F473105
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 657 | 243 | 657 | 75 |
Family's Representative Sequence
| Representative Sequence | 3300030760|Ga0265762_1000835|Ga0265762_10008352 |
| Length | 84 |
| Sequence | MVITRRRSAGVELKVRKFGNSLGVVLAKEVINRLHTRDGEPLFLIEASVGGCRLTPYGPRFQEKMAKAEDIISRYRNTLHVLAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 96 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 97 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 98 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 158 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 161 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 162 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 168 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 169 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 170 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 171 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 179 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 185 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 186 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 187 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 188 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 189 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 190 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 191 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 192 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 193 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 194 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 195 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 196 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 213 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 214 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 215 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 216 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 217 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 218 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 233 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 242 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 243 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.24 |
| Metatranscriptomes | 0.76 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.46 |
| Nodule | 0 |
| Rhizoplane | 1.37 |
| Rhizosphere | 96.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10914189 | 3300005327 | Unclassified | 763 |
| 2 | Ga0070676_10290716 | 3300005328 | Bacteria | 1104 |
| 3 | Ga0070683_100046315 | 3300005329 | Bacteria | 4017 |
| 4 | Ga0070683_100289932 | 3300005329 | Bacteria | 1557 |
| 5 | Ga0070683_100530195 | 3300005329 | Bacteria | 1125 |
| 6 | Ga0070690_100982218 | 3300005330 | Unclassified | 664 |
| 7 | Ga0068869_100045007 | 3300005334 | Bacteria | 3176 |
| 8 | Ga0070680_101035862 | 3300005336 | Bacteria | 709 |
| 9 | Ga0070682_100199002 | 3300005337 | Bacteria | 1412 |
| 10 | Ga0070682_101134394 | 3300005337 | Bacteria | 656 |
| 11 | Ga0070682_101556405 | 3300005337 | Unclassified | 570 |
| 12 | Ga0070682_101658180 | 3300005337 | Unclassified | 554 |
| 13 | Ga0068868_100002894 | 3300005338 | Bacteria | 11912 |
| 14 | Ga0068868_100008897 | 3300005338 | Bacteria | 7197 |
| 15 | Ga0068868_100031351 | 3300005338 | Bacteria | 4082 |
| 16 | Ga0070660_100587429 | 3300005339 | Unclassified | 931 |
| 17 | Ga0070660_100626889 | 3300005339 | Bacteria | 900 |
| 18 | Ga0070660_100765003 | 3300005339 | Unclassified | 811 |
| 19 | Ga0070660_100825399 | 3300005339 | Unclassified | 780 |
| 20 | Ga0070691_10342842 | 3300005341 | Unclassified | 827 |
| 21 | Ga0070661_100289876 | 3300005344 | Bacteria | 1272 |
| 22 | Ga0070661_100730120 | 3300005344 | Unclassified | 809 |
| 23 | Ga0070661_101273512 | 3300005344 | Unclassified | 616 |
| 24 | Ga0070668_100347110 | 3300005347 | Bacteria | 1255 |
| 25 | Ga0070675_100074237 | 3300005354 | Bacteria | 2825 |
| 26 | Ga0070673_100138140 | 3300005364 | Bacteria | 2053 |
| 27 | Ga0070688_100606648 | 3300005365 | Bacteria | 838 |
| 28 | Ga0070659_100027419 | 3300005366 | Bacteria | 4389 |
| 29 | Ga0070659_100027609 | 3300005366 | Bacteria | 4376 |
| 30 | Ga0070659_100437803 | 3300005366 | Unclassified | 1107 |
| 31 | Ga0070659_102160572 | 3300005366 | Unclassified | 501 |
| 32 | Ga0070667_100043424 | 3300005367 | Bacteria | 3773 |
| 33 | Ga0070709_10074290 | 3300005434 | Bacteria | 2203 |
| 34 | Ga0070709_10240932 | 3300005434 | Unclassified | 1299 |
| 35 | Ga0070714_100016706 | 3300005435 | Bacteria | 5933 |
| 36 | Ga0070714_100018479 | 3300005435 | Bacteria | 5663 |
| 37 | Ga0070714_100091382 | 3300005435 | Bacteria | 2667 |
| 38 | Ga0070714_100551728 | 3300005435 | Unclassified | 1103 |
| 39 | Ga0070713_100000442 | 3300005436 | Bacteria | 26498 |
| 40 | Ga0070713_100049952 | 3300005436 | Plasmid | 3453 |
| 41 | Ga0070713_100218376 | 3300005436 | Unclassified | 1729 |
| 42 | Ga0070713_100489869 | 3300005436 | Unclassified | 1159 |
| 43 | Ga0070713_100687579 | 3300005436 | Bacteria | 976 |
| 44 | Ga0070713_101078419 | 3300005436 | Unclassified | 776 |
| 45 | Ga0070713_101403893 | 3300005436 | Bacteria | 677 |
| 46 | Ga0070710_10038252 | 3300005437 | Bacteria | 2634 |
| 47 | Ga0070710_10042607 | 3300005437 | Bacteria | 2511 |
| 48 | Ga0070710_10074960 | 3300005437 | Unclassified | 1959 |
| 49 | Ga0070710_10615813 | 3300005437 | Unclassified | 757 |
| 50 | Ga0070711_100011992 | 3300005439 | Bacteria | 5399 |
| 51 | Ga0070711_100164006 | 3300005439 | Unclassified | 1687 |
| 52 | Ga0070711_100463306 | 3300005439 | Bacteria | 1039 |
| 53 | Ga0070705_100285962 | 3300005440 | Bacteria | 1175 |
| 54 | Ga0070705_100831355 | 3300005440 | Unclassified | 737 |
| 55 | Ga0070694_100687126 | 3300005444 | Bacteria | 831 |
| 56 | Ga0070708_100029368 | 3300005445 | Bacteria | 4741 |
| 57 | Ga0070708_100051011 | 3300005445 | Bacteria | 3665 |
| 58 | Ga0070708_100554293 | 3300005445 | Bacteria | 1084 |
| 59 | Ga0070708_100840789 | 3300005445 | Bacteria | 862 |
| 60 | Ga0070708_100953837 | 3300005445 | Bacteria | 805 |
| 61 | Ga0070708_101661630 | 3300005445 | Unclassified | 594 |
| 62 | Ga0070708_101837183 | 3300005445 | Unclassified | 562 |
| 63 | Ga0070678_100912872 | 3300005456 | Bacteria | 803 |
| 64 | Ga0070678_101193405 | 3300005456 | Unclassified | 705 |
| 65 | Ga0070678_101356973 | 3300005456 | Bacteria | 663 |
| 66 | Ga0070681_10017399 | 3300005458 | Bacteria | 7184 |
| 67 | Ga0070681_10040972 | 3300005458 | Bacteria | 4640 |
| 68 | Ga0070681_10124471 | 3300005458 | Bacteria | 2511 |
| 69 | Ga0070681_10217021 | 3300005458 | Bacteria | 1828 |
| 70 | Ga0070681_10357559 | 3300005458 | Bacteria | 1370 |
| 71 | Ga0070681_10869929 | 3300005458 | Unclassified | 819 |
| 72 | Ga0068867_100014039 | 3300005459 | Bacteria | 5674 |
| 73 | Ga0068867_100065104 | 3300005459 | Bacteria | 2712 |
| 74 | Ga0068867_101279304 | 3300005459 | Bacteria | 676 |
| 75 | Ga0070706_100030200 | 3300005467 | Bacteria | 4992 |
| 76 | Ga0070706_100764144 | 3300005467 | Bacteria | 895 |
| 77 | Ga0070706_100903580 | 3300005467 | Bacteria | 816 |
| 78 | Ga0070707_100026849 | 3300005468 | Bacteria | 5471 |
| 79 | Ga0070707_100219347 | 3300005468 | Bacteria | 1853 |
| 80 | Ga0070707_100336510 | 3300005468 | Bacteria | 1467 |
| 81 | Ga0070707_100713878 | 3300005468 | Bacteria | 965 |
| 82 | Ga0070707_100893429 | 3300005468 | Bacteria | 853 |
| 83 | Ga0070698_100220888 | 3300005471 | Bacteria | 1828 |
| 84 | Ga0070698_101127260 | 3300005471 | Bacteria | 733 |
| 85 | Ga0070699_100020359 | 3300005518 | Bacteria | 5722 |
| 86 | Ga0070699_100099460 | 3300005518 | Bacteria | 2549 |
| 87 | Ga0070679_100044393 | 3300005530 | Bacteria | 4428 |
| 88 | Ga0070679_100064064 | 3300005530 | Bacteria | 3663 |
| 89 | Ga0070679_100475327 | 3300005530 | Bacteria | 1194 |
| 90 | Ga0070679_100476535 | 3300005530 | Bacteria | 1192 |
| 91 | Ga0070679_101080353 | 3300005530 | Unclassified | 747 |
| 92 | Ga0070679_101362109 | 3300005530 | Bacteria | 655 |
| 93 | Ga0070679_101562226 | 3300005530 | Unclassified | 607 |
| 94 | Ga0070684_100063847 | 3300005535 | Bacteria | 3229 |
| 95 | Ga0070684_100078087 | 3300005535 | Bacteria | 2924 |
| 96 | Ga0070684_100249738 | 3300005535 | Bacteria | 1621 |
| 97 | Ga0070684_100449837 | 3300005535 | Bacteria | 1190 |
| 98 | Ga0070697_100021516 | 3300005536 | Bacteria | 5110 |
| 99 | Ga0070697_101735891 | 3300005536 | Unclassified | 558 |
| 100 | Ga0068853_100034312 | 3300005539 | Bacteria | 4307 |
| 101 | Ga0068853_100289835 | 3300005539 | Bacteria | 1511 |
| 102 | Ga0068853_100350912 | 3300005539 | Bacteria | 1372 |
| 103 | Ga0068853_100678418 | 3300005539 | Archaea | 982 |
| 104 | Ga0070672_100149102 | 3300005543 | Bacteria | 1934 |
| 105 | Ga0070695_100310138 | 3300005545 | Unclassified | 1169 |
| 106 | Ga0070695_100472129 | 3300005545 | Bacteria | 965 |
| 107 | Ga0070693_101312816 | 3300005547 | Bacteria | 560 |
| 108 | Ga0070665_100031090 | 3300005548 | Bacteria | 5373 |
| 109 | Ga0070665_100036584 | 3300005548 | Bacteria | 4937 |
| 110 | Ga0070665_100148815 | 3300005548 | Bacteria | 2344 |
| 111 | Ga0070665_100431283 | 3300005548 | Bacteria | 1327 |
| 112 | Ga0070665_100678888 | 3300005548 | Unclassified | 1043 |
| 113 | Ga0070704_102228388 | 3300005549 | Unclassified | 509 |
| 114 | Ga0068855_100002351 | 3300005563 | Bacteria | 23338 |
| 115 | Ga0068855_100071998 | 3300005563 | Bacteria | 4018 |
| 116 | Ga0068855_100228334 | 3300005563 | Bacteria | 2085 |
| 117 | Ga0068855_100319183 | 3300005563 | Bacteria | 1717 |
| 118 | Ga0068855_100474705 | 3300005563 | Unclassified | 1362 |
| 119 | Ga0068855_100970121 | 3300005563 | Unclassified | 894 |
| 120 | Ga0068855_102529176 | 3300005563 | Bacteria | 510 |
| 121 | Ga0070664_100002308 | 3300005564 | Bacteria | 15323 |
| 122 | Ga0070664_100032319 | 3300005564 | Bacteria | 4376 |
| 123 | Ga0070664_100499123 | 3300005564 | Unclassified | 1121 |
| 124 | Ga0070664_100927158 | 3300005564 | Archaea | 817 |
| 125 | Ga0068857_100001625 | 3300005577 | Bacteria | 18054 |
| 126 | Ga0068857_100009294 | 3300005577 | Bacteria | 8530 |
| 127 | Ga0068857_100017654 | 3300005577 | Bacteria | 6256 |
| 128 | Ga0068857_100017799 | 3300005577 | Bacteria | 6230 |
| 129 | Ga0068857_100299249 | 3300005577 | Bacteria | 1483 |
| 130 | Ga0068854_100000550 | 3300005578 | Bacteria | 22638 |
| 131 | Ga0068854_100107531 | 3300005578 | Bacteria | 2100 |
| 132 | Ga0068854_100813515 | 3300005578 | Archaea | 815 |
| 133 | Ga0068856_100012294 | 3300005614 | Bacteria | 8289 |
| 134 | Ga0068856_100020440 | 3300005614 | Bacteria | 6430 |
| 135 | Ga0068856_100208256 | 3300005614 | Bacteria | 1970 |
| 136 | Ga0068856_100210529 | 3300005614 | Unclassified | 1959 |
| 137 | Ga0068856_100516595 | 3300005614 | Unclassified | 1215 |
| 138 | Ga0068856_100622509 | 3300005614 | Unclassified | 1100 |
| 139 | Ga0068856_101355646 | 3300005614 | Bacteria | 726 |
| 140 | Ga0068856_102409072 | 3300005614 | Unclassified | 534 |
| 141 | Ga0070702_100118126 | 3300005615 | Bacteria | 1656 |
| 142 | Ga0068852_100014168 | 3300005616 | Bacteria | 6124 |
| 143 | Ga0068852_101298438 | 3300005616 | Unclassified | 749 |
| 144 | Ga0068852_102599165 | 3300005616 | Unclassified | 526 |
| 145 | Ga0068859_100019717 | 3300005617 | Bacteria | 6772 |
| 146 | Ga0068859_100149235 | 3300005617 | Bacteria | 2413 |
| 147 | Ga0068859_100951382 | 3300005617 | Unclassified | 942 |
| 148 | Ga0068864_100000254 | 3300005618 | Bacteria | 47729 |
| 149 | Ga0068864_101111067 | 3300005618 | Unclassified | 787 |
| 150 | Ga0068866_10002768 | 3300005718 | Bacteria | 7233 |
| 151 | Ga0068866_10034683 | 3300005718 | Bacteria | 2459 |
| 152 | Ga0068861_100302605 | 3300005719 | Bacteria | 1386 |
| 153 | Ga0068851_10978202 | 3300005834 | Unclassified | 533 |
| 154 | Ga0068863_100038545 | 3300005841 | Bacteria | 4547 |
| 155 | Ga0068858_100008626 | 3300005842 | Bacteria | 9792 |
| 156 | Ga0068858_100040847 | 3300005842 | Bacteria | 4303 |
| 157 | Ga0068858_101591650 | 3300005842 | Unclassified | 645 |
| 158 | Ga0068860_100030407 | 3300005843 | Bacteria | 5194 |
| 159 | Ga0068860_100364616 | 3300005843 | Bacteria | 1424 |
| 160 | Ga0068860_100501062 | 3300005843 | Bacteria | 1212 |
| 161 | Ga0068860_100748227 | 3300005843 | Unclassified | 989 |
| 162 | Ga0068860_101346582 | 3300005843 | Bacteria | 735 |
| 163 | Ga0068862_102398101 | 3300005844 | Unclassified | 539 |
| 164 | Ga0070717_10007014 | 3300006028 | Bacteria | 8339 |
| 165 | Ga0070717_10027062 | 3300006028 | Bacteria | 4581 |
| 166 | Ga0070717_10030846 | 3300006028 | Bacteria | 4308 |
| 167 | Ga0070717_10137584 | 3300006028 | Bacteria | 2104 |
| 168 | Ga0070717_10144510 | 3300006028 | Unclassified | 2054 |
| 169 | Ga0070717_10332521 | 3300006028 | Bacteria | 1355 |
| 170 | Ga0070717_10793686 | 3300006028 | Unclassified | 861 |
| 171 | Ga0070717_10995017 | 3300006028 | Bacteria | 764 |
| 172 | Ga0070717_11067185 | 3300006028 | Unclassified | 736 |
| 173 | Ga0070717_11198346 | 3300006028 | Unclassified | 691 |
| 174 | Ga0070717_12133576 | 3300006028 | Unclassified | 504 |
| 175 | Ga0070715_10001048 | 3300006163 | Bacteria | 7808 |
| 176 | Ga0070715_10421996 | 3300006163 | Unclassified | 746 |
| 177 | Ga0070716_100004491 | 3300006173 | Bacteria | 6676 |
| 178 | Ga0070712_100000284 | 3300006175 | Bacteria | 28610 |
| 179 | Ga0070712_100341313 | 3300006175 | Bacteria | 1223 |
| 180 | Ga0070712_100639590 | 3300006175 | Unclassified | 903 |
| 181 | Ga0070712_100894110 | 3300006175 | Unclassified | 765 |
| 182 | Ga0097621_100007110 | 3300006237 | Bacteria | 7980 |
| 183 | Ga0097621_100020116 | 3300006237 | Bacteria | 5140 |
| 184 | Ga0097621_100039367 | 3300006237 | Bacteria | 3797 |
| 185 | Ga0097621_100095177 | 3300006237 | Bacteria | 2497 |
| 186 | Ga0097621_100289518 | 3300006237 | Unclassified | 1444 |
| 187 | Ga0097621_100295478 | 3300006237 | Unclassified | 1429 |
| 188 | Ga0097621_100443815 | 3300006237 | Bacteria | 1168 |
| 189 | Ga0097621_100448768 | 3300006237 | Bacteria | 1162 |
| 190 | Ga0097621_100482910 | 3300006237 | Bacteria | 1120 |
| 191 | Ga0068871_100010030 | 3300006358 | Bacteria | 6887 |
| 192 | Ga0068871_100013601 | 3300006358 | Bacteria | 6043 |
| 193 | Ga0068871_100034909 | 3300006358 | Bacteria | 3994 |
| 194 | Ga0068871_100123609 | 3300006358 | Bacteria | 2188 |
| 195 | Ga0068871_100715884 | 3300006358 | Bacteria | 918 |
| 196 | Ga0068871_100785617 | 3300006358 | Unclassified | 877 |
| 197 | Ga0068871_101894123 | 3300006358 | Unclassified | 567 |
| 198 | Ga0068871_102053230 | 3300006358 | Unclassified | 544 |
| 199 | Ga0068871_102106200 | 3300006358 | Bacteria | 537 |
| 200 | Ga0075431_101353023 | 3300006847 | Bacteria | 672 |
| 201 | Ga0075433_10550598 | 3300006852 | Unclassified | 1014 |
| 202 | Ga0075434_100005411 | 3300006871 | Bacteria | 11618 |
| 203 | Ga0068865_100002578 | 3300006881 | Bacteria | 10756 |
| 204 | Ga0068865_100083878 | 3300006881 | Bacteria | 2295 |
| 205 | Ga0068865_100452674 | 3300006881 | Bacteria | 1062 |
| 206 | Ga0068865_100772114 | 3300006881 | Bacteria | 827 |
| 207 | Ga0075436_100039741 | 3300006914 | Bacteria | 3246 |
| 208 | Ga0075436_100281517 | 3300006914 | Unclassified | 1189 |
| 209 | Ga0097620_100019718 | 3300006931 | Bacteria | 6772 |
| 210 | Ga0097620_100149240 | 3300006931 | Bacteria | 2413 |
| 211 | Ga0097620_100951363 | 3300006931 | Unclassified | 942 |
| 212 | Ga0075435_100278980 | 3300007076 | Unclassified | 1426 |
| 213 | Ga0105240_10076808 | 3300009093 | Plasmid | 4116 |
| 214 | Ga0105240_10259598 | 3300009093 | Bacteria | 2005 |
| 215 | Ga0105240_10465872 | 3300009093 | Bacteria | 1411 |
| 216 | Ga0105240_10625084 | 3300009093 | Bacteria | 1183 |
| 217 | Ga0105240_10627410 | 3300009093 | Bacteria | 1180 |
| 218 | Ga0105240_10758786 | 3300009093 | Unclassified | 1054 |
| 219 | Ga0105240_11210389 | 3300009093 | Unclassified | 799 |
| 220 | Ga0105240_11442731 | 3300009093 | Bacteria | 723 |
| 221 | Ga0105240_11469862 | 3300009093 | Unclassified | 715 |
| 222 | Ga0111539_11802959 | 3300009094 | Unclassified | 710 |
| 223 | Ga0105245_10011028 | 3300009098 | Bacteria | 7866 |
| 224 | Ga0105245_10017355 | 3300009098 | Bacteria | 6279 |
| 225 | Ga0105245_10091863 | 3300009098 | Bacteria | 2794 |
| 226 | Ga0105245_10362579 | 3300009098 | Archaea | 1438 |
| 227 | Ga0105245_10817623 | 3300009098 | Bacteria | 970 |
| 228 | Ga0105245_11119170 | 3300009098 | Unclassified | 834 |
| 229 | Ga0105245_11382564 | 3300009098 | Bacteria | 754 |
| 230 | Ga0105243_11402929 | 3300009148 | Bacteria | 719 |
| 231 | Ga0105241_10008917 | 3300009174 | Bacteria | 7373 |
| 232 | Ga0105241_10113823 | 3300009174 | Bacteria | 2169 |
| 233 | Ga0105241_10242262 | 3300009174 | Bacteria | 1525 |
| 234 | Ga0105241_10388839 | 3300009174 | Bacteria | 1221 |
| 235 | Ga0105241_10439830 | 3300009174 | Unclassified | 1151 |
| 236 | Ga0105241_10625054 | 3300009174 | Unclassified | 975 |
| 237 | Ga0105241_10822327 | 3300009174 | Unclassified | 857 |
| 238 | Ga0105241_11322356 | 3300009174 | Unclassified | 687 |
| 239 | Ga0105242_10010190 | 3300009176 | Bacteria | 7201 |
| 240 | Ga0105242_10053036 | 3300009176 | Bacteria | 3310 |
| 241 | Ga0105242_10110145 | 3300009176 | Bacteria | 2345 |
| 242 | Ga0105242_10195919 | 3300009176 | Unclassified | 1792 |
| 243 | Ga0105242_10208502 | 3300009176 | Unclassified | 1740 |
| 244 | Ga0105242_10238308 | 3300009176 | Bacteria | 1634 |
| 245 | Ga0105242_10948377 | 3300009176 | Bacteria | 864 |
| 246 | Ga0105242_11905767 | 3300009176 | Unclassified | 635 |
| 247 | Ga0105248_10013796 | 3300009177 | Bacteria | 8893 |
| 248 | Ga0105248_10059685 | 3300009177 | Bacteria | 4285 |
| 249 | Ga0105248_10356946 | 3300009177 | Bacteria | 1646 |
| 250 | Ga0105248_11366544 | 3300009177 | Bacteria | 801 |
| 251 | Ga0105237_10025507 | 3300009545 | Bacteria | 6046 |
| 252 | Ga0105237_10027372 | 3300009545 | Bacteria | 5820 |
| 253 | Ga0105237_10065137 | 3300009545 | Bacteria | 3640 |
| 254 | Ga0105237_10074855 | 3300009545 | Unclassified | 3378 |
| 255 | Ga0105237_10376230 | 3300009545 | Bacteria | 1425 |
| 256 | Ga0105237_10380322 | 3300009545 | Unclassified | 1417 |
| 257 | Ga0105237_10583079 | 3300009545 | Unclassified | 1125 |
| 258 | Ga0105237_10944154 | 3300009545 | Unclassified | 869 |
| 259 | Ga0105237_11033942 | 3300009545 | Unclassified | 828 |
| 260 | Ga0105237_11978616 | 3300009545 | Unclassified | 591 |
| 261 | Ga0105238_10003228 | 3300009551 | Bacteria | 16291 |
| 262 | Ga0105238_10018824 | 3300009551 | Bacteria | 7029 |
| 263 | Ga0105238_10088384 | 3300009551 | Bacteria | 3085 |
| 264 | Ga0105238_10167710 | 3300009551 | Bacteria | 2172 |
| 265 | Ga0105238_10168302 | 3300009551 | Bacteria | 2168 |
| 266 | Ga0105238_10299853 | 3300009551 | Bacteria | 1590 |
| 267 | Ga0105238_10556495 | 3300009551 | Unclassified | 1152 |
| 268 | Ga0105238_10746944 | 3300009551 | Bacteria | 992 |
| 269 | Ga0105249_11318991 | 3300009553 | Bacteria | 793 |
| 270 | Ga0105239_10009183 | 3300010375 | Bacteria | 11181 |
| 271 | Ga0105239_10027061 | 3300010375 | Bacteria | 6313 |
| 272 | Ga0105239_10147659 | 3300010375 | Bacteria | 2623 |
| 273 | Ga0105239_10226706 | 3300010375 | Bacteria | 2096 |
| 274 | Ga0105239_10227980 | 3300010375 | Unclassified | 2090 |
| 275 | Ga0105239_10381904 | 3300010375 | Bacteria | 1593 |
| 276 | Ga0105239_11716092 | 3300010375 | Bacteria | 727 |
| 277 | Ga0105239_12277922 | 3300010375 | Unclassified | 630 |
| 278 | Ga0105246_10132961 | 3300011119 | Bacteria | 1861 |
| 279 | Ga0105246_10315388 | 3300011119 | Unclassified | 1268 |
| 280 | Ga0105246_10634397 | 3300011119 | Bacteria | 928 |
| 281 | Ga0157373_10043557 | 3300013100 | Bacteria | 3206 |
| 282 | Ga0157373_10181387 | 3300013100 | Bacteria | 1482 |
| 283 | Ga0157373_10386962 | 3300013100 | Bacteria | 1001 |
| 284 | Ga0157373_11453867 | 3300013100 | Unclassified | 522 |
| 285 | Ga0157371_10114140 | 3300013102 | Bacteria | 1918 |
| 286 | Ga0157370_10202492 | 3300013104 | Bacteria | 1841 |
| 287 | Ga0157370_10295190 | 3300013104 | Bacteria | 1497 |
| 288 | Ga0157370_10481625 | 3300013104 | Unclassified | 1140 |
| 289 | Ga0157370_10778484 | 3300013104 | Unclassified | 871 |
| 290 | Ga0157370_11940508 | 3300013104 | Unclassified | 528 |
| 291 | Ga0157369_10135547 | 3300013105 | Bacteria | 2607 |
| 292 | Ga0157369_10211676 | 3300013105 | Bacteria | 2031 |
| 293 | Ga0157369_10213815 | 3300013105 | Bacteria | 2020 |
| 294 | Ga0157369_11070884 | 3300013105 | Unclassified | 824 |
| 295 | Ga0157369_11301759 | 3300013105 | Bacteria | 741 |
| 296 | Ga0157374_10000623 | 3300013296 | Bacteria | 31137 |
| 297 | Ga0157374_10014478 | 3300013296 | Bacteria | 6902 |
| 298 | Ga0157374_10401862 | 3300013296 | Unclassified | 1367 |
| 299 | Ga0157374_10519896 | 3300013296 | Unclassified | 1196 |
| 300 | Ga0157378_10000217 | 3300013297 | Bacteria | 55710 |
| 301 | Ga0157378_10043628 | 3300013297 | Bacteria | 3982 |
| 302 | Ga0157378_10245971 | 3300013297 | Bacteria | 1710 |
| 303 | Ga0157378_10246598 | 3300013297 | Unclassified | 1708 |
| 304 | Ga0157378_10628435 | 3300013297 | Bacteria | 1088 |
| 305 | Ga0157378_10654888 | 3300013297 | Unclassified | 1066 |
| 306 | Ga0157378_11273735 | 3300013297 | Unclassified | 776 |
| 307 | Ga0157378_11468052 | 3300013297 | Unclassified | 726 |
| 308 | Ga0163162_10029610 | 3300013306 | Bacteria | 5419 |
| 309 | Ga0163162_10056432 | 3300013306 | Bacteria | 3955 |
| 310 | Ga0163162_10102308 | 3300013306 | Unclassified | 2958 |
| 311 | Ga0163162_11358051 | 3300013306 | Bacteria | 808 |
| 312 | Ga0163162_12069787 | 3300013306 | Unclassified | 653 |
| 313 | Ga0157372_10001157 | 3300013307 | Bacteria | 28525 |
| 314 | Ga0157372_10016198 | 3300013307 | Bacteria | 7998 |
| 315 | Ga0157372_10034062 | 3300013307 | Bacteria | 5596 |
| 316 | Ga0157372_10182241 | 3300013307 | Bacteria | 2431 |
| 317 | Ga0157372_10212186 | 3300013307 | Bacteria | 2244 |
| 318 | Ga0157372_10299874 | 3300013307 | Unclassified | 1869 |
| 319 | Ga0157372_10306503 | 3300013307 | Bacteria | 1848 |
| 320 | Ga0157372_10354734 | 3300013307 | Unclassified | 1709 |
| 321 | Ga0157372_11380829 | 3300013307 | Unclassified | 812 |
| 322 | Ga0157372_12032048 | 3300013307 | Unclassified | 660 |
| 323 | Ga0157372_12203935 | 3300013307 | Unclassified | 633 |
| 324 | Ga0157375_11271556 | 3300013308 | Unclassified | 864 |
| 325 | Ga0163163_10035576 | 3300014325 | Bacteria | 4832 |
| 326 | Ga0163163_10493854 | 3300014325 | Bacteria | 1286 |
| 327 | Ga0163163_10699046 | 3300014325 | Bacteria | 1077 |
| 328 | Ga0163163_11615594 | 3300014325 | Bacteria | 709 |
| 329 | Ga0163163_12377630 | 3300014325 | Unclassified | 588 |
| 330 | Ga0157377_10078427 | 3300014745 | Bacteria | 1925 |
| 331 | Ga0157376_10025238 | 3300014969 | Bacteria | 4679 |
| 332 | Ga0157376_11001275 | 3300014969 | Bacteria | 858 |
| 333 | Ga0157376_12239593 | 3300014969 | Bacteria | 585 |
| 334 | Ga0157376_12388023 | 3300014969 | Unclassified | 568 |
| 335 | Ga0213873_10041902 | 3300021358 | Unclassified | 1182 |
| 336 | Ga0213874_10057501 | 3300021377 | Bacteria | 1210 |
| 337 | Ga0213875_10081610 | 3300021388 | Bacteria | 1508 |
| 338 | Ga0213875_10670822 | 3300021388 | Bacteria | 503 |
| 339 | Ga0207656_10236796 | 3300025321 | Bacteria | 891 |
| 340 | Ga0207692_10056007 | 3300025898 | Bacteria | 2021 |
| 341 | Ga0207692_10124495 | 3300025898 | Unclassified | 1448 |
| 342 | Ga0207642_10047698 | 3300025899 | Bacteria | 1916 |
| 343 | Ga0207642_10050242 | 3300025899 | Bacteria | 1880 |
| 344 | Ga0207647_10047576 | 3300025904 | Bacteria | 2667 |
| 345 | Ga0207647_10341482 | 3300025904 | Bacteria | 849 |
| 346 | Ga0207685_10000448 | 3300025905 | Bacteria | 6876 |
| 347 | Ga0207699_10246559 | 3300025906 | Bacteria | 1229 |
| 348 | Ga0207699_10268892 | 3300025906 | Bacteria | 1181 |
| 349 | Ga0207699_10346453 | 3300025906 | Unclassified | 1048 |
| 350 | Ga0207645_10280625 | 3300025907 | Bacteria | 1106 |
| 351 | Ga0207705_10214797 | 3300025909 | Bacteria | 1459 |
| 352 | Ga0207684_10009193 | 3300025910 | Bacteria | 8741 |
| 353 | Ga0207684_10708183 | 3300025910 | Bacteria | 855 |
| 354 | Ga0207654_10071561 | 3300025911 | Bacteria | 2062 |
| 355 | Ga0207654_10258359 | 3300025911 | Bacteria | 1170 |
| 356 | Ga0207654_11107052 | 3300025911 | Unclassified | 577 |
| 357 | Ga0207707_10009951 | 3300025912 | Bacteria | 8246 |
| 358 | Ga0207707_10013326 | 3300025912 | Bacteria | 7166 |
| 359 | Ga0207707_10175973 | 3300025912 | Bacteria | 1869 |
| 360 | Ga0207707_10692770 | 3300025912 | Archaea | 856 |
| 361 | Ga0207707_10936347 | 3300025912 | Unclassified | 714 |
| 362 | Ga0207695_10010580 | 3300025913 | Bacteria | 11277 |
| 363 | Ga0207695_10028548 | 3300025913 | Bacteria | 6184 |
| 364 | Ga0207695_10058596 | 3300025913 | Plasmid | 3997 |
| 365 | Ga0207695_10130146 | 3300025913 | Bacteria | 2475 |
| 366 | Ga0207695_10225422 | 3300025913 | Unclassified | 1781 |
| 367 | Ga0207695_10621039 | 3300025913 | Unclassified | 962 |
| 368 | Ga0207695_11138730 | 3300025913 | Unclassified | 660 |
| 369 | Ga0207695_11405328 | 3300025913 | Unclassified | 578 |
| 370 | Ga0207671_10060624 | 3300025914 | Bacteria | 2807 |
| 371 | Ga0207671_10212739 | 3300025914 | Bacteria | 1513 |
| 372 | Ga0207671_10469652 | 3300025914 | Unclassified | 1002 |
| 373 | Ga0207671_10618316 | 3300025914 | Unclassified | 863 |
| 374 | Ga0207671_10692228 | 3300025914 | Bacteria | 811 |
| 375 | Ga0207693_10000038 | 3300025915 | Bacteria | 109225 |
| 376 | Ga0207693_10542464 | 3300025915 | Unclassified | 907 |
| 377 | Ga0207663_10000445 | 3300025916 | Bacteria | 17932 |
| 378 | Ga0207663_10463694 | 3300025916 | Bacteria | 979 |
| 379 | Ga0207663_11549430 | 3300025916 | Unclassified | 533 |
| 380 | Ga0207660_10481556 | 3300025917 | Bacteria | 1006 |
| 381 | Ga0207660_11042990 | 3300025917 | Unclassified | 667 |
| 382 | Ga0207657_10282475 | 3300025919 | Bacteria | 1317 |
| 383 | Ga0207657_10943993 | 3300025919 | Bacteria | 663 |
| 384 | Ga0207657_10963403 | 3300025919 | Unclassified | 655 |
| 385 | Ga0207649_10103521 | 3300025920 | Bacteria | 1889 |
| 386 | Ga0207649_10301361 | 3300025920 | Bacteria | 1172 |
| 387 | Ga0207649_11192634 | 3300025920 | Unclassified | 601 |
| 388 | Ga0207652_10041168 | 3300025921 | Bacteria | 3926 |
| 389 | Ga0207652_10091447 | 3300025921 | Unclassified | 2676 |
| 390 | Ga0207652_10230846 | 3300025921 | Bacteria | 1668 |
| 391 | Ga0207652_11262756 | 3300025921 | Unclassified | 641 |
| 392 | Ga0207646_10003637 | 3300025922 | Bacteria | 17242 |
| 393 | Ga0207646_10170975 | 3300025922 | Bacteria | 1962 |
| 394 | Ga0207646_10302474 | 3300025922 | Bacteria | 1445 |
| 395 | Ga0207646_10331749 | 3300025922 | Bacteria | 1374 |
| 396 | Ga0207646_10916682 | 3300025922 | Bacteria | 777 |
| 397 | Ga0207694_10054836 | 3300025924 | Bacteria | 3094 |
| 398 | Ga0207694_10101130 | 3300025924 | Bacteria | 2284 |
| 399 | Ga0207694_10171115 | 3300025924 | Bacteria | 1759 |
| 400 | Ga0207694_10454459 | 3300025924 | Unclassified | 1069 |
| 401 | Ga0207694_10741720 | 3300025924 | Unclassified | 829 |
| 402 | Ga0207659_11907120 | 3300025926 | Bacteria | 503 |
| 403 | Ga0207687_10010819 | 3300025927 | Bacteria | 5963 |
| 404 | Ga0207687_10067701 | 3300025927 | Bacteria | 2541 |
| 405 | Ga0207687_10327913 | 3300025927 | Unclassified | 1241 |
| 406 | Ga0207687_10340170 | 3300025927 | Bacteria | 1220 |
| 407 | Ga0207687_10876735 | 3300025927 | Unclassified | 767 |
| 408 | Ga0207687_11681716 | 3300025927 | Unclassified | 544 |
| 409 | Ga0207700_10013866 | 3300025928 | Bacteria | 5263 |
| 410 | Ga0207700_10026719 | 3300025928 | Bacteria | 4029 |
| 411 | Ga0207700_10042606 | 3300025928 | Plasmid | 3329 |
| 412 | Ga0207700_10128601 | 3300025928 | Unclassified | 2065 |
| 413 | Ga0207700_10589345 | 3300025928 | Bacteria | 989 |
| 414 | Ga0207700_11323385 | 3300025928 | Unclassified | 642 |
| 415 | Ga0207700_11356207 | 3300025928 | Bacteria | 633 |
| 416 | Ga0207664_10010919 | 3300025929 | Bacteria | 6432 |
| 417 | Ga0207664_10039862 | 3300025929 | Bacteria | 3648 |
| 418 | Ga0207664_10291058 | 3300025929 | Unclassified | 1435 |
| 419 | Ga0207664_10444997 | 3300025929 | Unclassified | 1156 |
| 420 | Ga0207690_10063398 | 3300025932 | Bacteria | 2520 |
| 421 | Ga0207690_10897882 | 3300025932 | Unclassified | 735 |
| 422 | Ga0207690_10965163 | 3300025932 | Bacteria | 708 |
| 423 | Ga0207690_10970591 | 3300025932 | Unclassified | 706 |
| 424 | Ga0207706_10082985 | 3300025933 | Bacteria | 2817 |
| 425 | Ga0207706_11390545 | 3300025933 | Unclassified | 577 |
| 426 | Ga0207686_10022758 | 3300025934 | Bacteria | 3612 |
| 427 | Ga0207686_10035947 | 3300025934 | Unclassified | 2977 |
| 428 | Ga0207686_10097331 | 3300025934 | Bacteria | 1957 |
| 429 | Ga0207686_10167876 | 3300025934 | Bacteria | 1545 |
| 430 | Ga0207686_10442897 | 3300025934 | Bacteria | 998 |
| 431 | Ga0207686_10647161 | 3300025934 | Bacteria | 836 |
| 432 | Ga0207686_11464945 | 3300025934 | Unclassified | 562 |
| 433 | Ga0207709_10153194 | 3300025935 | Unclassified | 1599 |
| 434 | Ga0207709_11735119 | 3300025935 | Bacteria | 519 |
| 435 | Ga0207704_10398093 | 3300025938 | Bacteria | 1086 |
| 436 | Ga0207704_11918911 | 3300025938 | Unclassified | 509 |
| 437 | Ga0207665_10003824 | 3300025939 | Bacteria | 10060 |
| 438 | Ga0207665_10065768 | 3300025939 | Bacteria | 2466 |
| 439 | Ga0207665_10087981 | 3300025939 | Unclassified | 2148 |
| 440 | Ga0207665_10673484 | 3300025939 | Unclassified | 812 |
| 441 | Ga0207691_11531844 | 3300025940 | Bacteria | 544 |
| 442 | Ga0207711_10027274 | 3300025941 | Bacteria | 4797 |
| 443 | Ga0207711_10310864 | 3300025941 | Bacteria | 1455 |
| 444 | Ga0207711_10433695 | 3300025941 | Unclassified | 1223 |
| 445 | Ga0207689_10011972 | 3300025942 | Bacteria | 7435 |
| 446 | Ga0207661_10074157 | 3300025944 | Bacteria | 2789 |
| 447 | Ga0207661_10174234 | 3300025944 | Bacteria | 1874 |
| 448 | Ga0207661_10209225 | 3300025944 | Bacteria | 1718 |
| 449 | Ga0207661_10396357 | 3300025944 | Bacteria | 1251 |
| 450 | Ga0207679_10005250 | 3300025945 | Bacteria | 8119 |
| 451 | Ga0207679_10976622 | 3300025945 | Unclassified | 776 |
| 452 | Ga0207679_11357273 | 3300025945 | Bacteria | 652 |
| 453 | Ga0207667_10005709 | 3300025949 | Bacteria | 15179 |
| 454 | Ga0207667_10184517 | 3300025949 | Bacteria | 2142 |
| 455 | Ga0207667_10190325 | 3300025949 | Bacteria | 2105 |
| 456 | Ga0207667_10385912 | 3300025949 | Unclassified | 1427 |
| 457 | Ga0207667_10737712 | 3300025949 | Unclassified | 985 |
| 458 | Ga0207667_10918413 | 3300025949 | Unclassified | 866 |
| 459 | Ga0207667_11171767 | 3300025949 | Unclassified | 749 |
| 460 | Ga0207651_10495988 | 3300025960 | Bacteria | 1055 |
| 461 | Ga0207712_10874758 | 3300025961 | Bacteria | 793 |
| 462 | Ga0207668_10644339 | 3300025972 | Unclassified | 927 |
| 463 | Ga0207640_10003176 | 3300025981 | Bacteria | 8848 |
| 464 | Ga0207658_10229592 | 3300025986 | Bacteria | 1566 |
| 465 | Ga0207677_10009222 | 3300026023 | Bacteria | 5542 |
| 466 | Ga0207677_10083528 | 3300026023 | Bacteria | 2299 |
| 467 | Ga0207703_10011649 | 3300026035 | Bacteria | 6839 |
| 468 | Ga0207703_10609417 | 3300026035 | Bacteria | 1033 |
| 469 | Ga0207703_11473114 | 3300026035 | Unclassified | 655 |
| 470 | Ga0207639_10572421 | 3300026041 | Unclassified | 1039 |
| 471 | Ga0207639_11685758 | 3300026041 | Bacteria | 594 |
| 472 | Ga0207639_12074888 | 3300026041 | Bacteria | 530 |
| 473 | Ga0207702_10037217 | 3300026078 | Bacteria | 4072 |
| 474 | Ga0207702_10269803 | 3300026078 | Bacteria | 1604 |
| 475 | Ga0207702_10313003 | 3300026078 | Unclassified | 1493 |
| 476 | Ga0207702_10336646 | 3300026078 | Unclassified | 1441 |
| 477 | Ga0207702_10946513 | 3300026078 | Unclassified | 854 |
| 478 | Ga0207702_11124948 | 3300026078 | Archaea | 779 |
| 479 | Ga0207641_11103024 | 3300026088 | Bacteria | 792 |
| 480 | Ga0207641_11222269 | 3300026088 | Unclassified | 751 |
| 481 | Ga0207648_10012998 | 3300026089 | Bacteria | 7767 |
| 482 | Ga0207648_10102624 | 3300026089 | Bacteria | 2507 |
| 483 | Ga0207676_10028737 | 3300026095 | Bacteria | 4157 |
| 484 | Ga0207676_11021215 | 3300026095 | Unclassified | 815 |
| 485 | Ga0207674_10000257 | 3300026116 | Bacteria | 66462 |
| 486 | Ga0207674_10042637 | 3300026116 | Bacteria | 4684 |
| 487 | Ga0207674_10045452 | 3300026116 | Bacteria | 4517 |
| 488 | Ga0207674_10050783 | 3300026116 | Bacteria | 4235 |
| 489 | Ga0207674_10122853 | 3300026116 | Bacteria | 2562 |
| 490 | Ga0207675_100430899 | 3300026118 | Bacteria | 1304 |
| 491 | Ga0207683_10227717 | 3300026121 | Bacteria | 1699 |
| 492 | Ga0207683_10365165 | 3300026121 | Bacteria | 1326 |
| 493 | Ga0207683_11500205 | 3300026121 | Unclassified | 622 |
| 494 | Ga0207698_10415064 | 3300026142 | Bacteria | 1290 |
| 495 | Ga0207698_10502181 | 3300026142 | Unclassified | 1180 |
| 496 | Ga0207428_11085072 | 3300027907 | Bacteria | 560 |
| 497 | Ga0265357_1025794 | 3300028023 | Unclassified | 659 |
| 498 | Ga0268266_10002897 | 3300028379 | Bacteria | 17780 |
| 499 | Ga0268266_10099235 | 3300028379 | Bacteria | 2563 |
| 500 | Ga0268266_10242658 | 3300028379 | Unclassified | 1663 |
| 501 | Ga0268266_10607042 | 3300028379 | Unclassified | 1051 |
| 502 | Ga0268266_11985222 | 3300028379 | Bacteria | 555 |
| 503 | Ga0268266_12275162 | 3300028379 | Bacteria | 514 |
| 504 | Ga0268264_10551288 | 3300028381 | Bacteria | 1131 |
| 505 | Ga0268264_10837193 | 3300028381 | Bacteria | 921 |
| 506 | Ga0268264_10940444 | 3300028381 | Unclassified | 869 |
| 507 | Ga0268264_11617293 | 3300028381 | Unclassified | 658 |
| 508 | Ga0265338_10015795 | 3300028800 | Bacteria | 8267 |
| 509 | Ga0265338_10314876 | 3300028800 | Unclassified | 1134 |
| 510 | Ga0265324_10071639 | 3300029957 | Unclassified | 1181 |
| 511 | Ga0265762_1000835 | 3300030760 | Bacteria | 5469 |
| 512 | Ga0265762_1015837 | 3300030760 | Bacteria | 1365 |
| 513 | Ga0265760_10003536 | 3300031090 | Bacteria | 4535 |
| 514 | Ga0265760_10151697 | 3300031090 | Bacteria | 760 |
| 515 | Ga0265760_10180275 | 3300031090 | Unclassified | 705 |
| 516 | Ga0265332_10355274 | 3300031238 | Unclassified | 605 |
| 517 | Ga0265325_10157650 | 3300031241 | Bacteria | 1070 |
| 518 | Ga0265340_10064148 | 3300031247 | Bacteria | 1752 |
| 519 | Ga0265340_10488634 | 3300031247 | Unclassified | 542 |
| 520 | Ga0265340_10559492 | 3300031247 | Unclassified | 503 |
| 521 | Ga0265339_10031642 | 3300031249 | Unclassified | 2988 |
| 522 | Ga0265339_10084081 | 3300031249 | Bacteria | 1678 |
| 523 | Ga0265331_10384131 | 3300031250 | Unclassified | 629 |
| 524 | Ga0265316_10003152 | 3300031344 | Bacteria | 16788 |
| 525 | Ga0265316_11057881 | 3300031344 | Unclassified | 564 |
| 526 | Ga0265313_10024891 | 3300031595 | Unclassified | 3185 |
| 527 | Ga0265314_10001555 | 3300031711 | Bacteria | 25292 |
| 528 | Ga0265314_10072115 | 3300031711 | Bacteria | 2308 |
| 529 | Ga0265314_10197520 | 3300031711 | Bacteria | 1192 |
| 530 | Ga0265314_10704304 | 3300031711 | Unclassified | 510 |
| 531 | Ga0307516_10003420 | 3300031730 | Bacteria | 20401 |
| 532 | Ga0307413_11376731 | 3300031824 | Unclassified | 620 |
| 533 | Ga0307409_101176570 | 3300031995 | Unclassified | 790 |
| 534 | Ga0373926_0273403 | 3300035083 | Unclassified | 657 |
| 535 | Ga0373936_0119123 | 3300035113 | Bacteria | 1126 |
| 536 | Ga0373941_0380671 | 3300035115 | Bacteria | 580 |
| 537 | Ga0373945_0034297 | 3300035116 | Bacteria | 1808 |
| 538 | Ga0373960_0131559 | 3300035121 | Bacteria | 840 |
| 539 | Ga0373943_0158856 | 3300035170 | Bacteria | 1229 |
| 540 | Ga0373946_0198704 | 3300035171 | Bacteria | 959 |
| 541 | Ga0373935_0090979 | 3300035692 | Bacteria | 1998 |
| 542 | Ga0373935_0378526 | 3300035692 | Unclassified | 1013 |
| 543 | Ga0373927_0294475 | 3300035695 | Bacteria | 1068 |
| 544 | Ga0373947_0119034 | 3300035725 | Bacteria | 1676 |
| 545 | Ga0373947_0220747 | 3300035725 | Bacteria | 1246 |
| 546 | Ga0373937_0126692 | 3300036401 | Unclassified | 2383 |
| 547 | Ga0373925_0001347 | 3300037068 | Bacteria | 21411 |
| 548 | Ga0373925_0017618 | 3300037068 | Bacteria | 5182 |
| 549 | Ga0373925_1353511 | 3300037068 | Bacteria | 584 |
| 550 | Ga0395899_0103624 | 3300037312 | Bacteria | 2052 |
| 551 | Ga0395900_0011767 | 3300037418 | Bacteria | 8947 |
| 552 | Ga0436364_0196890 | 3300037853 | Unclassified | 1272 |
| 553 | Ga0436364_0619394 | 3300037853 | Bacteria | 504 |
| 554 | Ga0436364_0752135 | 3300037853 | Bacteria | 2048 |
| 555 | Ga0436364_0818917 | 3300037853 | Unclassified | 543 |
| 556 | Ga0436364_1148362 | 3300037853 | Bacteria | 1306 |
| 557 | Ga0395901_0002017 | 3300038443 | Bacteria | 20892 |
| 558 | Ga0436365_0535589 | 3300039437 | Bacteria | 1509 |
| 559 | Ga0436360_0193073 | 3300039438 | Bacteria | 1694 |
| 560 | Ga0436361_0410353 | 3300039447 | Bacteria | 1065 |
| 561 | Ga0436363_1167321 | 3300039450 | Unclassified | 602 |
| 562 | Ga0436363_1325016 | 3300039450 | Bacteria | 5069 |
| 563 | Ga0436362_0461317 | 3300039453 | Unclassified | 1643 |
| 564 | Ga0436362_0554361 | 3300039453 | Bacteria | 1219 |
| 565 | Ga0439439_0129405 | 3300041406 | Unclassified | 708 |
| 566 | Ga0466961_0011063 | 3300044693 | Bacteria | 5767 |
| 567 | Ga0466963_0175031 | 3300044694 | Unclassified | 1497 |
| 568 | Ga0466963_0281212 | 3300044694 | Unclassified | 1169 |
| 569 | Ga0466964_0239003 | 3300044706 | Unclassified | 890 |
| 570 | Ga0466971_0087345 | 3300044719 | Bacteria | 1426 |
| 571 | Ga0466970_0348604 | 3300044765 | Bacteria | 840 |
| 572 | Ga0466958_0214639 | 3300045836 | Unclassified | 1227 |
| 573 | Ga0466958_0458552 | 3300045836 | Unclassified | 826 |
| 574 | Ga0466967_0001421 | 3300045976 | Bacteria | 13862 |
| 575 | Ga0466967_0430875 | 3300045976 | Bacteria | 1286 |
| 576 | Ga0495629_0118858 | 3300046459 | Bacteria | 1841 |
| 577 | Ga0495653_0261535 | 3300046463 | Unclassified | 1144 |
| 578 | Ga0495580_0000798 | 3300046472 | Bacteria | 27239 |
| 579 | Ga0495580_0543819 | 3300046472 | Bacteria | 772 |
| 580 | Ga0495580_0619788 | 3300046472 | Unclassified | 714 |
| 581 | Ga0495580_1105985 | 3300046472 | Bacteria | 501 |
| 582 | Ga0495582_0024473 | 3300046473 | Bacteria | 3304 |
| 583 | Ga0495594_0377887 | 3300046499 | Bacteria | 806 |
| 584 | Ga0495623_0260879 | 3300046679 | Unclassified | 971 |
| 585 | Ga0495658_0106168 | 3300046683 | Bacteria | 1683 |
| 586 | Ga0495669_0137851 | 3300046684 | Unclassified | 1151 |
| 587 | Ga0495581_0248192 | 3300047315 | Bacteria | 1041 |
| 588 | Ga0495684_0406906 | 3300047471 | Unclassified | 954 |
| 589 | Ga0495593_0233808 | 3300047673 | Bacteria | 921 |
| 590 | Ga0495602_0707789 | 3300048088 | Unclassified | 683 |
| 591 | Ga0496100_0067036 | 3300048903 | Bacteria | 2383 |
| 592 | Ga0496102_1232163 | 3300048905 | Unclassified | 668 |
| 593 | Ga0496102_1664110 | 3300048905 | Archaea | 556 |
| 594 | Ga0496104_0066133 | 3300048907 | Bacteria | 3432 |
| 595 | Ga0496104_0072229 | 3300048907 | Bacteria | 3281 |
| 596 | Ga0496110_1733965 | 3300048913 | Bacteria | 535 |
| 597 | Ga0496112_1618076 | 3300048915 | Unclassified | 561 |
| 598 | Ga0496114_0684998 | 3300048917 | Bacteria | 900 |
| 599 | Ga0496115_0034645 | 3300048918 | Bacteria | 3990 |
| 600 | Ga0501031_0062891 | 3300049568 | Bacteria | 2418 |
| 601 | Ga0501032_0041923 | 3300049569 | Bacteria | 3106 |
| 602 | Ga0501032_0138183 | 3300049569 | Bacteria | 1605 |
| 603 | Ga0501032_0158509 | 3300049569 | Bacteria | 1486 |
| 604 | Ga0501032_0388158 | 3300049569 | Unclassified | 897 |
| 605 | Ga0501033_0040142 | 3300049570 | Bacteria | 3494 |
| 606 | Ga0501033_0090141 | 3300049570 | Bacteria | 2243 |
| 607 | Ga0501033_0198553 | 3300049570 | Bacteria | 1433 |
| 608 | Ga0501033_0242516 | 3300049570 | Unclassified | 1278 |
| 609 | Ga0501033_0594288 | 3300049570 | Bacteria | 759 |
| 610 | Ga0501034_0000778 | 3300049571 | Bacteria | 47744 |
| 611 | Ga0501034_0085510 | 3300049571 | Bacteria | 3155 |
| 612 | Ga0501034_0185782 | 3300049571 | Bacteria | 2042 |
| 613 | Ga0501034_0233221 | 3300049571 | Bacteria | 1789 |
| 614 | Ga0501036_0008377 | 3300049572 | Bacteria | 8475 |
| 615 | Ga0501036_0195775 | 3300049572 | Bacteria | 1700 |
| 616 | Ga0501036_0386102 | 3300049572 | Unclassified | 1168 |
| 617 | Ga0501037_0004949 | 3300049573 | Bacteria | 9689 |
| 618 | Ga0501037_0301753 | 3300049573 | Bacteria | 1112 |
| 619 | Ga0501037_0322924 | 3300049573 | Bacteria | 1068 |
| 620 | Ga0501037_0904404 | 3300049573 | Unclassified | 578 |
| 621 | Ga0501038_0152306 | 3300049574 | Bacteria | 1884 |
| 622 | Ga0501038_0439908 | 3300049574 | Bacteria | 1004 |
| 623 | Ga0501039_0164309 | 3300049575 | Bacteria | 1745 |
| 624 | Ga0501039_0656785 | 3300049575 | Bacteria | 821 |
| 625 | Ga0501040_0180109 | 3300049576 | Bacteria | 1498 |
| 626 | Ga0501043_0125140 | 3300049579 | Bacteria | 2015 |
| 627 | Ga0501043_0152295 | 3300049579 | Bacteria | 1809 |
| 628 | Ga0501043_0553222 | 3300049579 | Bacteria | 854 |
| 629 | Ga0501046_0058561 | 3300049580 | Bacteria | 3019 |
| 630 | Ga0501046_0302697 | 3300049580 | Bacteria | 1167 |
| 631 | Ga0501047_0133728 | 3300049581 | Bacteria | 2360 |
| 632 | Ga0501047_0140719 | 3300049581 | Bacteria | 2291 |
| 633 | Ga0501047_0656246 | 3300049581 | Bacteria | 868 |
| 634 | Ga0501048_0942009 | 3300049582 | Unclassified | 621 |
| 635 | Ga0501070_0084865 | 3300049586 | Bacteria | 2622 |
| 636 | Ga0501257_000588 | 3300049686 | Bacteria | 7187 |
| 637 | Ga0501035_0000386 | 3300049822 | Bacteria | 50709 |
| 638 | Ga0501035_0350821 | 3300049822 | Bacteria | 1234 |
| 639 | Ga0501035_0387735 | 3300049822 | Unclassified | 1164 |
| 640 | Ga0501044_0004473 | 3300049823 | Bacteria | 15631 |
| 641 | Ga0501044_0129884 | 3300049823 | Bacteria | 2514 |
| 642 | Ga0501044_0166866 | 3300049823 | Bacteria | 2175 |
| 643 | Ga0501044_0171915 | 3300049823 | Bacteria | 2138 |
| 644 | Ga0501044_0381224 | 3300049823 | Unclassified | 1325 |
| 645 | Ga0501044_0588185 | 3300049823 | Bacteria | 1007 |
| 646 | Ga0501044_1058709 | 3300049823 | Unclassified | 681 |
| 647 | nmdc:mga06r32_1509110_c1 | 3300050510 | Bacteria | 612 |
| 648 | nmdc:mga08y16_1439571_c1 | 3300050511 | Bacteria | 651 |
| 649 | nmdc:mga0n895_4119_c1 | 3300050512 | Bacteria | 11850 |
| 650 | nmdc:mga0rr50_199678_c1 | 3300050513 | Unclassified | 1643 |
| 651 | nmdc:mga08x19_1278777_c1 | 3300050514 | Unclassified | 520 |
| 652 | nmdc:mga08x19_28256_c1 | 3300050514 | Bacteria | 3512 |
| 653 | nmdc:mga08x19_93699_c1 | 3300050514 | Unclassified | 1985 |
| 654 | nmdc:mga0a205_418568_c1 | 3300050515 | Unclassified | 1202 |
| 655 | Ga0500595_043391 | 3300053119 | Bacteria | 1432 |
| 656 | Ga0500568_0387741 | 3300053139 | Bacteria | 506 |
| 657 | Ga0500616_0043063 | 3300053153 | Bacteria | 2414 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005436 | Ga0070713_101403893 | Ga0070713_1014038931 | 74 |
| 2 | 3300005437 | Ga0070710_10615813 | Ga0070710_106158132 | 74 |
| 3 | 3300005439 | Ga0070711_100463306 | Ga0070711_1004633062 | 74 |
| 4 | 3300025916 | Ga0207663_10463694 | Ga0207663_104636942 | 74 |
| 5 | 3300025928 | Ga0207700_11356207 | Ga0207700_113562072 | 74 |
| 6 | 3300005327 | Ga0070658_10914189 | Ga0070658_109141892 | 75 |
| 7 | 3300005328 | Ga0070676_10290716 | Ga0070676_102907162 | 75 |
| 8 | 3300005329 | Ga0070683_100046315 | Ga0070683_1000463154 | 75 |
| 9 | 3300005329 | Ga0070683_100289932 | Ga0070683_1002899322 | 75 |
| 10 | 3300005329 | Ga0070683_100530195 | Ga0070683_1005301951 | 75 |
| 11 | 3300005330 | Ga0070690_100982218 | Ga0070690_1009822182 | 75 |
| 12 | 3300005334 | Ga0068869_100045007 | Ga0068869_1000450072 | 75 |
| 13 | 3300005336 | Ga0070680_101035862 | Ga0070680_1010358622 | 75 |
| 14 | 3300005337 | Ga0070682_100199002 | Ga0070682_1001990022 | 75 |
| 15 | 3300005337 | Ga0070682_101134394 | Ga0070682_1011343942 | 75 |
| 16 | 3300005337 | Ga0070682_101556405 | Ga0070682_1015564052 | 75 |
| 17 | 3300005337 | Ga0070682_101658180 | Ga0070682_1016581802 | 75 |
| 18 | 3300005338 | Ga0068868_100002894 | Ga0068868_1000028944 | 75 |
| 19 | 3300005338 | Ga0068868_100008897 | Ga0068868_1000088972 | 75 |
| 20 | 3300005338 | Ga0068868_100031351 | Ga0068868_1000313512 | 75 |
| 21 | 3300005339 | Ga0070660_100587429 | Ga0070660_1005874292 | 75 |
| 22 | 3300005339 | Ga0070660_100626889 | Ga0070660_1006268892 | 75 |
| 23 | 3300005339 | Ga0070660_100765003 | Ga0070660_1007650032 | 75 |
| 24 | 3300005339 | Ga0070660_100825399 | Ga0070660_1008253991 | 75 |
| 25 | 3300005341 | Ga0070691_10342842 | Ga0070691_103428422 | 75 |
| 26 | 3300005344 | Ga0070661_100289876 | Ga0070661_1002898762 | 75 |
| 27 | 3300005344 | Ga0070661_100730120 | Ga0070661_1007301202 | 75 |
| 28 | 3300005344 | Ga0070661_101273512 | Ga0070661_1012735121 | 75 |
| 29 | 3300005347 | Ga0070668_100347110 | Ga0070668_1003471103 | 75 |
| 30 | 3300005354 | Ga0070675_100074237 | Ga0070675_1000742373 | 75 |
| 31 | 3300005364 | Ga0070673_100138140 | Ga0070673_1001381403 | 75 |
| 32 | 3300005365 | Ga0070688_100606648 | Ga0070688_1006066482 | 75 |
| 33 | 3300005366 | Ga0070659_100027419 | Ga0070659_1000274192 | 75 |
| 34 | 3300005366 | Ga0070659_100027609 | Ga0070659_1000276094 | 75 |
| 35 | 3300005366 | Ga0070659_100437803 | Ga0070659_1004378032 | 75 |
| 36 | 3300005366 | Ga0070659_102160572 | Ga0070659_1021605721 | 75 |
| 37 | 3300005367 | Ga0070667_100043424 | Ga0070667_1000434245 | 75 |
| 38 | 3300005434 | Ga0070709_10074290 | Ga0070709_100742904 | 75 |
| 39 | 3300005434 | Ga0070709_10240932 | Ga0070709_102409322 | 75 |
| 40 | 3300005435 | Ga0070714_100016706 | Ga0070714_1000167068 | 75 |
| 41 | 3300005435 | Ga0070714_100018479 | Ga0070714_1000184793 | 75 |
| 42 | 3300005435 | Ga0070714_100091382 | Ga0070714_1000913823 | 75 |
| 43 | 3300005435 | Ga0070714_100551728 | Ga0070714_1005517282 | 75 |
| 44 | 3300005436 | Ga0070713_100000442 | Ga0070713_1000004424 | 75 |
| 45 | 3300005436 | Ga0070713_100049952 | Ga0070713_1000499523 | 75 |
| 46 | 3300005436 | Ga0070713_100218376 | Ga0070713_1002183763 | 75 |
| 47 | 3300005436 | Ga0070713_100489869 | Ga0070713_1004898691 | 75 |
| 48 | 3300005436 | Ga0070713_100687579 | Ga0070713_1006875792 | 75 |
| 49 | 3300005436 | Ga0070713_101078419 | Ga0070713_1010784191 | 75 |
| 50 | 3300005437 | Ga0070710_10038252 | Ga0070710_100382524 | 75 |
| 51 | 3300005437 | Ga0070710_10042607 | Ga0070710_100426072 | 75 |
| 52 | 3300005437 | Ga0070710_10074960 | Ga0070710_100749602 | 75 |
| 53 | 3300005439 | Ga0070711_100011992 | Ga0070711_1000119923 | 75 |
| 54 | 3300005439 | Ga0070711_100164006 | Ga0070711_1001640063 | 75 |
| 55 | 3300005440 | Ga0070705_100285962 | Ga0070705_1002859623 | 75 |
| 56 | 3300005440 | Ga0070705_100831355 | Ga0070705_1008313551 | 75 |
| 57 | 3300005444 | Ga0070694_100687126 | Ga0070694_1006871262 | 75 |
| 58 | 3300005445 | Ga0070708_100029368 | Ga0070708_1000293687 | 75 |
| 59 | 3300005445 | Ga0070708_100051011 | Ga0070708_1000510113 | 75 |
| 60 | 3300005445 | Ga0070708_100554293 | Ga0070708_1005542933 | 75 |
| 61 | 3300005445 | Ga0070708_100840789 | Ga0070708_1008407891 | 75 |
| 62 | 3300005445 | Ga0070708_100953837 | Ga0070708_1009538372 | 75 |
| 63 | 3300005445 | Ga0070708_101661630 | Ga0070708_1016616302 | 75 |
| 64 | 3300005445 | Ga0070708_101837183 | Ga0070708_1018371832 | 75 |
| 65 | 3300005456 | Ga0070678_100912872 | Ga0070678_1009128721 | 75 |
| 66 | 3300005456 | Ga0070678_101193405 | Ga0070678_1011934052 | 75 |
| 67 | 3300005456 | Ga0070678_101356973 | Ga0070678_1013569732 | 75 |
| 68 | 3300005458 | Ga0070681_10017399 | Ga0070681_100173992 | 75 |
| 69 | 3300005458 | Ga0070681_10040972 | Ga0070681_100409723 | 75 |
| 70 | 3300005458 | Ga0070681_10124471 | Ga0070681_101244713 | 75 |
| 71 | 3300005458 | Ga0070681_10217021 | Ga0070681_102170214 | 75 |
| 72 | 3300005458 | Ga0070681_10357559 | Ga0070681_103575592 | 75 |
| 73 | 3300005458 | Ga0070681_10869929 | Ga0070681_108699291 | 75 |
| 74 | 3300005459 | Ga0068867_100014039 | Ga0068867_1000140394 | 75 |
| 75 | 3300005459 | Ga0068867_100065104 | Ga0068867_1000651043 | 75 |
| 76 | 3300005459 | Ga0068867_101279304 | Ga0068867_1012793042 | 75 |
| 77 | 3300005467 | Ga0070706_100030200 | Ga0070706_1000302001 | 75 |
| 78 | 3300005467 | Ga0070706_100764144 | Ga0070706_1007641441 | 75 |
| 79 | 3300005467 | Ga0070706_100903580 | Ga0070706_1009035801 | 75 |
| 80 | 3300005468 | Ga0070707_100026849 | Ga0070707_1000268491 | 75 |
| 81 | 3300005468 | Ga0070707_100219347 | Ga0070707_1002193472 | 75 |
| 82 | 3300005468 | Ga0070707_100336510 | Ga0070707_1003365101 | 75 |
| 83 | 3300005468 | Ga0070707_100713878 | Ga0070707_1007138783 | 75 |
| 84 | 3300005468 | Ga0070707_100893429 | Ga0070707_1008934292 | 75 |
| 85 | 3300005471 | Ga0070698_100220888 | Ga0070698_1002208883 | 75 |
| 86 | 3300005471 | Ga0070698_101127260 | Ga0070698_1011272602 | 75 |
| 87 | 3300005518 | Ga0070699_100020359 | Ga0070699_1000203591 | 75 |
| 88 | 3300005518 | Ga0070699_100099460 | Ga0070699_1000994604 | 75 |
| 89 | 3300005530 | Ga0070679_100044393 | Ga0070679_1000443934 | 75 |
| 90 | 3300005530 | Ga0070679_100064064 | Ga0070679_1000640643 | 75 |
| 91 | 3300005530 | Ga0070679_100475327 | Ga0070679_1004753272 | 75 |
| 92 | 3300005530 | Ga0070679_100476535 | Ga0070679_1004765352 | 75 |
| 93 | 3300005530 | Ga0070679_101080353 | Ga0070679_1010803531 | 75 |
| 94 | 3300005530 | Ga0070679_101362109 | Ga0070679_1013621092 | 75 |
| 95 | 3300005530 | Ga0070679_101562226 | Ga0070679_1015622262 | 75 |
| 96 | 3300005535 | Ga0070684_100063847 | Ga0070684_1000638474 | 75 |
| 97 | 3300005535 | Ga0070684_100078087 | Ga0070684_1000780875 | 75 |
| 98 | 3300005535 | Ga0070684_100249738 | Ga0070684_1002497382 | 75 |
| 99 | 3300005535 | Ga0070684_100449837 | Ga0070684_1004498372 | 75 |
| 100 | 3300005536 | Ga0070697_100021516 | Ga0070697_1000215168 | 75 |
| 101 | 3300005536 | Ga0070697_101735891 | Ga0070697_1017358911 | 75 |
| 102 | 3300005539 | Ga0068853_100034312 | Ga0068853_1000343125 | 75 |
| 103 | 3300005539 | Ga0068853_100289835 | Ga0068853_1002898354 | 75 |
| 104 | 3300005539 | Ga0068853_100350912 | Ga0068853_1003509121 | 75 |
| 105 | 3300005539 | Ga0068853_100678418 | Ga0068853_1006784182 | 75 |
| 106 | 3300005543 | Ga0070672_100149102 | Ga0070672_1001491022 | 75 |
| 107 | 3300005545 | Ga0070695_100310138 | Ga0070695_1003101382 | 75 |
| 108 | 3300005545 | Ga0070695_100472129 | Ga0070695_1004721292 | 75 |
| 109 | 3300005547 | Ga0070693_101312816 | Ga0070693_1013128161 | 75 |
| 110 | 3300005548 | Ga0070665_100031090 | Ga0070665_1000310903 | 75 |
| 111 | 3300005548 | Ga0070665_100036584 | Ga0070665_1000365845 | 75 |
| 112 | 3300005548 | Ga0070665_100148815 | Ga0070665_1001488152 | 75 |
| 113 | 3300005548 | Ga0070665_100431283 | Ga0070665_1004312832 | 75 |
| 114 | 3300005548 | Ga0070665_100678888 | Ga0070665_1006788882 | 75 |
| 115 | 3300005549 | Ga0070704_102228388 | Ga0070704_1022283881 | 75 |
| 116 | 3300005563 | Ga0068855_100002351 | Ga0068855_1000023518 | 75 |
| 117 | 3300005563 | Ga0068855_100071998 | Ga0068855_1000719984 | 75 |
| 118 | 3300005563 | Ga0068855_100228334 | Ga0068855_1002283344 | 75 |
| 119 | 3300005563 | Ga0068855_100319183 | Ga0068855_1003191831 | 75 |
| 120 | 3300005563 | Ga0068855_100474705 | Ga0068855_1004747053 | 75 |
| 121 | 3300005563 | Ga0068855_100970121 | Ga0068855_1009701212 | 75 |
| 122 | 3300005563 | Ga0068855_102529176 | Ga0068855_1025291762 | 75 |
| 123 | 3300005564 | Ga0070664_100002308 | Ga0070664_1000023084 | 75 |
| 124 | 3300005564 | Ga0070664_100032319 | Ga0070664_1000323192 | 75 |
| 125 | 3300005564 | Ga0070664_100499123 | Ga0070664_1004991233 | 75 |
| 126 | 3300005564 | Ga0070664_100927158 | Ga0070664_1009271582 | 75 |
| 127 | 3300005577 | Ga0068857_100001625 | Ga0068857_1000016257 | 75 |
| 128 | 3300005577 | Ga0068857_100009294 | Ga0068857_1000092948 | 75 |
| 129 | 3300005577 | Ga0068857_100017654 | Ga0068857_1000176544 | 75 |
| 130 | 3300005577 | Ga0068857_100017799 | Ga0068857_1000177992 | 75 |
| 131 | 3300005577 | Ga0068857_100299249 | Ga0068857_1002992493 | 75 |
| 132 | 3300005578 | Ga0068854_100000550 | Ga0068854_10000055012 | 75 |
| 133 | 3300005578 | Ga0068854_100107531 | Ga0068854_1001075311 | 75 |
| 134 | 3300005578 | Ga0068854_100813515 | Ga0068854_1008135151 | 75 |
| 135 | 3300005614 | Ga0068856_100012294 | Ga0068856_1000122946 | 75 |
| 136 | 3300005614 | Ga0068856_100020440 | Ga0068856_1000204403 | 75 |
| 137 | 3300005614 | Ga0068856_100208256 | Ga0068856_1002082563 | 75 |
| 138 | 3300005614 | Ga0068856_100210529 | Ga0068856_1002105292 | 75 |
| 139 | 3300005614 | Ga0068856_100516595 | Ga0068856_1005165952 | 75 |
| 140 | 3300005614 | Ga0068856_100622509 | Ga0068856_1006225092 | 75 |
| 141 | 3300005614 | Ga0068856_101355646 | Ga0068856_1013556462 | 75 |
| 142 | 3300005614 | Ga0068856_102409072 | Ga0068856_1024090721 | 75 |
| 143 | 3300005615 | Ga0070702_100118126 | Ga0070702_1001181262 | 75 |
| 144 | 3300005616 | Ga0068852_100014168 | Ga0068852_1000141683 | 75 |
| 145 | 3300005616 | Ga0068852_101298438 | Ga0068852_1012984382 | 75 |
| 146 | 3300005616 | Ga0068852_102599165 | Ga0068852_1025991652 | 75 |
| 147 | 3300005617 | Ga0068859_100019717 | Ga0068859_1000197177 | 75 |
| 148 | 3300005617 | Ga0068859_100149235 | Ga0068859_1001492353 | 75 |
| 149 | 3300005617 | Ga0068859_100951382 | Ga0068859_1009513822 | 75 |
| 150 | 3300005618 | Ga0068864_100000254 | Ga0068864_1000002545 | 75 |
| 151 | 3300005618 | Ga0068864_101111067 | Ga0068864_1011110672 | 75 |
| 152 | 3300005718 | Ga0068866_10002768 | Ga0068866_100027688 | 75 |
| 153 | 3300005718 | Ga0068866_10034683 | Ga0068866_100346834 | 75 |
| 154 | 3300005719 | Ga0068861_100302605 | Ga0068861_1003026053 | 75 |
| 155 | 3300005834 | Ga0068851_10978202 | Ga0068851_109782021 | 75 |
| 156 | 3300005841 | Ga0068863_100038545 | Ga0068863_1000385454 | 75 |
| 157 | 3300005842 | Ga0068858_100008626 | Ga0068858_1000086262 | 75 |
| 158 | 3300005842 | Ga0068858_100040847 | Ga0068858_1000408474 | 75 |
| 159 | 3300005842 | Ga0068858_101591650 | Ga0068858_1015916502 | 75 |
| 160 | 3300005843 | Ga0068860_100030407 | Ga0068860_1000304072 | 75 |
| 161 | 3300005843 | Ga0068860_100364616 | Ga0068860_1003646161 | 75 |
| 162 | 3300005843 | Ga0068860_100501062 | Ga0068860_1005010622 | 75 |
| 163 | 3300005843 | Ga0068860_100748227 | Ga0068860_1007482272 | 75 |
| 164 | 3300005843 | Ga0068860_101346582 | Ga0068860_1013465822 | 75 |
| 165 | 3300005844 | Ga0068862_102398101 | Ga0068862_1023981011 | 75 |
| 166 | 3300006028 | Ga0070717_10007014 | Ga0070717_1000701412 | 75 |
| 167 | 3300006028 | Ga0070717_10027062 | Ga0070717_100270624 | 75 |
| 168 | 3300006028 | Ga0070717_10030846 | Ga0070717_100308466 | 75 |
| 169 | 3300006028 | Ga0070717_10137584 | Ga0070717_101375843 | 75 |
| 170 | 3300006028 | Ga0070717_10144510 | Ga0070717_101445103 | 75 |
| 171 | 3300006028 | Ga0070717_10332521 | Ga0070717_103325213 | 75 |
| 172 | 3300006028 | Ga0070717_10793686 | Ga0070717_107936862 | 75 |
| 173 | 3300006028 | Ga0070717_10995017 | Ga0070717_109950171 | 75 |
| 174 | 3300006028 | Ga0070717_11067185 | Ga0070717_110671851 | 75 |
| 175 | 3300006028 | Ga0070717_11198346 | Ga0070717_111983462 | 75 |
| 176 | 3300006028 | Ga0070717_12133576 | Ga0070717_121335762 | 75 |
| 177 | 3300006163 | Ga0070715_10001048 | Ga0070715_100010488 | 75 |
| 178 | 3300006163 | Ga0070715_10421996 | Ga0070715_104219962 | 75 |
| 179 | 3300006173 | Ga0070716_100004491 | Ga0070716_1000044915 | 75 |
| 180 | 3300006175 | Ga0070712_100000284 | Ga0070712_1000002847 | 75 |
| 181 | 3300006175 | Ga0070712_100341313 | Ga0070712_1003413132 | 75 |
| 182 | 3300006175 | Ga0070712_100639590 | Ga0070712_1006395902 | 75 |
| 183 | 3300006175 | Ga0070712_100894110 | Ga0070712_1008941101 | 75 |
| 184 | 3300006237 | Ga0097621_100007110 | Ga0097621_1000071102 | 75 |
| 185 | 3300006237 | Ga0097621_100020116 | Ga0097621_1000201166 | 75 |
| 186 | 3300006237 | Ga0097621_100039367 | Ga0097621_1000393673 | 75 |
| 187 | 3300006237 | Ga0097621_100095177 | Ga0097621_1000951773 | 75 |
| 188 | 3300006237 | Ga0097621_100289518 | Ga0097621_1002895183 | 75 |
| 189 | 3300006237 | Ga0097621_100295478 | Ga0097621_1002954783 | 75 |
| 190 | 3300006237 | Ga0097621_100443815 | Ga0097621_1004438152 | 75 |
| 191 | 3300006237 | Ga0097621_100448768 | Ga0097621_1004487683 | 75 |
| 192 | 3300006237 | Ga0097621_100482910 | Ga0097621_1004829102 | 75 |
| 193 | 3300006358 | Ga0068871_100010030 | Ga0068871_1000100305 | 75 |
| 194 | 3300006358 | Ga0068871_100013601 | Ga0068871_1000136017 | 75 |
| 195 | 3300006358 | Ga0068871_100034909 | Ga0068871_1000349092 | 75 |
| 196 | 3300006358 | Ga0068871_100123609 | Ga0068871_1001236092 | 75 |
| 197 | 3300006358 | Ga0068871_100715884 | Ga0068871_1007158842 | 75 |
| 198 | 3300006358 | Ga0068871_100785617 | Ga0068871_1007856172 | 75 |
| 199 | 3300006358 | Ga0068871_101894123 | Ga0068871_1018941232 | 75 |
| 200 | 3300006358 | Ga0068871_102053230 | Ga0068871_1020532302 | 75 |
| 201 | 3300006358 | Ga0068871_102106200 | Ga0068871_1021062002 | 75 |
| 202 | 3300006847 | Ga0075431_101353023 | Ga0075431_1013530231 | 75 |
| 203 | 3300006852 | Ga0075433_10550598 | Ga0075433_105505982 | 75 |
| 204 | 3300006871 | Ga0075434_100005411 | Ga0075434_10000541110 | 75 |
| 205 | 3300006881 | Ga0068865_100002578 | Ga0068865_10000257812 | 75 |
| 206 | 3300006881 | Ga0068865_100083878 | Ga0068865_1000838783 | 75 |
| 207 | 3300006881 | Ga0068865_100452674 | Ga0068865_1004526742 | 75 |
| 208 | 3300006881 | Ga0068865_100772114 | Ga0068865_1007721142 | 75 |
| 209 | 3300006914 | Ga0075436_100039741 | Ga0075436_1000397413 | 75 |
| 210 | 3300006914 | Ga0075436_100281517 | Ga0075436_1002815172 | 75 |
| 211 | 3300006931 | Ga0097620_100019718 | Ga0097620_1000197187 | 75 |
| 212 | 3300006931 | Ga0097620_100149240 | Ga0097620_1001492402 | 75 |
| 213 | 3300006931 | Ga0097620_100951363 | Ga0097620_1009513632 | 75 |
| 214 | 3300007076 | Ga0075435_100278980 | Ga0075435_1002789802 | 75 |
| 215 | 3300009093 | Ga0105240_10076808 | Ga0105240_100768086 | 75 |
| 216 | 3300009093 | Ga0105240_10259598 | Ga0105240_102595983 | 75 |
| 217 | 3300009093 | Ga0105240_10465872 | Ga0105240_104658722 | 75 |
| 218 | 3300009093 | Ga0105240_10625084 | Ga0105240_106250843 | 75 |
| 219 | 3300009093 | Ga0105240_10627410 | Ga0105240_106274103 | 75 |
| 220 | 3300009093 | Ga0105240_10758786 | Ga0105240_107587862 | 75 |
| 221 | 3300009093 | Ga0105240_11210389 | Ga0105240_112103892 | 75 |
| 222 | 3300009093 | Ga0105240_11442731 | Ga0105240_114427312 | 75 |
| 223 | 3300009093 | Ga0105240_11469862 | Ga0105240_114698622 | 75 |
| 224 | 3300009094 | Ga0111539_11802959 | Ga0111539_118029592 | 75 |
| 225 | 3300009098 | Ga0105245_10011028 | Ga0105245_100110287 | 75 |
| 226 | 3300009098 | Ga0105245_10017355 | Ga0105245_100173554 | 75 |
| 227 | 3300009098 | Ga0105245_10091863 | Ga0105245_100918633 | 75 |
| 228 | 3300009098 | Ga0105245_10362579 | Ga0105245_103625792 | 75 |
| 229 | 3300009098 | Ga0105245_10817623 | Ga0105245_108176232 | 75 |
| 230 | 3300009098 | Ga0105245_11119170 | Ga0105245_111191702 | 75 |
| 231 | 3300009098 | Ga0105245_11382564 | Ga0105245_113825642 | 75 |
| 232 | 3300009148 | Ga0105243_11402929 | Ga0105243_114029292 | 75 |
| 233 | 3300009174 | Ga0105241_10008917 | Ga0105241_100089173 | 75 |
| 234 | 3300009174 | Ga0105241_10113823 | Ga0105241_101138233 | 75 |
| 235 | 3300009174 | Ga0105241_10242262 | Ga0105241_102422623 | 75 |
| 236 | 3300009174 | Ga0105241_10388839 | Ga0105241_103888392 | 75 |
| 237 | 3300009174 | Ga0105241_10439830 | Ga0105241_104398302 | 75 |
| 238 | 3300009174 | Ga0105241_10625054 | Ga0105241_106250542 | 75 |
| 239 | 3300009174 | Ga0105241_10822327 | Ga0105241_108223272 | 75 |
| 240 | 3300009174 | Ga0105241_11322356 | Ga0105241_113223562 | 75 |
| 241 | 3300009176 | Ga0105242_10010190 | Ga0105242_100101908 | 75 |
| 242 | 3300009176 | Ga0105242_10053036 | Ga0105242_100530362 | 75 |
| 243 | 3300009176 | Ga0105242_10110145 | Ga0105242_101101454 | 75 |
| 244 | 3300009176 | Ga0105242_10195919 | Ga0105242_101959192 | 75 |
| 245 | 3300009176 | Ga0105242_10208502 | Ga0105242_102085022 | 75 |
| 246 | 3300009176 | Ga0105242_10238308 | Ga0105242_102383082 | 75 |
| 247 | 3300009176 | Ga0105242_10948377 | Ga0105242_109483772 | 75 |
| 248 | 3300009176 | Ga0105242_11905767 | Ga0105242_119057672 | 75 |
| 249 | 3300009177 | Ga0105248_10013796 | Ga0105248_100137964 | 75 |
| 250 | 3300009177 | Ga0105248_10059685 | Ga0105248_100596851 | 75 |
| 251 | 3300009177 | Ga0105248_10356946 | Ga0105248_103569463 | 75 |
| 252 | 3300009177 | Ga0105248_11366544 | Ga0105248_113665442 | 75 |
| 253 | 3300009545 | Ga0105237_10025507 | Ga0105237_100255075 | 75 |
| 254 | 3300009545 | Ga0105237_10027372 | Ga0105237_100273725 | 75 |
| 255 | 3300009545 | Ga0105237_10065137 | Ga0105237_100651374 | 75 |
| 256 | 3300009545 | Ga0105237_10074855 | Ga0105237_100748554 | 75 |
| 257 | 3300009545 | Ga0105237_10376230 | Ga0105237_103762303 | 75 |
| 258 | 3300009545 | Ga0105237_10380322 | Ga0105237_103803223 | 75 |
| 259 | 3300009545 | Ga0105237_10583079 | Ga0105237_105830792 | 75 |
| 260 | 3300009545 | Ga0105237_10944154 | Ga0105237_109441543 | 75 |
| 261 | 3300009545 | Ga0105237_11033942 | Ga0105237_110339421 | 75 |
| 262 | 3300009545 | Ga0105237_11978616 | Ga0105237_119786161 | 75 |
| 263 | 3300009551 | Ga0105238_10003228 | Ga0105238_100032289 | 75 |
| 264 | 3300009551 | Ga0105238_10018824 | Ga0105238_1001882410 | 75 |
| 265 | 3300009551 | Ga0105238_10088384 | Ga0105238_100883844 | 75 |
| 266 | 3300009551 | Ga0105238_10167710 | Ga0105238_101677103 | 75 |
| 267 | 3300009551 | Ga0105238_10168302 | Ga0105238_101683023 | 75 |
| 268 | 3300009551 | Ga0105238_10299853 | Ga0105238_102998533 | 75 |
| 269 | 3300009551 | Ga0105238_10556495 | Ga0105238_105564953 | 75 |
| 270 | 3300009551 | Ga0105238_10746944 | Ga0105238_107469442 | 75 |
| 271 | 3300009553 | Ga0105249_11318991 | Ga0105249_113189911 | 75 |
| 272 | 3300010375 | Ga0105239_10009183 | Ga0105239_1000918313 | 75 |
| 273 | 3300010375 | Ga0105239_10027061 | Ga0105239_100270614 | 75 |
| 274 | 3300010375 | Ga0105239_10147659 | Ga0105239_101476595 | 75 |
| 275 | 3300010375 | Ga0105239_10226706 | Ga0105239_102267063 | 75 |
| 276 | 3300010375 | Ga0105239_10227980 | Ga0105239_102279802 | 75 |
| 277 | 3300010375 | Ga0105239_10381904 | Ga0105239_103819042 | 75 |
| 278 | 3300010375 | Ga0105239_11716092 | Ga0105239_117160922 | 75 |
| 279 | 3300010375 | Ga0105239_12277922 | Ga0105239_122779222 | 75 |
| 280 | 3300011119 | Ga0105246_10132961 | Ga0105246_101329613 | 75 |
| 281 | 3300011119 | Ga0105246_10315388 | Ga0105246_103153882 | 75 |
| 282 | 3300011119 | Ga0105246_10634397 | Ga0105246_106343973 | 75 |
| 283 | 3300013100 | Ga0157373_10043557 | Ga0157373_100435573 | 75 |
| 284 | 3300013100 | Ga0157373_10181387 | Ga0157373_101813872 | 75 |
| 285 | 3300013100 | Ga0157373_10386962 | Ga0157373_103869622 | 75 |
| 286 | 3300013100 | Ga0157373_11453867 | Ga0157373_114538671 | 75 |
| 287 | 3300013102 | Ga0157371_10114140 | Ga0157371_101141402 | 75 |
| 288 | 3300013104 | Ga0157370_10202492 | Ga0157370_102024923 | 75 |
| 289 | 3300013104 | Ga0157370_10295190 | Ga0157370_102951903 | 75 |
| 290 | 3300013104 | Ga0157370_10481625 | Ga0157370_104816252 | 75 |
| 291 | 3300013104 | Ga0157370_10778484 | Ga0157370_107784842 | 75 |
| 292 | 3300013104 | Ga0157370_11940508 | Ga0157370_119405081 | 75 |
| 293 | 3300013105 | Ga0157369_10135547 | Ga0157369_101355471 | 75 |
| 294 | 3300013105 | Ga0157369_10211676 | Ga0157369_102116763 | 75 |
| 295 | 3300013105 | Ga0157369_10213815 | Ga0157369_102138153 | 75 |
| 296 | 3300013105 | Ga0157369_11070884 | Ga0157369_110708842 | 75 |
| 297 | 3300013105 | Ga0157369_11301759 | Ga0157369_113017592 | 75 |
| 298 | 3300013296 | Ga0157374_10000623 | Ga0157374_1000062315 | 75 |
| 299 | 3300013296 | Ga0157374_10014478 | Ga0157374_100144783 | 75 |
| 300 | 3300013296 | Ga0157374_10401862 | Ga0157374_104018622 | 75 |
| 301 | 3300013296 | Ga0157374_10519896 | Ga0157374_105198961 | 75 |
| 302 | 3300013297 | Ga0157378_10000217 | Ga0157378_100002172 | 75 |
| 303 | 3300013297 | Ga0157378_10043628 | Ga0157378_100436284 | 75 |
| 304 | 3300013297 | Ga0157378_10245971 | Ga0157378_102459712 | 75 |
| 305 | 3300013297 | Ga0157378_10246598 | Ga0157378_102465982 | 75 |
| 306 | 3300013297 | Ga0157378_10628435 | Ga0157378_106284351 | 75 |
| 307 | 3300013297 | Ga0157378_10654888 | Ga0157378_106548882 | 75 |
| 308 | 3300013297 | Ga0157378_11273735 | Ga0157378_112737351 | 75 |
| 309 | 3300013297 | Ga0157378_11468052 | Ga0157378_114680522 | 75 |
| 310 | 3300013306 | Ga0163162_10029610 | Ga0163162_100296106 | 75 |
| 311 | 3300013306 | Ga0163162_10056432 | Ga0163162_100564324 | 75 |
| 312 | 3300013306 | Ga0163162_10102308 | Ga0163162_101023083 | 75 |
| 313 | 3300013306 | Ga0163162_11358051 | Ga0163162_113580512 | 75 |
| 314 | 3300013306 | Ga0163162_12069787 | Ga0163162_120697872 | 75 |
| 315 | 3300013307 | Ga0157372_10001157 | Ga0157372_1000115719 | 75 |
| 316 | 3300013307 | Ga0157372_10016198 | Ga0157372_100161982 | 75 |
| 317 | 3300013307 | Ga0157372_10034062 | Ga0157372_100340624 | 75 |
| 318 | 3300013307 | Ga0157372_10182241 | Ga0157372_101822413 | 75 |
| 319 | 3300013307 | Ga0157372_10212186 | Ga0157372_102121861 | 75 |
| 320 | 3300013307 | Ga0157372_10299874 | Ga0157372_102998743 | 75 |
| 321 | 3300013307 | Ga0157372_10306503 | Ga0157372_103065031 | 75 |
| 322 | 3300013307 | Ga0157372_10354734 | Ga0157372_103547342 | 75 |
| 323 | 3300013307 | Ga0157372_11380829 | Ga0157372_113808291 | 75 |
| 324 | 3300013307 | Ga0157372_12032048 | Ga0157372_120320481 | 75 |
| 325 | 3300013307 | Ga0157372_12203935 | Ga0157372_122039352 | 75 |
| 326 | 3300013308 | Ga0157375_11271556 | Ga0157375_112715562 | 75 |
| 327 | 3300014325 | Ga0163163_10035576 | Ga0163163_100355763 | 75 |
| 328 | 3300014325 | Ga0163163_10493854 | Ga0163163_104938541 | 75 |
| 329 | 3300014325 | Ga0163163_10699046 | Ga0163163_106990462 | 75 |
| 330 | 3300014325 | Ga0163163_11615594 | Ga0163163_116155942 | 75 |
| 331 | 3300014325 | Ga0163163_12377630 | Ga0163163_123776302 | 75 |
| 332 | 3300014745 | Ga0157377_10078427 | Ga0157377_100784272 | 75 |
| 333 | 3300014969 | Ga0157376_10025238 | Ga0157376_100252384 | 75 |
| 334 | 3300014969 | Ga0157376_11001275 | Ga0157376_110012751 | 75 |
| 335 | 3300014969 | Ga0157376_12239593 | Ga0157376_122395932 | 75 |
| 336 | 3300014969 | Ga0157376_12388023 | Ga0157376_123880231 | 75 |
| 337 | 3300021358 | Ga0213873_10041902 | Ga0213873_100419022 | 75 |
| 338 | 3300021377 | Ga0213874_10057501 | Ga0213874_100575011 | 75 |
| 339 | 3300021388 | Ga0213875_10081610 | Ga0213875_100816101 | 75 |
| 340 | 3300021388 | Ga0213875_10670822 | Ga0213875_106708222 | 75 |
| 341 | 3300025321 | Ga0207656_10236796 | Ga0207656_102367962 | 75 |
| 342 | 3300025898 | Ga0207692_10056007 | Ga0207692_100560073 | 75 |
| 343 | 3300025898 | Ga0207692_10124495 | Ga0207692_101244953 | 75 |
| 344 | 3300025899 | Ga0207642_10047698 | Ga0207642_100476984 | 75 |
| 345 | 3300025899 | Ga0207642_10050242 | Ga0207642_100502424 | 75 |
| 346 | 3300025904 | Ga0207647_10047576 | Ga0207647_100475764 | 75 |
| 347 | 3300025904 | Ga0207647_10341482 | Ga0207647_103414822 | 75 |
| 348 | 3300025905 | Ga0207685_10000448 | Ga0207685_100004486 | 75 |
| 349 | 3300025906 | Ga0207699_10246559 | Ga0207699_102465592 | 75 |
| 350 | 3300025906 | Ga0207699_10268892 | Ga0207699_102688922 | 75 |
| 351 | 3300025906 | Ga0207699_10346453 | Ga0207699_103464532 | 75 |
| 352 | 3300025907 | Ga0207645_10280625 | Ga0207645_102806251 | 75 |
| 353 | 3300025909 | Ga0207705_10214797 | Ga0207705_102147973 | 75 |
| 354 | 3300025910 | Ga0207684_10009193 | Ga0207684_100091935 | 75 |
| 355 | 3300025910 | Ga0207684_10708183 | Ga0207684_107081832 | 75 |
| 356 | 3300025911 | Ga0207654_10071561 | Ga0207654_100715613 | 75 |
| 357 | 3300025911 | Ga0207654_10258359 | Ga0207654_102583591 | 75 |
| 358 | 3300025911 | Ga0207654_11107052 | Ga0207654_111070522 | 75 |
| 359 | 3300025912 | Ga0207707_10009951 | Ga0207707_100099515 | 75 |
| 360 | 3300025912 | Ga0207707_10013326 | Ga0207707_100133262 | 75 |
| 361 | 3300025912 | Ga0207707_10175973 | Ga0207707_101759733 | 75 |
| 362 | 3300025912 | Ga0207707_10692770 | Ga0207707_106927701 | 75 |
| 363 | 3300025912 | Ga0207707_10936347 | Ga0207707_109363472 | 75 |
| 364 | 3300025913 | Ga0207695_10010580 | Ga0207695_100105803 | 75 |
| 365 | 3300025913 | Ga0207695_10028548 | Ga0207695_100285484 | 75 |
| 366 | 3300025913 | Ga0207695_10058596 | Ga0207695_100585962 | 75 |
| 367 | 3300025913 | Ga0207695_10130146 | Ga0207695_101301463 | 75 |
| 368 | 3300025913 | Ga0207695_10225422 | Ga0207695_102254224 | 75 |
| 369 | 3300025913 | Ga0207695_10621039 | Ga0207695_106210392 | 75 |
| 370 | 3300025913 | Ga0207695_11138730 | Ga0207695_111387302 | 75 |
| 371 | 3300025913 | Ga0207695_11405328 | Ga0207695_114053281 | 75 |
| 372 | 3300025914 | Ga0207671_10060624 | Ga0207671_100606244 | 75 |
| 373 | 3300025914 | Ga0207671_10212739 | Ga0207671_102127391 | 75 |
| 374 | 3300025914 | Ga0207671_10469652 | Ga0207671_104696523 | 75 |
| 375 | 3300025914 | Ga0207671_10618316 | Ga0207671_106183162 | 75 |
| 376 | 3300025914 | Ga0207671_10692228 | Ga0207671_106922281 | 75 |
| 377 | 3300025915 | Ga0207693_10000038 | Ga0207693_1000003865 | 75 |
| 378 | 3300025915 | Ga0207693_10542464 | Ga0207693_105424642 | 75 |
| 379 | 3300025916 | Ga0207663_10000445 | Ga0207663_100004459 | 75 |
| 380 | 3300025916 | Ga0207663_11549430 | Ga0207663_115494302 | 75 |
| 381 | 3300025917 | Ga0207660_10481556 | Ga0207660_104815562 | 75 |
| 382 | 3300025917 | Ga0207660_11042990 | Ga0207660_110429902 | 75 |
| 383 | 3300025919 | Ga0207657_10282475 | Ga0207657_102824753 | 75 |
| 384 | 3300025919 | Ga0207657_10943993 | Ga0207657_109439932 | 75 |
| 385 | 3300025919 | Ga0207657_10963403 | Ga0207657_109634032 | 75 |
| 386 | 3300025920 | Ga0207649_10103521 | Ga0207649_101035212 | 75 |
| 387 | 3300025920 | Ga0207649_10301361 | Ga0207649_103013614 | 75 |
| 388 | 3300025920 | Ga0207649_11192634 | Ga0207649_111926342 | 75 |
| 389 | 3300025921 | Ga0207652_10041168 | Ga0207652_100411683 | 75 |
| 390 | 3300025921 | Ga0207652_10091447 | Ga0207652_100914474 | 75 |
| 391 | 3300025921 | Ga0207652_10230846 | Ga0207652_102308463 | 75 |
| 392 | 3300025921 | Ga0207652_11262756 | Ga0207652_112627562 | 75 |
| 393 | 3300025922 | Ga0207646_10003637 | Ga0207646_100036375 | 75 |
| 394 | 3300025922 | Ga0207646_10170975 | Ga0207646_101709753 | 75 |
| 395 | 3300025922 | Ga0207646_10302474 | Ga0207646_103024742 | 75 |
| 396 | 3300025922 | Ga0207646_10331749 | Ga0207646_103317492 | 75 |
| 397 | 3300025922 | Ga0207646_10916682 | Ga0207646_109166821 | 75 |
| 398 | 3300025924 | Ga0207694_10054836 | Ga0207694_100548363 | 75 |
| 399 | 3300025924 | Ga0207694_10101130 | Ga0207694_101011302 | 75 |
| 400 | 3300025924 | Ga0207694_10171115 | Ga0207694_101711151 | 75 |
| 401 | 3300025924 | Ga0207694_10454459 | Ga0207694_104544592 | 75 |
| 402 | 3300025924 | Ga0207694_10741720 | Ga0207694_107417202 | 75 |
| 403 | 3300025926 | Ga0207659_11907120 | Ga0207659_119071202 | 75 |
| 404 | 3300025927 | Ga0207687_10010819 | Ga0207687_100108195 | 75 |
| 405 | 3300025927 | Ga0207687_10067701 | Ga0207687_100677015 | 75 |
| 406 | 3300025927 | Ga0207687_10327913 | Ga0207687_103279133 | 75 |
| 407 | 3300025927 | Ga0207687_10340170 | Ga0207687_103401703 | 75 |
| 408 | 3300025927 | Ga0207687_10876735 | Ga0207687_108767351 | 75 |
| 409 | 3300025927 | Ga0207687_11681716 | Ga0207687_116817161 | 75 |
| 410 | 3300025928 | Ga0207700_10013866 | Ga0207700_100138662 | 75 |
| 411 | 3300025928 | Ga0207700_10026719 | Ga0207700_100267194 | 75 |
| 412 | 3300025928 | Ga0207700_10042606 | Ga0207700_100426063 | 75 |
| 413 | 3300025928 | Ga0207700_10128601 | Ga0207700_101286012 | 75 |
| 414 | 3300025928 | Ga0207700_10589345 | Ga0207700_105893451 | 75 |
| 415 | 3300025928 | Ga0207700_11323385 | Ga0207700_113233852 | 75 |
| 416 | 3300025929 | Ga0207664_10010919 | Ga0207664_100109195 | 75 |
| 417 | 3300025929 | Ga0207664_10039862 | Ga0207664_100398625 | 75 |
| 418 | 3300025929 | Ga0207664_10291058 | Ga0207664_102910582 | 75 |
| 419 | 3300025929 | Ga0207664_10444997 | Ga0207664_104449973 | 75 |
| 420 | 3300025932 | Ga0207690_10063398 | Ga0207690_100633983 | 75 |
| 421 | 3300025932 | Ga0207690_10897882 | Ga0207690_108978822 | 75 |
| 422 | 3300025932 | Ga0207690_10965163 | Ga0207690_109651632 | 75 |
| 423 | 3300025932 | Ga0207690_10970591 | Ga0207690_109705912 | 75 |
| 424 | 3300025933 | Ga0207706_10082985 | Ga0207706_100829852 | 75 |
| 425 | 3300025933 | Ga0207706_11390545 | Ga0207706_113905452 | 75 |
| 426 | 3300025934 | Ga0207686_10022758 | Ga0207686_100227582 | 75 |
| 427 | 3300025934 | Ga0207686_10035947 | Ga0207686_100359472 | 75 |
| 428 | 3300025934 | Ga0207686_10097331 | Ga0207686_100973313 | 75 |
| 429 | 3300025934 | Ga0207686_10167876 | Ga0207686_101678761 | 75 |
| 430 | 3300025934 | Ga0207686_10442897 | Ga0207686_104428972 | 75 |
| 431 | 3300025934 | Ga0207686_10647161 | Ga0207686_106471612 | 75 |
| 432 | 3300025934 | Ga0207686_11464945 | Ga0207686_114649451 | 75 |
| 433 | 3300025935 | Ga0207709_10153194 | Ga0207709_101531941 | 75 |
| 434 | 3300025935 | Ga0207709_11735119 | Ga0207709_117351191 | 75 |
| 435 | 3300025938 | Ga0207704_10398093 | Ga0207704_103980933 | 75 |
| 436 | 3300025938 | Ga0207704_11918911 | Ga0207704_119189111 | 75 |
| 437 | 3300025939 | Ga0207665_10003824 | Ga0207665_1000382412 | 75 |
| 438 | 3300025939 | Ga0207665_10065768 | Ga0207665_100657683 | 75 |
| 439 | 3300025939 | Ga0207665_10087981 | Ga0207665_100879811 | 75 |
| 440 | 3300025939 | Ga0207665_10673484 | Ga0207665_106734841 | 75 |
| 441 | 3300025940 | Ga0207691_11531844 | Ga0207691_115318442 | 75 |
| 442 | 3300025941 | Ga0207711_10027274 | Ga0207711_100272744 | 75 |
| 443 | 3300025941 | Ga0207711_10310864 | Ga0207711_103108643 | 75 |
| 444 | 3300025941 | Ga0207711_10433695 | Ga0207711_104336952 | 75 |
| 445 | 3300025942 | Ga0207689_10011972 | Ga0207689_100119724 | 75 |
| 446 | 3300025944 | Ga0207661_10074157 | Ga0207661_100741574 | 75 |
| 447 | 3300025944 | Ga0207661_10174234 | Ga0207661_101742343 | 75 |
| 448 | 3300025944 | Ga0207661_10209225 | Ga0207661_102092252 | 75 |
| 449 | 3300025944 | Ga0207661_10396357 | Ga0207661_103963572 | 75 |
| 450 | 3300025945 | Ga0207679_10005250 | Ga0207679_100052502 | 75 |
| 451 | 3300025945 | Ga0207679_10976622 | Ga0207679_109766222 | 75 |
| 452 | 3300025945 | Ga0207679_11357273 | Ga0207679_113572732 | 75 |
| 453 | 3300025949 | Ga0207667_10005709 | Ga0207667_100057094 | 75 |
| 454 | 3300025949 | Ga0207667_10184517 | Ga0207667_101845174 | 75 |
| 455 | 3300025949 | Ga0207667_10190325 | Ga0207667_101903253 | 75 |
| 456 | 3300025949 | Ga0207667_10385912 | Ga0207667_103859122 | 75 |
| 457 | 3300025949 | Ga0207667_10737712 | Ga0207667_107377123 | 75 |
| 458 | 3300025949 | Ga0207667_10918413 | Ga0207667_109184132 | 75 |
| 459 | 3300025949 | Ga0207667_11171767 | Ga0207667_111717672 | 75 |
| 460 | 3300025960 | Ga0207651_10495988 | Ga0207651_104959882 | 75 |
| 461 | 3300025961 | Ga0207712_10874758 | Ga0207712_108747581 | 75 |
| 462 | 3300025972 | Ga0207668_10644339 | Ga0207668_106443391 | 75 |
| 463 | 3300025981 | Ga0207640_10003176 | Ga0207640_100031764 | 75 |
| 464 | 3300025986 | Ga0207658_10229592 | Ga0207658_102295922 | 75 |
| 465 | 3300026023 | Ga0207677_10009222 | Ga0207677_100092222 | 75 |
| 466 | 3300026023 | Ga0207677_10083528 | Ga0207677_100835284 | 75 |
| 467 | 3300026035 | Ga0207703_10011649 | Ga0207703_100116494 | 75 |
| 468 | 3300026035 | Ga0207703_10609417 | Ga0207703_106094172 | 75 |
| 469 | 3300026035 | Ga0207703_11473114 | Ga0207703_114731142 | 75 |
| 470 | 3300026041 | Ga0207639_10572421 | Ga0207639_105724213 | 75 |
| 471 | 3300026041 | Ga0207639_11685758 | Ga0207639_116857582 | 75 |
| 472 | 3300026041 | Ga0207639_12074888 | Ga0207639_120748881 | 75 |
| 473 | 3300026078 | Ga0207702_10037217 | Ga0207702_100372173 | 75 |
| 474 | 3300026078 | Ga0207702_10269803 | Ga0207702_102698032 | 75 |
| 475 | 3300026078 | Ga0207702_10313003 | Ga0207702_103130033 | 75 |
| 476 | 3300026078 | Ga0207702_10336646 | Ga0207702_103366463 | 75 |
| 477 | 3300026078 | Ga0207702_10946513 | Ga0207702_109465132 | 75 |
| 478 | 3300026078 | Ga0207702_11124948 | Ga0207702_111249481 | 75 |
| 479 | 3300026088 | Ga0207641_11103024 | Ga0207641_111030242 | 75 |
| 480 | 3300026088 | Ga0207641_11222269 | Ga0207641_112222692 | 75 |
| 481 | 3300026089 | Ga0207648_10012998 | Ga0207648_1001299810 | 75 |
| 482 | 3300026089 | Ga0207648_10102624 | Ga0207648_101026244 | 75 |
| 483 | 3300026095 | Ga0207676_10028737 | Ga0207676_100287374 | 75 |
| 484 | 3300026095 | Ga0207676_11021215 | Ga0207676_110212152 | 75 |
| 485 | 3300026116 | Ga0207674_10000257 | Ga0207674_1000025714 | 75 |
| 486 | 3300026116 | Ga0207674_10042637 | Ga0207674_100426374 | 75 |
| 487 | 3300026116 | Ga0207674_10045452 | Ga0207674_100454522 | 75 |
| 488 | 3300026116 | Ga0207674_10050783 | Ga0207674_100507835 | 75 |
| 489 | 3300026116 | Ga0207674_10122853 | Ga0207674_101228534 | 75 |
| 490 | 3300026118 | Ga0207675_100430899 | Ga0207675_1004308992 | 75 |
| 491 | 3300026121 | Ga0207683_10227717 | Ga0207683_102277172 | 75 |
| 492 | 3300026121 | Ga0207683_10365165 | Ga0207683_103651653 | 75 |
| 493 | 3300026121 | Ga0207683_11500205 | Ga0207683_115002052 | 75 |
| 494 | 3300026142 | Ga0207698_10415064 | Ga0207698_104150643 | 75 |
| 495 | 3300026142 | Ga0207698_10502181 | Ga0207698_105021812 | 75 |
| 496 | 3300027907 | Ga0207428_11085072 | Ga0207428_110850721 | 75 |
| 497 | 3300028023 | Ga0265357_1025794 | Ga0265357_10257942 | 75 |
| 498 | 3300028379 | Ga0268266_10002897 | Ga0268266_100028976 | 75 |
| 499 | 3300028379 | Ga0268266_10099235 | Ga0268266_100992353 | 75 |
| 500 | 3300028379 | Ga0268266_10242658 | Ga0268266_102426582 | 75 |
| 501 | 3300028379 | Ga0268266_10607042 | Ga0268266_106070422 | 75 |
| 502 | 3300028379 | Ga0268266_11985222 | Ga0268266_119852222 | 75 |
| 503 | 3300028379 | Ga0268266_12275162 | Ga0268266_122751622 | 75 |
| 504 | 3300028381 | Ga0268264_10551288 | Ga0268264_105512882 | 75 |
| 505 | 3300028381 | Ga0268264_10837193 | Ga0268264_108371932 | 75 |
| 506 | 3300028381 | Ga0268264_10940444 | Ga0268264_109404442 | 75 |
| 507 | 3300028381 | Ga0268264_11617293 | Ga0268264_116172932 | 75 |
| 508 | 3300028800 | Ga0265338_10015795 | Ga0265338_100157953 | 75 |
| 509 | 3300028800 | Ga0265338_10314876 | Ga0265338_103148762 | 75 |
| 510 | 3300029957 | Ga0265324_10071639 | Ga0265324_100716392 | 75 |
| 511 | 3300030760 | Ga0265762_1000835 | Ga0265762_10008352 | 75 |
| 512 | 3300030760 | Ga0265762_1015837 | Ga0265762_10158371 | 75 |
| 513 | 3300031090 | Ga0265760_10003536 | Ga0265760_100035367 | 75 |
| 514 | 3300031090 | Ga0265760_10151697 | Ga0265760_101516972 | 75 |
| 515 | 3300031090 | Ga0265760_10180275 | Ga0265760_101802752 | 75 |
| 516 | 3300031238 | Ga0265332_10355274 | Ga0265332_103552742 | 75 |
| 517 | 3300031241 | Ga0265325_10157650 | Ga0265325_101576501 | 75 |
| 518 | 3300031247 | Ga0265340_10064148 | Ga0265340_100641482 | 75 |
| 519 | 3300031247 | Ga0265340_10488634 | Ga0265340_104886341 | 75 |
| 520 | 3300031247 | Ga0265340_10559492 | Ga0265340_105594921 | 75 |
| 521 | 3300031249 | Ga0265339_10031642 | Ga0265339_100316422 | 75 |
| 522 | 3300031249 | Ga0265339_10084081 | Ga0265339_100840811 | 75 |
| 523 | 3300031250 | Ga0265331_10384131 | Ga0265331_103841312 | 75 |
| 524 | 3300031344 | Ga0265316_10003152 | Ga0265316_100031527 | 75 |
| 525 | 3300031344 | Ga0265316_11057881 | Ga0265316_110578812 | 75 |
| 526 | 3300031595 | Ga0265313_10024891 | Ga0265313_100248912 | 75 |
| 527 | 3300031711 | Ga0265314_10001555 | Ga0265314_100015552 | 75 |
| 528 | 3300031711 | Ga0265314_10072115 | Ga0265314_100721153 | 75 |
| 529 | 3300031711 | Ga0265314_10197520 | Ga0265314_101975203 | 75 |
| 530 | 3300031711 | Ga0265314_10704304 | Ga0265314_107043041 | 75 |
| 531 | 3300031730 | Ga0307516_10003420 | Ga0307516_100034205 | 75 |
| 532 | 3300031824 | Ga0307413_11376731 | Ga0307413_113767311 | 75 |
| 533 | 3300031995 | Ga0307409_101176570 | Ga0307409_1011765702 | 75 |
| 534 | 3300035083 | Ga0373926_0273403 | Ga0373926_0273403_208_435 | 75 |
| 535 | 3300035113 | Ga0373936_0119123 | Ga0373936_0119123_241_468 | 75 |
| 536 | 3300035115 | Ga0373941_0380671 | Ga0373941_0380671_154_381 | 75 |
| 537 | 3300035116 | Ga0373945_0034297 | Ga0373945_0034297_1038_1265 | 75 |
| 538 | 3300035121 | Ga0373960_0131559 | Ga0373960_0131559_49_276 | 75 |
| 539 | 3300035170 | Ga0373943_0158856 | Ga0373943_0158856_750_977 | 75 |
| 540 | 3300035171 | Ga0373946_0198704 | Ga0373946_0198704_21_248 | 75 |
| 541 | 3300035692 | Ga0373935_0090979 | Ga0373935_0090979_1639_1866 | 75 |
| 542 | 3300035692 | Ga0373935_0378526 | Ga0373935_0378526_207_434 | 75 |
| 543 | 3300035695 | Ga0373927_0294475 | Ga0373927_0294475_588_815 | 75 |
| 544 | 3300035725 | Ga0373947_0119034 | Ga0373947_0119034_611_838 | 75 |
| 545 | 3300035725 | Ga0373947_0220747 | Ga0373947_0220747_545_772 | 75 |
| 546 | 3300036401 | Ga0373937_0126692 | Ga0373937_0126692_23_250 | 75 |
| 547 | 3300037068 | Ga0373925_0001347 | Ga0373925_0001347_9163_9390 | 75 |
| 548 | 3300037068 | Ga0373925_0017618 | Ga0373925_0017618_2155_2382 | 75 |
| 549 | 3300037068 | Ga0373925_1353511 | Ga0373925_1353511_145_372 | 75 |
| 550 | 3300037312 | Ga0395899_0103624 | Ga0395899_0103624_1638_1865 | 75 |
| 551 | 3300037418 | Ga0395900_0011767 | Ga0395900_0011767_2317_2544 | 75 |
| 552 | 3300037853 | Ga0436364_0196890 | Ga0436364_0196890_488_715 | 75 |
| 553 | 3300037853 | Ga0436364_0619394 | Ga0436364_0619394_78_305 | 75 |
| 554 | 3300037853 | Ga0436364_0752135 | Ga0436364_0752135_1015_1242 | 75 |
| 555 | 3300037853 | Ga0436364_0818917 | Ga0436364_0818917_10_264 | 75 |
| 556 | 3300037853 | Ga0436364_1148362 | Ga0436364_1148362_117_344 | 75 |
| 557 | 3300038443 | Ga0395901_0002017 | Ga0395901_0002017_9668_9895 | 75 |
| 558 | 3300039437 | Ga0436365_0535589 | Ga0436365_0535589_1195_1422 | 75 |
| 559 | 3300039438 | Ga0436360_0193073 | Ga0436360_0193073_1364_1591 | 75 |
| 560 | 3300039447 | Ga0436361_0410353 | Ga0436361_0410353_718_945 | 75 |
| 561 | 3300039450 | Ga0436363_1167321 | Ga0436363_1167321_51_278 | 75 |
| 562 | 3300039450 | Ga0436363_1325016 | Ga0436363_1325016_966_1193 | 75 |
| 563 | 3300039453 | Ga0436362_0461317 | Ga0436362_0461317_841_1068 | 75 |
| 564 | 3300039453 | Ga0436362_0554361 | Ga0436362_0554361_176_403 | 75 |
| 565 | 3300041406 | Ga0439439_0129405 | Ga0439439_0129405_455_682 | 75 |
| 566 | 3300044693 | Ga0466961_0011063 | Ga0466961_0011063_39_266 | 75 |
| 567 | 3300044694 | Ga0466963_0175031 | Ga0466963_0175031_822_1049 | 75 |
| 568 | 3300044694 | Ga0466963_0281212 | Ga0466963_0281212_30_263 | 75 |
| 569 | 3300044706 | Ga0466964_0239003 | Ga0466964_0239003_176_403 | 75 |
| 570 | 3300044719 | Ga0466971_0087345 | Ga0466971_0087345_1169_1396 | 75 |
| 571 | 3300044765 | Ga0466970_0348604 | Ga0466970_0348604_489_716 | 75 |
| 572 | 3300045836 | Ga0466958_0214639 | Ga0466958_0214639_171_398 | 75 |
| 573 | 3300045836 | Ga0466958_0458552 | Ga0466958_0458552_408_635 | 75 |
| 574 | 3300045976 | Ga0466967_0001421 | Ga0466967_0001421_13392_13619 | 75 |
| 575 | 3300045976 | Ga0466967_0430875 | Ga0466967_0430875_1023_1256 | 75 |
| 576 | 3300046459 | Ga0495629_0118858 | Ga0495629_0118858_1055_1282 | 75 |
| 577 | 3300046463 | Ga0495653_0261535 | Ga0495653_0261535_655_882 | 75 |
| 578 | 3300046472 | Ga0495580_0000798 | Ga0495580_0000798_9236_9463 | 75 |
| 579 | 3300046472 | Ga0495580_0543819 | Ga0495580_0543819_12_239 | 75 |
| 580 | 3300046472 | Ga0495580_0619788 | Ga0495580_0619788_430_657 | 75 |
| 581 | 3300046472 | Ga0495580_1105985 | Ga0495580_1105985_133_360 | 75 |
| 582 | 3300046473 | Ga0495582_0024473 | Ga0495582_0024473_1113_1340 | 75 |
| 583 | 3300046499 | Ga0495594_0377887 | Ga0495594_0377887_44_271 | 75 |
| 584 | 3300046679 | Ga0495623_0260879 | Ga0495623_0260879_283_510 | 75 |
| 585 | 3300046683 | Ga0495658_0106168 | Ga0495658_0106168_605_832 | 75 |
| 586 | 3300046684 | Ga0495669_0137851 | Ga0495669_0137851_241_468 | 75 |
| 587 | 3300047315 | Ga0495581_0248192 | Ga0495581_0248192_405_632 | 75 |
| 588 | 3300047471 | Ga0495684_0406906 | Ga0495684_0406906_78_305 | 75 |
| 589 | 3300047673 | Ga0495593_0233808 | Ga0495593_0233808_69_296 | 75 |
| 590 | 3300048088 | Ga0495602_0707789 | Ga0495602_0707789_228_455 | 75 |
| 591 | 3300048903 | Ga0496100_0067036 | Ga0496100_0067036_29_256 | 75 |
| 592 | 3300048905 | Ga0496102_1232163 | Ga0496102_1232163_156_383 | 75 |
| 593 | 3300048905 | Ga0496102_1664110 | Ga0496102_1664110_177_404 | 75 |
| 594 | 3300048907 | Ga0496104_0066133 | Ga0496104_0066133_552_779 | 75 |
| 595 | 3300048907 | Ga0496104_0072229 | Ga0496104_0072229_1270_1497 | 75 |
| 596 | 3300048913 | Ga0496110_1733965 | Ga0496110_1733965_271_498 | 75 |
| 597 | 3300048915 | Ga0496112_1618076 | Ga0496112_1618076_250_477 | 75 |
| 598 | 3300048917 | Ga0496114_0684998 | Ga0496114_0684998_651_878 | 75 |
| 599 | 3300048918 | Ga0496115_0034645 | Ga0496115_0034645_2443_2670 | 75 |
| 600 | 3300049568 | Ga0501031_0062891 | Ga0501031_0062891_962_1189 | 75 |
| 601 | 3300049569 | Ga0501032_0041923 | Ga0501032_0041923_1508_1735 | 75 |
| 602 | 3300049569 | Ga0501032_0138183 | Ga0501032_0138183_926_1153 | 75 |
| 603 | 3300049569 | Ga0501032_0158509 | Ga0501032_0158509_257_484 | 75 |
| 604 | 3300049569 | Ga0501032_0388158 | Ga0501032_0388158_16_243 | 75 |
| 605 | 3300049570 | Ga0501033_0040142 | Ga0501033_0040142_818_1045 | 75 |
| 606 | 3300049570 | Ga0501033_0090141 | Ga0501033_0090141_580_807 | 75 |
| 607 | 3300049570 | Ga0501033_0198553 | Ga0501033_0198553_50_277 | 75 |
| 608 | 3300049570 | Ga0501033_0242516 | Ga0501033_0242516_166_393 | 75 |
| 609 | 3300049570 | Ga0501033_0594288 | Ga0501033_0594288_101_328 | 75 |
| 610 | 3300049571 | Ga0501034_0000778 | Ga0501034_0000778_14895_15122 | 75 |
| 611 | 3300049571 | Ga0501034_0085510 | Ga0501034_0085510_662_889 | 75 |
| 612 | 3300049571 | Ga0501034_0185782 | Ga0501034_0185782_1157_1384 | 75 |
| 613 | 3300049571 | Ga0501034_0233221 | Ga0501034_0233221_1496_1723 | 75 |
| 614 | 3300049572 | Ga0501036_0008377 | Ga0501036_0008377_7188_7415 | 75 |
| 615 | 3300049572 | Ga0501036_0195775 | Ga0501036_0195775_548_775 | 75 |
| 616 | 3300049572 | Ga0501036_0386102 | Ga0501036_0386102_804_1031 | 75 |
| 617 | 3300049573 | Ga0501037_0004949 | Ga0501037_0004949_7656_7883 | 75 |
| 618 | 3300049573 | Ga0501037_0301753 | Ga0501037_0301753_73_300 | 75 |
| 619 | 3300049573 | Ga0501037_0322924 | Ga0501037_0322924_748_975 | 75 |
| 620 | 3300049573 | Ga0501037_0904404 | Ga0501037_0904404_30_257 | 75 |
| 621 | 3300049574 | Ga0501038_0152306 | Ga0501038_0152306_959_1186 | 75 |
| 622 | 3300049574 | Ga0501038_0439908 | Ga0501038_0439908_440_667 | 75 |
| 623 | 3300049575 | Ga0501039_0164309 | Ga0501039_0164309_720_947 | 75 |
| 624 | 3300049575 | Ga0501039_0656785 | Ga0501039_0656785_111_338 | 75 |
| 625 | 3300049576 | Ga0501040_0180109 | Ga0501040_0180109_693_920 | 75 |
| 626 | 3300049579 | Ga0501043_0125140 | Ga0501043_0125140_863_1090 | 75 |
| 627 | 3300049579 | Ga0501043_0152295 | Ga0501043_0152295_426_653 | 75 |
| 628 | 3300049579 | Ga0501043_0553222 | Ga0501043_0553222_267_494 | 75 |
| 629 | 3300049580 | Ga0501046_0058561 | Ga0501046_0058561_678_905 | 75 |
| 630 | 3300049580 | Ga0501046_0302697 | Ga0501046_0302697_776_1003 | 75 |
| 631 | 3300049581 | Ga0501047_0133728 | Ga0501047_0133728_807_1034 | 75 |
| 632 | 3300049581 | Ga0501047_0140719 | Ga0501047_0140719_1358_1585 | 75 |
| 633 | 3300049581 | Ga0501047_0656246 | Ga0501047_0656246_340_567 | 75 |
| 634 | 3300049582 | Ga0501048_0942009 | Ga0501048_0942009_64_291 | 75 |
| 635 | 3300049586 | Ga0501070_0084865 | Ga0501070_0084865_1143_1370 | 75 |
| 636 | 3300049686 | Ga0501257_000588 | Ga0501257_000588_5569_5796 | 75 |
| 637 | 3300049822 | Ga0501035_0000386 | Ga0501035_0000386_983_1210 | 75 |
| 638 | 3300049822 | Ga0501035_0350821 | Ga0501035_0350821_514_741 | 75 |
| 639 | 3300049822 | Ga0501035_0387735 | Ga0501035_0387735_217_444 | 75 |
| 640 | 3300049823 | Ga0501044_0004473 | Ga0501044_0004473_1874_2101 | 75 |
| 641 | 3300049823 | Ga0501044_0129884 | Ga0501044_0129884_1165_1392 | 75 |
| 642 | 3300049823 | Ga0501044_0166866 | Ga0501044_0166866_792_1019 | 75 |
| 643 | 3300049823 | Ga0501044_0171915 | Ga0501044_0171915_1152_1379 | 75 |
| 644 | 3300049823 | Ga0501044_0381224 | Ga0501044_0381224_829_1056 | 75 |
| 645 | 3300049823 | Ga0501044_0588185 | Ga0501044_0588185_567_794 | 75 |
| 646 | 3300049823 | Ga0501044_1058709 | Ga0501044_1058709_42_269 | 75 |
| 647 | 3300050510 | nmdc:mga06r32_1509110_c1 | nmdc:mga06r32_1509110_c1_249_476 | 75 |
| 648 | 3300050511 | nmdc:mga08y16_1439571_c1 | nmdc:mga08y16_1439571_c1_397_624 | 75 |
| 649 | 3300050512 | nmdc:mga0n895_4119_c1 | nmdc:mga0n895_4119_c1_6724_6951 | 75 |
| 650 | 3300050513 | nmdc:mga0rr50_199678_c1 | nmdc:mga0rr50_199678_c1_438_665 | 75 |
| 651 | 3300050514 | nmdc:mga08x19_1278777_c1 | nmdc:mga08x19_1278777_c1_47_274 | 75 |
| 652 | 3300050514 | nmdc:mga08x19_28256_c1 | nmdc:mga08x19_28256_c1_1339_1566 | 75 |
| 653 | 3300050514 | nmdc:mga08x19_93699_c1 | nmdc:mga08x19_93699_c1_1274_1501 | 75 |
| 654 | 3300050515 | nmdc:mga0a205_418568_c1 | nmdc:mga0a205_418568_c1_437_664 | 75 |
| 655 | 3300053119 | Ga0500595_043391 | Ga0500595_043391_156_383 | 75 |
| 656 | 3300053139 | Ga0500568_0387741 | Ga0500568_0387741_107_334 | 75 |
| 657 | 3300053153 | Ga0500616_0043063 | Ga0500616_0043063_1268_1495 | 75 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1z0r-assembly1.cif.gz_B | solution structure of the n-terminal dna recognition domain of the bacillus subtilis transcription-state regulator abrb | 0.8393 | 15 | 50 |
| 2mrn-assembly1.cif.gz_B | structure of truncated ecmaze | 0.8067 | 1 | 49 |
| 1ub4-assembly1.cif.gz_C-2 | crystal structure of mazef complex | 0.7912 | 2 | 49 |
| 2w1t-assembly1.cif.gz_B | crystal structure of b. subtilis spovt | 0.7793 | 1 | 47 |
| 1mvf-assembly2.cif.gz_D | maze addiction antidote | 0.7763 | 5 | 48 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9Y615_245_329_3.90.640.10 | Alpha Beta;Alpha-Beta Complex;Actin; Chain A, domain 4;ATPase, substrate binding domain, subdomain 4 | 0.8923 | 33 | 47 | 3.90.640.10 |
| 1ub4C00 | Mainly Beta;Ribbon;Pemi-like Protein 1; Chain: D; | 0.7912 | 2 | 49 | 2.10.260.10 |
| 1mvfE00 | Mainly Beta;Ribbon;Pemi-like Protein 1; Chain: D; | 0.7876 | 5 | 48 | 2.10.260.10 |
| af_Q15772_1679_1886_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.7874 | 33 | 49 | 1.10.510.10 |
| af_O23614_302_511_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.7828 | 31 | 48 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V8Z7D6-F1-model_v4 | SpoVT-AbrB domain-containing protein | 0.9335 | 2 | 53 |
|
| AF-A0A3M1DDG5-F1-model_v4 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | 0.8689 | 1 | 50 |
GO:0003677
|
| AF-A0A062V8M3-F1-model_v4 | SpoVT / AbrB-like protein | 0.8686 | 1 | 50 |
GO:0003677
|
| AF-A0A1I6K6L5-F1-model_v4 | Looped-hinge helix DNA binding domain-containing protein, AbrB family | 0.8666 | 1 | 50 |
|
| AF-A0A2H1FEZ5-F1-model_v4 | SpoVT-AbrB domain-containing protein | 0.8663 | 1 | 50 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar