706_1009035801 75
80 3300005468 Ga0070707_100026849 Ga0070707_1000268491 75
81 3300005468 Ga0070707_100219347 Ga0070707_1002193472 75
82 3300005468 Ga0070707_100336510 Ga0070707_1003365101 75
83 3300005468 Ga0070707_100713878 Ga0070707_1007138783 75
84 3300005468 Ga0070707_100893429 Ga0070707_1008934292 75
85 3300005471 Ga0070698_100220888 Ga0070698_1002208883 75
86 3300005471 Ga0070698_101127260 Ga0070698_1011272602 75
87 3300005518 Ga0070699_100020359 Ga0070699_1000203591 75
88 3300005518 Ga0070699_100099460 Ga0070699_1000994604 75
89 3300005530 Ga0070679_100044393 Ga0070679_1000443934 75
90 3300005530 Ga0070679_100064064 Ga0070679_1000640643 75
91 3300005530 Ga0070679_100475327 Ga0070679_1004753272 75
92 3300005530 Ga0070679_100476535 Ga0070679_1004765352 75
93 3300005530 Ga0070679_101080353 Ga0070679_1010803531 75
94 3300005530 Ga0070679_101362109 Ga0070679_1013621092 75
95 3300005530 Ga0070679_101562226 Ga0070679_1015622262 75
96 3300005535 Ga0070684_100063847 Ga0070684_1000638474 75
97 3300005535 Ga0070684_100078087 Ga0070684_1000780875 75
98 3300005535 Ga0070684_100249738 Ga0070684_1002497382 75
99 3300005535 Ga0070684_100449837 Ga0070684_1004498372 75
100 3300005536 Ga0070697_100021516 Ga0070697_1000215168 75
101 3300005536 Ga0070697_101735891 Ga0070697_1017358911 75
102 3300005539 Ga0068853_100034312 Ga0068853_1000343125 75
103 3300005539 Ga0068853_100289835 Ga0068853_1002898354 75
104 3300005539 Ga0068853_100350912 Ga0068853_1003509121 75
105 3300005539 Ga0068853_100678418 Ga0068853_1006784182 75
106 3300005543 Ga0070672_100149102 Ga0070672_1001491022 75
107 3300005545 Ga0070695_100310138 Ga0070695_1003101382 75
108 3300005545 Ga0070695_100472129 Ga0070695_1004721292 75
109 3300005547 Ga0070693_101312816 Ga0070693_1013128161 75
110 3300005548 Ga0070665_100031090 Ga0070665_1000310903 75
111 3300005548 Ga0070665_100036584 Ga0070665_1000365845 75
112 3300005548 Ga0070665_100148815 Ga0070665_1001488152 75
113 3300005548 Ga0070665_100431283 Ga0070665_1004312832 75
114 3300005548 Ga0070665_100678888 Ga0070665_1006788882 75
115 3300005549 Ga0070704_102228388 Ga0070704_1022283881 75
116 3300005563 Ga0068855_100002351 Ga0068855_1000023518 75
117 3300005563 Ga0068855_100071998 Ga0068855_1000719984 75
118 3300005563 Ga0068855_100228334 Ga0068855_1002283344 75
119 3300005563 Ga0068855_100319183 Ga0068855_1003191831 75
120 3300005563 Ga0068855_100474705 Ga0068855_1004747053 75
121 3300005563 Ga0068855_100970121 Ga0068855_1009701212 75
122 3300005563 Ga0068855_102529176 Ga0068855_1025291762 75
123 3300005564 Ga0070664_100002308 Ga0070664_1000023084 75
124 3300005564 Ga0070664_100032319 Ga0070664_1000323192 75
125 3300005564 Ga0070664_100499123 Ga0070664_1004991233 75
126 3300005564 Ga0070664_100927158 Ga0070664_1009271582 75
127 3300005577 Ga0068857_100001625 Ga0068857_1000016257 75
128 3300005577 Ga0068857_100009294 Ga0068857_1000092948 75
129 3300005577 Ga0068857_100017654 Ga0068857_1000176544 75
130 3300005577 Ga0068857_100017799 Ga0068857_1000177992 75
131 3300005577 Ga0068857_100299249 Ga0068857_1002992493 75
132 3300005578 Ga0068854_100000550 Ga0068854_10000055012 75
133 3300005578 Ga0068854_100107531 Ga0068854_1001075311 75
134 3300005578 Ga0068854_100813515 Ga0068854_1008135151 75
135 3300005614 Ga0068856_100012294 Ga0068856_1000122946 75
136 3300005614 Ga0068856_100020440 Ga0068856_1000204403 75
137 3300005614 Ga0068856_100208256 Ga0068856_1002082563 75
138 3300005614 Ga0068856_100210529 Ga0068856_1002105292 75
139 3300005614 Ga0068856_100516595 Ga0068856_1005165952 75
140 3300005614 Ga0068856_100622509 Ga0068856_1006225092 75
141 3300005614 Ga0068856_101355646 Ga0068856_1013556462 75
142 3300005614 Ga0068856_102409072 Ga0068856_1024090721 75
143 3300005615 Ga0070702_100118126 Ga0070702_1001181262 75
144 3300005616 Ga0068852_100014168 Ga0068852_1000141683 75
145 3300005616 Ga0068852_101298438 Ga0068852_1012984382 75
146 3300005616 Ga0068852_102599165 Ga0068852_1025991652 75
147 3300005617 Ga0068859_100019717 Ga0068859_1000197177 75
148 3300005617 Ga0068859_100149235 Ga0068859_1001492353 75
149 3300005617 Ga0068859_100951382 Ga0068859_1009513822 75
150 3300005618 Ga0068864_100000254 Ga0068864_1000002545 75
151 3300005618 Ga0068864_101111067 Ga0068864_1011110672 75
152 3300005718 Ga0068866_10002768 Ga0068866_100027688 75
153 3300005718 Ga0068866_10034683 Ga0068866_100346834 75
154 3300005719 Ga0068861_100302605 Ga0068861_1003026053 75
155 3300005834 Ga0068851_10978202 Ga0068851_109782021 75
156 3300005841 Ga0068863_100038545 Ga0068863_1000385454 75
157 3300005842 Ga0068858_100008626 Ga0068858_1000086262 75
158 3300005842 Ga0068858_100040847 Ga0068858_1000408474 75
159 3300005842 Ga0068858_101591650 Ga0068858_1015916502 75
160 3300005843 Ga0068860_100030407 Ga0068860_1000304072 75
161 3300005843 Ga0068860_100364616 Ga0068860_1003646161 75
162 3300005843 Ga0068860_100501062 Ga0068860_1005010622 75
163 3300005843 Ga0068860_100748227 Ga0068860_1007482272 75
164 3300005843 Ga0068860_101346582 Ga0068860_1013465822 75
165 3300005844 Ga0068862_102398101 Ga0068862_1023981011 75
166 3300006028 Ga0070717_10007014 Ga0070717_1000701412 75
167 3300006028 Ga0070717_10027062 Ga0070717_100270624 75
168 3300006028 Ga0070717_10030846 Ga0070717_100308466 75
169 3300006028 Ga0070717_10137584 Ga0070717_101375843 75
170 3300006028 Ga0070717_10144510 Ga0070717_101445103 75
171 3300006028 Ga0070717_10332521 Ga0070717_103325213 75
172 3300006028 Ga0070717_10793686 Ga0070717_107936862 75
173 3300006028 Ga0070717_10995017 Ga0070717_109950171 75
174 3300006028 Ga0070717_11067185 Ga0070717_110671851 75
175 3300006028 Ga0070717_11198346 Ga0070717_111983462 75
176 3300006028 Ga0070717_12133576 Ga0070717_121335762 75
177 3300006163 Ga0070715_10001048 Ga0070715_100010488 75
178 3300006163 Ga0070715_10421996 Ga0070715_104219962 75
179 3300006173 Ga0070716_100004491 Ga0070716_1000044915 75
180 3300006175 Ga0070712_100000284 Ga0070712_1000002847 75
181 3300006175 Ga0070712_100341313 Ga0070712_1003413132 75
182 3300006175 Ga0070712_100639590 Ga0070712_1006395902 75
183 3300006175 Ga0070712_100894110 Ga0070712_1008941101 75
184 3300006237 Ga0097621_100007110 Ga0097621_1000071102 75
185 3300006237 Ga0097621_100020116 Ga0097621_1000201166 75
186 3300006237 Ga0097621_100039367 Ga0097621_1000393673 75
187 3300006237 Ga0097621_100095177 Ga0097621_1000951773 75
188 3300006237 Ga0097621_100289518 Ga0097621_1002895183 75
189 3300006237 Ga0097621_100295478 Ga0097621_1002954783 75
190 3300006237 Ga0097621_100443815 Ga0097621_1004438152 75
191 3300006237 Ga0097621_100448768 Ga0097621_1004487683 75
192 3300006237 Ga0097621_100482910 Ga0097621_1004829102 75
193 3300006358 Ga0068871_100010030 Ga0068871_1000100305 75
194 3300006358 Ga0068871_100013601 Ga0068871_1000136017 75
195 3300006358 Ga0068871_100034909 Ga0068871_1000349092 75
196 3300006358 Ga0068871_100123609 Ga0068871_1001236092 75
197 3300006358 Ga0068871_100715884 Ga0068871_1007158842 75
198 3300006358 Ga0068871_100785617 Ga0068871_1007856172 75
199 3300006358 Ga0068871_101894123 Ga0068871_1018941232 75
200 3300006358 Ga0068871_102053230 Ga0068871_1020532302 75
201 3300006358 Ga0068871_102106200 Ga0068871_1021062002 75
202 3300006847 Ga0075431_101353023 Ga0075431_1013530231 75
203 3300006852 Ga0075433_10550598 Ga0075433_105505982 75
204 3300006871 Ga0075434_100005411 Ga0075434_10000541110 75
205 3300006881 Ga0068865_100002578 Ga0068865_10000257812 75
206 3300006881 Ga0068865_100083878 Ga0068865_1000838783 75
207 3300006881 Ga0068865_100452674 Ga0068865_1004526742 75
208 3300006881 Ga0068865_100772114 Ga0068865_1007721142 75
209 3300006914 Ga0075436_100039741 Ga0075436_1000397413 75
210 3300006914 Ga0075436_100281517 Ga0075436_1002815172 75
211 3300006931 Ga0097620_100019718 Ga0097620_1000197187 75
212 3300006931 Ga0097620_100149240 Ga0097620_1001492402 75
213 3300006931 Ga0097620_100951363 Ga0097620_1009513632 75
214 3300007076 Ga0075435_100278980 Ga0075435_1002789802 75
215 3300009093 Ga0105240_10076808 Ga0105240_100768086 75
216 3300009093 Ga0105240_10259598 Ga0105240_102595983 75
217 3300009093 Ga0105240_10465872 Ga0105240_104658722 75
218 3300009093 Ga0105240_10625084 Ga0105240_106250843 75
219 3300009093 Ga0105240_10627410 Ga0105240_106274103 75
220 3300009093 Ga0105240_10758786 Ga0105240_107587862 75
221 3300009093 Ga0105240_11210389 Ga0105240_112103892 75
222 3300009093 Ga0105240_11442731 Ga0105240_114427312 75
223 3300009093 Ga0105240_11469862 Ga0105240_114698622 75
224 3300009094 Ga0111539_11802959 Ga0111539_118029592 75
225 3300009098 Ga0105245_10011028 Ga0105245_100110287 75
226 3300009098 Ga0105245_10017355 Ga0105245_100173554 75
227 3300009098 Ga0105245_10091863 Ga0105245_100918633 75
228 3300009098 Ga0105245_10362579 Ga0105245_103625792 75
229 3300009098 Ga0105245_10817623 Ga0105245_108176232 75
230 3300009098 Ga0105245_11119170 Ga0105245_111191702 75
231 3300009098 Ga0105245_11382564 Ga0105245_113825642 75
232 3300009148 Ga0105243_11402929 Ga0105243_114029292 75
233 3300009174 Ga0105241_10008917 Ga0105241_100089173 75
234 3300009174 Ga0105241_10113823 Ga0105241_101138233 75
235 3300009174 Ga0105241_10242262 Ga0105241_102422623 75
236 3300009174 Ga0105241_10388839 Ga0105241_103888392 75
237 3300009174 Ga0105241_10439830 Ga0105241_104398302 75
238 3300009174 Ga0105241_10625054 Ga0105241_106250542 75
239 3300009174 Ga0105241_10822327 Ga0105241_108223272 75
240 3300009174 Ga0105241_11322356 Ga0105241_113223562 75
241 3300009176 Ga0105242_10010190 Ga0105242_100101908 75
242 3300009176 Ga0105242_10053036 Ga0105242_100530362 75
243 3300009176 Ga0105242_10110145 Ga0105242_101101454 75
244 3300009176 Ga0105242_10195919 Ga0105242_101959192 75
245 3300009176 Ga0105242_10208502 Ga0105242_102085022 75
246 3300009176 Ga0105242_10238308 Ga0105242_102383082 75
247 3300009176 Ga0105242_10948377 Ga0105242_109483772 75
248 3300009176 Ga0105242_11905767 Ga0105242_119057672 75
249 3300009177 Ga0105248_10013796 Ga0105248_100137964 75
250 3300009177 Ga0105248_10059685 Ga0105248_100596851 75
251 3300009177 Ga0105248_10356946 Ga0105248_103569463 75
252 3300009177 Ga0105248_11366544 Ga0105248_113665442 75
253 3300009545 Ga0105237_10025507 Ga0105237_100255075 75
254 3300009545 Ga0105237_10027372 Ga0105237_100273725 75
255 3300009545 Ga0105237_10065137 Ga0105237_100651374 75
256 3300009545 Ga0105237_10074855 Ga0105237_100748554 75
257 3300009545 Ga0105237_10376230 Ga0105237_103762303 75
258 3300009545 Ga0105237_10380322 Ga0105237_103803223 75
259 3300009545 Ga0105237_10583079 Ga0105237_105830792 75
260 3300009545 Ga0105237_10944154 Ga0105237_109441543 75
261 3300009545 Ga0105237_11033942 Ga0105237_110339421 75
262 3300009545 Ga0105237_11978616 Ga0105237_119786161 75
263 3300009551 Ga0105238_10003228 Ga0105238_100032289 75
264 3300009551 Ga0105238_10018824 Ga0105238_1001882410 75
265 3300009551 Ga0105238_10088384 Ga0105238_100883844 75
266 3300009551 Ga0105238_10167710 Ga0105238_101677103 75
267 3300009551 Ga0105238_10168302 Ga0105238_101683023 75
268 3300009551 Ga0105238_10299853 Ga0105238_102998533 75
269 3300009551 Ga0105238_10556495 Ga0105238_105564953 75
270 3300009551 Ga0105238_10746944 Ga0105238_107469442 75
271 3300009553 Ga0105249_11318991 Ga0105249_113189911 75
272 3300010375 Ga0105239_10009183 Ga0105239_1000918313 75
273 3300010375 Ga0105239_10027061 Ga0105239_100270614 75
274 3300010375 Ga0105239_10147659 Ga0105239_101476595 75
275 3300010375 Ga0105239_10226706 Ga0105239_102267063 75
276 3300010375 Ga0105239_10227980 Ga0105239_102279802 75
277 3300010375 Ga0105239_10381904 Ga0105239_103819042 75
278 3300010375 Ga0105239_11716092 Ga0105239_117160922 75
279 3300010375 Ga0105239_12277922 Ga0105239_122779222 75
280 3300011119 Ga0105246_10132961 Ga0105246_101329613 75
281 3300011119 Ga0105246_10315388 Ga0105246_103153882 75
282 3300011119 Ga0105246_10634397 Ga0105246_106343973 75
283 3300013100 Ga0157373_10043557 Ga0157373_100435573 75
284 3300013100 Ga0157373_10181387 Ga0157373_101813872 75
285 3300013100 Ga0157373_10386962 Ga0157373_103869622 75
286 3300013100 Ga0157373_11453867 Ga0157373_114538671 75
287 3300013102 Ga0157371_10114140 Ga0157371_101141402 75
288 3300013104 Ga0157370_10202492 Ga0157370_102024923 75
289 3300013104 Ga0157370_10295190 Ga0157370_102951903 75
290 3300013104 Ga0157370_10481625 Ga0157370_104816252 75
291 3300013104 Ga0157370_10778484 Ga0157370_107784842 75
292 3300013104 Ga0157370_11940508 Ga0157370_119405081 75
293 3300013105 Ga0157369_10135547 Ga0157369_101355471 75
294 3300013105 Ga0157369_10211676 Ga0157369_102116763 75
295 3300013105 Ga0157369_10213815 Ga0157369_102138153 75
296 3300013105 Ga0157369_11070884 Ga0157369_110708842 75
297 3300013105 Ga0157369_11301759 Ga0157369_113017592 75
298 3300013296 Ga0157374_10000623 Ga0157374_1000062315 75
299 3300013296 Ga0157374_10014478 Ga0157374_100144783 75
300 3300013296 Ga0157374_10401862 Ga0157374_104018622 75
301 3300013296 Ga0157374_10519896 Ga0157374_105198961 75
302 3300013297 Ga0157378_10000217 Ga0157378_100002172 75
303 3300013297 Ga0157378_10043628 Ga0157378_100436284 75
304 3300013297 Ga0157378_10245971 Ga0157378_102459712 75
305 3300013297 Ga0157378_10246598 Ga0157378_102465982 75
306 3300013297 Ga0157378_10628435 Ga0157378_106284351 75
307 3300013297 Ga0157378_10654888 Ga0157378_106548882 75
308 3300013297 Ga0157378_11273735 Ga0157378_112737351 75
309 3300013297 Ga0157378_11468052 Ga0157378_114680522 75
310 3300013306 Ga0163162_10029610 Ga0163162_100296106 75
311 3300013306 Ga0163162_10056432 Ga0163162_100564324 75
312 3300013306 Ga0163162_10102308 Ga0163162_101023083 75
313 3300013306 Ga0163162_11358051 Ga0163162_113580512 75
314 3300013306 Ga0163162_12069787 Ga0163162_120697872 75
315 3300013307 Ga0157372_10001157 Ga0157372_1000115719 75
316 3300013307 Ga0157372_10016198 Ga0157372_100161982 75
317 3300013307 Ga0157372_10034062 Ga0157372_100340624 75
318 3300013307 Ga0157372_10182241 Ga0157372_101822413 75
319 3300013307 Ga0157372_10212186 Ga0157372_102121861 75
320 3300013307 Ga0157372_10299874 Ga0157372_102998743 75
321 3300013307 Ga0157372_10306503 Ga0157372_103065031 75
322 3300013307 Ga0157372_10354734 Ga0157372_103547342 75
323 3300013307 Ga0157372_11380829 Ga0157372_113808291 75
324 3300013307 Ga0157372_12032048 Ga0157372_120320481 75
325 3300013307 Ga0157372_12203935 Ga0157372_122039352 75
326 3300013308 Ga0157375_11271556 Ga0157375_112715562 75
327 3300014325 Ga0163163_10035576 Ga0163163_100355763 75
328 3300014325 Ga0163163_10493854 Ga0163163_104938541 75
329 3300014325 Ga0163163_10699046 Ga0163163_106990462 75
330 3300014325 Ga0163163_11615594 Ga0163163_116155942 75
331 3300014325 Ga0163163_12377630 Ga0163163_123776302 75
332 3300014745 Ga0157377_10078427 Ga0157377_100784272 75
333 3300014969 Ga0157376_10025238 Ga0157376_100252384 75
334 3300014969 Ga0157376_11001275 Ga0157376_110012751 75
335 3300014969 Ga0157376_12239593 Ga0157376_122395932 75
336 3300014969 Ga0157376_12388023 Ga0157376_123880231 75
337 3300021358 Ga0213873_10041902 Ga0213873_100419022 75
338 3300021377 Ga0213874_10057501 Ga0213874_100575011 75
339 3300021388 Ga0213875_10081610 Ga0213875_100816101 75
340 3300021388 Ga0213875_10670822 Ga0213875_106708222 75
341 3300025321 Ga0207656_10236796 Ga0207656_102367962 75
342 3300025898 Ga0207692_10056007 Ga0207692_100560073 75
343 3300025898 Ga0207692_10124495 Ga0207692_101244953 75
344 3300025899 Ga0207642_10047698 Ga0207642_100476984 75
345 3300025899 Ga0207642_10050242 Ga0207642_100502424 75
346 3300025904 Ga0207647_10047576 Ga0207647_100475764 75
347 3300025904 Ga0207647_10341482 Ga0207647_103414822 75
348 3300025905 Ga0207685_10000448 Ga0207685_100004486 75
349 3300025906 Ga0207699_10246559 Ga0207699_102465592 75
350 3300025906 Ga0207699_10268892 Ga0207699_102688922 75
351 3300025906 Ga0207699_10346453 Ga0207699_103464532 75
352 3300025907 Ga0207645_10280625 Ga0207645_102806251 75
353 3300025909 Ga0207705_10214797 Ga0207705_102147973 75
354 3300025910 Ga0207684_10009193 Ga0207684_100091935 75
355 3300025910 Ga0207684_10708183 Ga0207684_107081832 75
356 3300025911 Ga0207654_10071561 Ga0207654_100715613 75
357 3300025911 Ga0207654_10258359 Ga0207654_102583591 75
358 3300025911 Ga0207654_11107052 Ga0207654_111070522 75
359 3300025912 Ga0207707_10009951 Ga0207707_100099515 75
360 3300025912 Ga0207707_10013326 Ga0207707_100133262 75
361 3300025912 Ga0207707_10175973 Ga0207707_101759733 75
362 3300025912 Ga0207707_10692770 Ga0207707_106927701 75
363 3300025912 Ga0207707_10936347 Ga0207707_109363472 75
364 3300025913 Ga0207695_10010580 Ga0207695_100105803 75
365 3300025913 Ga0207695_10028548 Ga0207695_100285484 75
366 3300025913 Ga0207695_10058596 Ga0207695_100585962 75
367 3300025913 Ga0207695_10130146 Ga0207695_101301463 75
368 3300025913 Ga0207695_10225422 Ga0207695_102254224 75
369 3300025913 Ga0207695_10621039 Ga0207695_106210392 75
370 3300025913 Ga0207695_11138730 Ga0207695_111387302 75
371 3300025913 Ga0207695_11405328 Ga0207695_114053281 75
372 3300025914 Ga0207671_10060624 Ga0207671_100606244 75
373 3300025914 Ga0207671_10212739 Ga0207671_102127391 75
374 3300025914 Ga0207671_10469652 Ga0207671_104696523 75
375 3300025914 Ga0207671_10618316 Ga0207671_106183162 75
376 3300025914 Ga0207671_10692228 Ga0207671_106922281 75
377 3300025915 Ga0207693_10000038 Ga0207693_1000003865 75
378 3300025915 Ga0207693_10542464 Ga0207693_105424642 75
379 3300025916 Ga0207663_10000445 Ga0207663_100004459 75
380 3300025916 Ga0207663_11549430 Ga0207663_115494302 75
381 3300025917 Ga0207660_10481556 Ga0207660_104815562 75
382 3300025917 Ga0207660_11042990 Ga0207660_110429902 75
383 3300025919 Ga0207657_10282475 Ga0207657_102824753 75
384 3300025919 Ga0207657_10943993 Ga0207657_109439932 75
385 3300025919 Ga0207657_10963403 Ga0207657_109634032 75
386 3300025920 Ga0207649_10103521 Ga0207649_101035212 75
387 3300025920 Ga0207649_10301361 Ga0207649_103013614 75
388 3300025920 Ga0207649_11192634 Ga0207649_111926342 75
389 3300025921 Ga0207652_10041168 Ga0207652_100411683 75
390 3300025921 Ga0207652_10091447 Ga0207652_100914474 75
391 3300025921 Ga0207652_10230846 Ga0207652_102308463 75
392 3300025921 Ga0207652_11262756 Ga0207652_112627562 75
393 3300025922 Ga0207646_10003637 Ga0207646_100036375 75
394 3300025922 Ga0207646_10170975 Ga0207646_101709753 75
395 3300025922 Ga0207646_10302474 Ga0207646_103024742 75
396 3300025922 Ga0207646_10331749 Ga0207646_103317492 75
397 3300025922 Ga0207646_10916682 Ga0207646_109166821 75
398 3300025924 Ga0207694_10054836 Ga0207694_100548363 75
399 3300025924 Ga0207694_10101130 Ga0207694_101011302 75
400 3300025924 Ga0207694_10171115 Ga0207694_101711151 75
401 3300025924 Ga0207694_10454459 Ga0207694_104544592 75
402 3300025924 Ga0207694_10741720 Ga0207694_107417202 75
403 3300025926 Ga0207659_11907120 Ga0207659_119071202 75
404 3300025927 Ga0207687_10010819 Ga0207687_100108195 75
405 3300025927 Ga0207687_10067701 Ga0207687_100677015 75
406 3300025927 Ga0207687_10327913 Ga0207687_103279133 75
407 3300025927 Ga0207687_10340170 Ga0207687_103401703 75
408 3300025927 Ga0207687_10876735 Ga0207687_108767351 75
409 3300025927 Ga0207687_11681716 Ga0207687_116817161 75
410 3300025928 Ga0207700_10013866 Ga0207700_100138662 75
411 3300025928 Ga0207700_10026719 Ga0207700_100267194 75
412 3300025928 Ga0207700_10042606 Ga0207700_100426063 75
413 3300025928 Ga0207700_10128601 Ga0207700_101286012 75
414 3300025928 Ga0207700_10589345 Ga0207700_105893451 75
415 3300025928 Ga0207700_11323385 Ga0207700_113233852 75
416 3300025929 Ga0207664_10010919 Ga0207664_100109195 75
417 3300025929 Ga0207664_10039862 Ga0207664_100398625 75
418 3300025929 Ga0207664_10291058 Ga0207664_102910582 75
419 3300025929 Ga0207664_10444997 Ga0207664_104449973 75
420 3300025932 Ga0207690_10063398 Ga0207690_100633983 75
421 3300025932 Ga0207690_10897882 Ga0207690_108978822 75
422 3300025932 Ga0207690_10965163 Ga0207690_109651632 75
423 3300025932 Ga0207690_10970591 Ga0207690_109705912 75
424 3300025933 Ga0207706_10082985 Ga0207706_100829852 75
425 3300025933 Ga0207706_11390545 Ga0207706_113905452 75
426 3300025934 Ga0207686_10022758 Ga0207686_100227582 75
427 3300025934 Ga0207686_10035947 Ga0207686_100359472 75
428 3300025934 Ga0207686_10097331 Ga0207686_100973313 75
429 3300025934 Ga0207686_10167876 Ga0207686_101678761 75
430 3300025934 Ga0207686_10442897 Ga0207686_104428972 75
431 3300025934 Ga0207686_10647161 Ga0207686_106471612 75
432 3300025934 Ga0207686_11464945 Ga0207686_114649451 75
433 3300025935 Ga0207709_10153194 Ga0207709_101531941 75
434 3300025935 Ga0207709_11735119 Ga0207709_117351191 75
435 3300025938 Ga0207704_10398093 Ga0207704_103980933 75
436 3300025938 Ga0207704_11918911 Ga0207704_119189111 75
437 3300025939 Ga0207665_10003824 Ga0207665_1000382412 75
438 3300025939 Ga0207665_10065768 Ga0207665_100657683 75
439 3300025939 Ga0207665_10087981 Ga0207665_100879811 75
440 3300025939 Ga0207665_10673484 Ga0207665_106734841 75
441 3300025940 Ga0207691_11531844 Ga0207691_115318442 75
442 3300025941 Ga0207711_10027274 Ga0207711_100272744 75
443 3300025941 Ga0207711_10310864 Ga0207711_103108643 75
444 3300025941 Ga0207711_10433695 Ga0207711_104336952 75
445 3300025942 Ga0207689_10011972 Ga0207689_100119724 75
446 3300025944 Ga0207661_10074157 Ga0207661_100741574 75
447 3300025944 Ga0207661_10174234 Ga0207661_101742343 75
448 3300025944 Ga0207661_10209225 Ga0207661_102092252 75
449 3300025944 Ga0207661_10396357 Ga0207661_103963572 75
450 3300025945 Ga0207679_10005250 Ga0207679_100052502 75
451 3300025945 Ga0207679_10976622 Ga0207679_109766222 75
452 3300025945 Ga0207679_11357273 Ga0207679_113572732 75
453 3300025949 Ga0207667_10005709 Ga0207667_100057094 75
454 3300025949 Ga0207667_10184517 Ga0207667_101845174 75
455 3300025949 Ga0207667_10190325 Ga0207667_101903253 75
456 3300025949 Ga0207667_10385912 Ga0207667_103859122 75
457 3300025949 Ga0207667_10737712 Ga0207667_107377123 75
458 3300025949 Ga0207667_10918413 Ga0207667_109184132 75
459 3300025949 Ga0207667_11171767 Ga0207667_111717672 75
460 3300025960 Ga0207651_10495988 Ga0207651_104959882 75
461 3300025961 Ga0207712_10874758 Ga0207712_108747581 75
462 3300025972 Ga0207668_10644339 Ga0207668_106443391 75
463 3300025981 Ga0207640_10003176 Ga0207640_100031764 75
464 3300025986 Ga0207658_10229592 Ga0207658_102295922 75
465 3300026023 Ga0207677_10009222 Ga0207677_100092222 75
466 3300026023 Ga0207677_10083528 Ga0207677_100835284 75
467 3300026035 Ga0207703_10011649 Ga0207703_100116494 75
468 3300026035 Ga0207703_10609417 Ga0207703_106094172 75
469 3300026035 Ga0207703_11473114 Ga0207703_114731142 75
470 3300026041 Ga0207639_10572421 Ga0207639_105724213 75
471 3300026041 Ga0207639_11685758 Ga0207639_116857582 75
472 3300026041 Ga0207639_12074888 Ga0207639_120748881 75
473 3300026078 Ga0207702_10037217 Ga0207702_100372173 75
474 3300026078 Ga0207702_10269803 Ga0207702_102698032 75
475 3300026078 Ga0207702_10313003 Ga0207702_103130033 75
476 3300026078 Ga0207702_10336646 Ga0207702_103366463 75
477 3300026078 Ga0207702_10946513 Ga0207702_109465132 75
478 3300026078 Ga0207702_11124948 Ga0207702_111249481 75
479 3300026088 Ga0207641_11103024 Ga0207641_111030242 75
480 3300026088 Ga0207641_11222269 Ga0207641_112222692 75
481 3300026089 Ga0207648_10012998 Ga0207648_1001299810 75
482 3300026089 Ga0207648_10102624 Ga0207648_101026244 75
483 3300026095 Ga0207676_10028737 Ga0207676_100287374 75
484 3300026095 Ga0207676_11021215 Ga0207676_110212152 75
485 3300026116 Ga0207674_10000257 Ga0207674_1000025714 75
486 3300026116 Ga0207674_10042637 Ga0207674_100426374 75
487 3300026116 Ga0207674_10045452 Ga0207674_100454522 75
488 3300026116 Ga0207674_10050783 Ga0207674_100507835 75
489 3300026116 Ga0207674_10122853 Ga0207674_101228534 75
490 3300026118 Ga0207675_100430899 Ga0207675_1004308992 75
491 3300026121 Ga0207683_10227717 Ga0207683_102277172 75
492 3300026121 Ga0207683_10365165 Ga0207683_103651653 75
493 3300026121 Ga0207683_11500205 Ga0207683_115002052 75
494 3300026142 Ga0207698_10415064 Ga0207698_104150643 75
495 3300026142 Ga0207698_10502181 Ga0207698_105021812 75
496 3300027907 Ga0207428_11085072 Ga0207428_110850721 75
497 3300028023 Ga0265357_1025794 Ga0265357_10257942 75
498 3300028379 Ga0268266_10002897 Ga0268266_100028976 75
499 3300028379 Ga0268266_10099235 Ga0268266_100992353 75
500 3300028379 Ga0268266_10242658 Ga0268266_102426582 75
501 3300028379 Ga0268266_10607042 Ga0268266_106070422 75
502 3300028379 Ga0268266_11985222 Ga0268266_119852222 75
503 3300028379 Ga0268266_12275162 Ga0268266_122751622 75
504 3300028381 Ga0268264_10551288 Ga0268264_105512882 75
505 3300028381 Ga0268264_10837193 Ga0268264_108371932 75
506 3300028381 Ga0268264_10940444 Ga0268264_109404442 75
507 3300028381 Ga0268264_11617293 Ga0268264_116172932 75
508 3300028800 Ga0265338_10015795 Ga0265338_100157953 75
509 3300028800 Ga0265338_10314876 Ga0265338_103148762 75
510 3300029957 Ga0265324_10071639 Ga0265324_100716392 75
511 3300030760 Ga0265762_1000835 Ga0265762_10008352 75
512 3300030760 Ga0265762_1015837 Ga0265762_10158371 75
513 3300031090 Ga0265760_10003536 Ga0265760_100035367 75
514 3300031090 Ga0265760_10151697 Ga0265760_101516972 75
515 3300031090 Ga0265760_10180275 Ga0265760_101802752 75
516 3300031238 Ga0265332_10355274 Ga0265332_103552742 75
517 3300031241 Ga0265325_10157650 Ga0265325_101576501 75
518 3300031247 Ga0265340_10064148 Ga0265340_100641482 75
519 3300031247 Ga0265340_10488634 Ga0265340_104886341 75
520 3300031247 Ga0265340_10559492 Ga0265340_105594921 75
521 3300031249 Ga0265339_10031642 Ga0265339_100316422 75
522 3300031249 Ga0265339_10084081 Ga0265339_100840811 75
523 3300031250 Ga0265331_10384131 Ga0265331_103841312 75
524 3300031344 Ga0265316_10003152 Ga0265316_100031527 75
525 3300031344 Ga0265316_11057881 Ga0265316_110578812 75
526 3300031595 Ga0265313_10024891 Ga0265313_100248912 75
527 3300031711 Ga0265314_10001555 Ga0265314_100015552 75
528 3300031711 Ga0265314_10072115 Ga0265314_100721153 75
529 3300031711 Ga0265314_10197520 Ga0265314_101975203 75
530 3300031711 Ga0265314_10704304 Ga0265314_107043041 75
531 3300031730 Ga0307516_10003420 Ga0307516_100034205 75
532 3300031824 Ga0307413_11376731 Ga0307413_113767311 75
533 3300031995 Ga0307409_101176570 Ga0307409_1011765702 75
534 3300035083 Ga0373926_0273403 Ga0373926_0273403_208_435 75
535 3300035113 Ga0373936_0119123 Ga0373936_0119123_241_468 75
536 3300035115 Ga0373941_0380671 Ga0373941_0380671_154_381 75
537 3300035116 Ga0373945_0034297 Ga0373945_0034297_1038_1265 75
538 3300035121 Ga0373960_0131559 Ga0373960_0131559_49_276 75
539 3300035170 Ga0373943_0158856 Ga0373943_0158856_750_977 75
540 3300035171 Ga0373946_0198704 Ga0373946_0198704_21_248 75
541 3300035692 Ga0373935_0090979 Ga0373935_0090979_1639_1866 75
542 3300035692 Ga0373935_0378526 Ga0373935_0378526_207_434 75
543 3300035695 Ga0373927_0294475 Ga0373927_0294475_588_815 75
544 3300035725 Ga0373947_0119034 Ga0373947_0119034_611_838 75
545 3300035725 Ga0373947_0220747 Ga0373947_0220747_545_772 75
546 3300036401 Ga0373937_0126692 Ga0373937_0126692_23_250 75
547 3300037068 Ga0373925_0001347 Ga0373925_0001347_9163_9390 75
548 3300037068 Ga0373925_0017618 Ga0373925_0017618_2155_2382 75
549 3300037068 Ga0373925_1353511 Ga0373925_1353511_145_372 75
550 3300037312 Ga0395899_0103624 Ga0395899_0103624_1638_1865 75
551 3300037418 Ga0395900_0011767 Ga0395900_0011767_2317_2544 75
552 3300037853 Ga0436364_0196890 Ga0436364_0196890_488_715 75
553 3300037853 Ga0436364_0619394 Ga0436364_0619394_78_305 75
554 3300037853 Ga0436364_0752135 Ga0436364_0752135_1015_1242 75
555 3300037853 Ga0436364_0818917 Ga0436364_0818917_10_264 75
556 3300037853 Ga0436364_1148362 Ga0436364_1148362_117_344 75
557 3300038443 Ga0395901_0002017 Ga0395901_0002017_9668_9895 75
558 3300039437 Ga0436365_0535589 Ga0436365_0535589_1195_1422 75
559 3300039438 Ga0436360_0193073 Ga0436360_0193073_1364_1591 75
560 3300039447 Ga0436361_0410353 Ga0436361_0410353_718_945 75
561 3300039450 Ga0436363_1167321 Ga0436363_1167321_51_278 75
562 3300039450 Ga0436363_1325016 Ga0436363_1325016_966_1193 75
563 3300039453 Ga0436362_0461317 Ga0436362_0461317_841_1068 75
564 3300039453 Ga0436362_0554361 Ga0436362_0554361_176_403 75
565 3300041406 Ga0439439_0129405 Ga0439439_0129405_455_682 75
566 3300044693 Ga0466961_0011063 Ga0466961_0011063_39_266 75
567 3300044694 Ga0466963_0175031 Ga0466963_0175031_822_1049 75
568 3300044694 Ga0466963_0281212 Ga0466963_0281212_30_263 75
569 3300044706 Ga0466964_0239003 Ga0466964_0239003_176_403 75
570 3300044719 Ga0466971_0087345 Ga0466971_0087345_1169_1396 75
571 3300044765 Ga0466970_0348604 Ga0466970_0348604_489_716 75
572 3300045836 Ga0466958_0214639 Ga0466958_0214639_171_398 75
573 3300045836 Ga0466958_0458552 Ga0466958_0458552_408_635 75
574 3300045976 Ga0466967_0001421 Ga0466967_0001421_13392_13619 75
575 3300045976 Ga0466967_0430875 Ga0466967_0430875_1023_1256 75
576 3300046459 Ga0495629_0118858 Ga0495629_0118858_1055_1282 75
577 3300046463 Ga0495653_0261535 Ga0495653_0261535_655_882 75
578 3300046472 Ga0495580_0000798 Ga0495580_0000798_9236_9463 75
579 3300046472 Ga0495580_0543819 Ga0495580_0543819_12_239 75
580 3300046472 Ga0495580_0619788 Ga0495580_0619788_430_657 75
581 3300046472 Ga0495580_1105985 Ga0495580_1105985_133_360 75
582 3300046473 Ga0495582_0024473 Ga0495582_0024473_1113_1340 75
583 3300046499 Ga0495594_0377887 Ga0495594_0377887_44_271 75
584 3300046679 Ga0495623_0260879 Ga0495623_0260879_283_510 75
585 3300046683 Ga0495658_0106168 Ga0495658_0106168_605_832 75
586 3300046684 Ga0495669_0137851 Ga0495669_0137851_241_468 75
587 3300047315 Ga0495581_0248192 Ga0495581_0248192_405_632 75
588 3300047471 Ga0495684_0406906 Ga0495684_0406906_78_305 75
589 3300047673 Ga0495593_0233808 Ga0495593_0233808_69_296 75
590 3300048088 Ga0495602_0707789 Ga0495602_0707789_228_455 75
591 3300048903 Ga0496100_0067036 Ga0496100_0067036_29_256 75
592 3300048905 Ga0496102_1232163 Ga0496102_1232163_156_383 75
593 3300048905 Ga0496102_1664110 Ga0496102_1664110_177_404 75
594 3300048907 Ga0496104_0066133 Ga0496104_0066133_552_779 75
595 3300048907 Ga0496104_0072229 Ga0496104_0072229_1270_1497 75
596 3300048913 Ga0496110_1733965 Ga0496110_1733965_271_498 75
597 3300048915 Ga0496112_1618076 Ga0496112_1618076_250_477 75
598 3300048917 Ga0496114_0684998 Ga0496114_0684998_651_878 75
599 3300048918 Ga0496115_0034645 Ga0496115_0034645_2443_2670 75
600 3300049568 Ga0501031_0062891 Ga0501031_0062891_962_1189 75
601 3300049569 Ga0501032_0041923 Ga0501032_0041923_1508_1735 75
602 3300049569 Ga0501032_0138183 Ga0501032_0138183_926_1153 75
603 3300049569 Ga0501032_0158509 Ga0501032_0158509_257_484 75
604 3300049569 Ga0501032_0388158 Ga0501032_0388158_16_243 75
605 3300049570 Ga0501033_0040142 Ga0501033_0040142_818_1045 75
606 3300049570 Ga0501033_0090141 Ga0501033_0090141_580_807 75
607 3300049570 Ga0501033_0198553 Ga0501033_0198553_50_277 75
608 3300049570 Ga0501033_0242516 Ga0501033_0242516_166_393 75
609 3300049570 Ga0501033_0594288 Ga0501033_0594288_101_328 75
610 3300049571 Ga0501034_0000778 Ga0501034_0000778_14895_15122 75
611 3300049571 Ga0501034_0085510 Ga0501034_0085510_662_889 75
612 3300049571 Ga0501034_0185782 Ga0501034_0185782_1157_1384 75
613 3300049571 Ga0501034_0233221 Ga0501034_0233221_1496_1723 75
614 3300049572 Ga0501036_0008377 Ga0501036_0008377_7188_7415 75
615 3300049572 Ga0501036_0195775 Ga0501036_0195775_548_775 75
616 3300049572 Ga0501036_0386102 Ga0501036_0386102_804_1031 75
617 3300049573 Ga0501037_0004949 Ga0501037_0004949_7656_7883 75
618 3300049573 Ga0501037_0301753 Ga0501037_0301753_73_300 75
619 3300049573 Ga0501037_0322924 Ga0501037_0322924_748_975 75
620 3300049573 Ga0501037_0904404 Ga0501037_0904404_30_257 75
621 3300049574 Ga0501038_0152306 Ga0501038_0152306_959_1186 75
622 3300049574 Ga0501038_0439908 Ga0501038_0439908_440_667 75
623 3300049575 Ga0501039_0164309 Ga0501039_0164309_720_947 75
624 3300049575 Ga0501039_0656785 Ga0501039_0656785_111_338 75
625 3300049576 Ga0501040_0180109 Ga0501040_0180109_693_920 75
626 3300049579 Ga0501043_0125140 Ga0501043_0125140_863_1090 75
627 3300049579 Ga0501043_0152295 Ga0501043_0152295_426_653 75
628 3300049579 Ga0501043_0553222 Ga0501043_0553222_267_494 75
629 3300049580 Ga0501046_0058561 Ga0501046_0058561_678_905 75
630 3300049580 Ga0501046_0302697 Ga0501046_0302697_776_1003 75
631 3300049581 Ga0501047_0133728 Ga0501047_0133728_807_1034 75
632 3300049581 Ga0501047_0140719 Ga0501047_0140719_1358_1585 75
633 3300049581 Ga0501047_0656246 Ga0501047_0656246_340_567 75
634 3300049582 Ga0501048_0942009 Ga0501048_0942009_64_291 75
635 3300049586 Ga0501070_0084865 Ga0501070_0084865_1143_1370 75
636 3300049686 Ga0501257_000588 Ga0501257_000588_5569_5796 75
637 3300049822 Ga0501035_0000386 Ga0501035_0000386_983_1210 75
638 3300049822 Ga0501035_0350821 Ga0501035_0350821_514_741 75
639 3300049822 Ga0501035_0387735 Ga0501035_0387735_217_444 75
640 3300049823 Ga0501044_0004473 Ga0501044_0004473_1874_2101 75
641 3300049823 Ga0501044_0129884 Ga0501044_0129884_1165_1392 75
642 3300049823 Ga0501044_0166866 Ga0501044_0166866_792_1019 75
643 3300049823 Ga0501044_0171915 Ga0501044_0171915_1152_1379 75
644 3300049823 Ga0501044_0381224 Ga0501044_0381224_829_1056 75
645 3300049823 Ga0501044_0588185 Ga0501044_0588185_567_794 75
646 3300049823 Ga0501044_1058709 Ga0501044_1058709_42_269 75
647 3300050510 nmdc:mga06r32_1509110_c1 nmdc:mga06r32_1509110_c1_249_476 75
648 3300050511 nmdc:mga08y16_1439571_c1 nmdc:mga08y16_1439571_c1_397_624 75
649 3300050512 nmdc:mga0n895_4119_c1 nmdc:mga0n895_4119_c1_6724_6951 75
650 3300050513 nmdc:mga0rr50_199678_c1 nmdc:mga0rr50_199678_c1_438_665 75
651 3300050514 nmdc:mga08x19_1278777_c1 nmdc:mga08x19_1278777_c1_47_274 75
652 3300050514 nmdc:mga08x19_28256_c1 nmdc:mga08x19_28256_c1_1339_1566 75
653 3300050514 nmdc:mga08x19_93699_c1 nmdc:mga08x19_93699_c1_1274_1501 75
654 3300050515 nmdc:mga0a205_418568_c1 nmdc:mga0a205_418568_c1_437_664 75
655 3300053119 Ga0500595_043391 Ga0500595_043391_156_383 75
656 3300053139 Ga0500568_0387741 Ga0500568_0387741_107_334 75
657 3300053153 Ga0500616_0043063 Ga0500616_0043063_1268_1495 75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z0r-assembly1.cif.gz_B solution structure of the n-terminal dna recognition domain of the bacillus subtilis transcription-state regulator abrb 0.8393 15 50
2mrn-assembly1.cif.gz_B structure of truncated ecmaze 0.8067 1 49
1ub4-assembly1.cif.gz_C-2 crystal structure of mazef complex 0.7912 2 49
2w1t-assembly1.cif.gz_B crystal structure of b. subtilis spovt 0.7793 1 47
1mvf-assembly2.cif.gz_D maze addiction antidote 0.7763 5 48
ID Description Score Start End Superfamily
af_Q9Y615_245_329_3.90.640.10 Alpha Beta;Alpha-Beta Complex;Actin; Chain A, domain 4;ATPase, substrate binding domain, subdomain 4 0.8923 33 47 3.90.640.10
1ub4C00 Mainly Beta;Ribbon;Pemi-like Protein 1; Chain: D; 0.7912 2 49 2.10.260.10
1mvfE00 Mainly Beta;Ribbon;Pemi-like Protein 1; Chain: D; 0.7876 5 48 2.10.260.10
af_Q15772_1679_1886_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7874 33 49 1.10.510.10
af_O23614_302_511_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7828 31 48 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A7V8Z7D6-F1-model_v4 SpoVT-AbrB domain-containing protein 0.9335 2 53
AF-A0A3M1DDG5-F1-model_v4 AbrB/MazE/SpoVT family DNA-binding domain-containing protein 0.8689 1 50 GO:0003677
AF-A0A062V8M3-F1-model_v4 SpoVT / AbrB-like protein 0.8686 1 50 GO:0003677
AF-A0A1I6K6L5-F1-model_v4 Looped-hinge helix DNA binding domain-containing protein, AbrB family 0.8666 1 50
AF-A0A2H1FEZ5-F1-model_v4 SpoVT-AbrB domain-containing protein 0.8663 1 50

Feature Viewer

pLDDT pTM Quality
88.52 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map