F472911
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 655 | 345 | 650 | 221 |
Family's Representative Sequence
| Representative Sequence | 3300005616|Ga0068852_100355761|Ga0068852_1003557611 |
| Length | 236 |
| Sequence | MVSLELSRRLVAEWLGTAFLLTAVVGSGIMAQKLAGGNVALALLCNTIPTGAILVVLILIFGPVSGAHFNPAVTLAFASRGELPWAFAGCYIAAQIAGGIAGVWLAHLMFELPVWQFSLTARTGTGQWLAEGVATFGLLLTIFGCVARAPTAVPYAVGLYITSAYWFTASTSFANPAVTISRSLSDTFAGIAPGGVPAFIAAQLAGAGLAVLLARWLWQLPVSSNSRGKDINNRKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 3 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 4 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 5 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 6 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 7 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 12 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 88 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 89 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 104 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 118 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 121 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 178 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 188 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 192 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 194 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 197 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 198 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 201 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 202 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 203 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 205 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 207 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 211 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 215 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 221 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 228 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 234 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 239 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 240 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 244 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 245 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 246 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 247 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 248 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 304 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 305 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 306 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 307 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 308 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 309 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 312 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 313 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 314 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 315 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 316 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 317 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 318 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 319 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 320 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 321 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 322 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 323 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 324 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 329 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 333 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 335 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 336 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 337 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 338 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 339 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 340 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 341 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 342 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 343 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 344 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 345 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.08 |
| Metatranscriptomes | 0.15 |
| Isolates | 0.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.5 |
| Nodule | 0.61 |
| Rhizoplane | 9.77 |
| Rhizosphere | 81.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214772973 | 2209111006 | Bacteria | 13664 |
| 2 | ARcpr5oldR_c000172 | 3300000041 | Bacteria | 11189 |
| 3 | ARCol0yngRDRAFT_1000173 | 3300000652 | Bacteria | 11015 |
| 4 | JGI24737J22298_10002941 | 3300001990 | Bacteria | 6039 |
| 5 | JGI24737J22298_10077600 | 3300001990 | Bacteria | 990 |
| 6 | JGI24750J21931_1027100 | 3300002070 | Bacteria | 828 |
| 7 | JGI24749J21850_1013718 | 3300002076 | Bacteria | 1138 |
| 8 | Ga0055535_1000632 | 3300003761 | Bacteria | 28125 |
| 9 | Ga0055529_1001056 | 3300003763 | Bacteria | 12764 |
| 10 | Ga0065712_10131527 | 3300005290 | Bacteria | 1544 |
| 11 | Ga0065715_10001277 | 3300005293 | Bacteria | 11971 |
| 12 | Ga0070676_10139206 | 3300005328 | Bacteria | 1543 |
| 13 | Ga0070683_100022631 | 3300005329 | Bacteria | 5620 |
| 14 | Ga0070683_101000072 | 3300005329 | Bacteria | 803 |
| 15 | Ga0070690_100024004 | 3300005330 | Bacteria | 3747 |
| 16 | Ga0070670_100088515 | 3300005331 | Bacteria | 2662 |
| 17 | Ga0070680_100035397 | 3300005336 | Bacteria | 4030 |
| 18 | Ga0070680_100052054 | 3300005336 | Bacteria | 3342 |
| 19 | Ga0070680_100089806 | 3300005336 | Bacteria | 2542 |
| 20 | Ga0070682_100366738 | 3300005337 | Bacteria | 1078 |
| 21 | Ga0070682_100641447 | 3300005337 | Bacteria | 844 |
| 22 | Ga0068868_100009330 | 3300005338 | Bacteria | 7054 |
| 23 | Ga0068868_100182609 | 3300005338 | Bacteria | 1741 |
| 24 | Ga0070660_100063259 | 3300005339 | Bacteria | 2876 |
| 25 | Ga0070660_100127779 | 3300005339 | Bacteria | 2032 |
| 26 | Ga0070689_100017860 | 3300005340 | Bacteria | 5215 |
| 27 | Ga0070689_100261158 | 3300005340 | Bacteria | 1431 |
| 28 | Ga0070691_10044288 | 3300005341 | Bacteria | 2110 |
| 29 | Ga0070692_10007543 | 3300005345 | Bacteria | 4797 |
| 30 | Ga0070668_100057388 | 3300005347 | Bacteria | 3008 |
| 31 | Ga0070669_100841028 | 3300005353 | Bacteria | 782 |
| 32 | Ga0070675_100032642 | 3300005354 | Bacteria | 4214 |
| 33 | Ga0070675_100074917 | 3300005354 | Bacteria | 2813 |
| 34 | Ga0070675_100326568 | 3300005354 | Bacteria | 1356 |
| 35 | Ga0070671_100052240 | 3300005355 | Bacteria | 3398 |
| 36 | Ga0070673_100548887 | 3300005364 | Bacteria | 1049 |
| 37 | Ga0070659_100147296 | 3300005366 | Bacteria | 1919 |
| 38 | Ga0070667_101013901 | 3300005367 | Bacteria | 775 |
| 39 | Ga0070709_10113573 | 3300005434 | Bacteria | 1824 |
| 40 | Ga0070709_10344284 | 3300005434 | Bacteria | 1100 |
| 41 | Ga0070714_100061780 | 3300005435 | Bacteria | 3218 |
| 42 | Ga0070713_100020773 | 3300005436 | Bacteria | 5040 |
| 43 | Ga0070713_100240020 | 3300005436 | Bacteria | 1650 |
| 44 | Ga0070713_100480628 | 3300005436 | Bacteria | 1170 |
| 45 | Ga0070710_10166208 | 3300005437 | Bacteria | 1372 |
| 46 | Ga0070701_10024994 | 3300005438 | Bacteria | 2895 |
| 47 | Ga0070701_10189070 | 3300005438 | Bacteria | 1210 |
| 48 | Ga0070711_100053755 | 3300005439 | Bacteria | 2777 |
| 49 | Ga0070711_100157532 | 3300005439 | Bacteria | 1718 |
| 50 | Ga0070711_100310295 | 3300005439 | Bacteria | 1257 |
| 51 | Ga0070700_100037901 | 3300005441 | Bacteria | 2934 |
| 52 | Ga0070694_100144058 | 3300005444 | Bacteria | 1734 |
| 53 | Ga0070694_100186477 | 3300005444 | Bacteria | 1537 |
| 54 | Ga0070708_100229454 | 3300005445 | Bacteria | 1742 |
| 55 | Ga0070663_100041474 | 3300005455 | Bacteria | 3228 |
| 56 | Ga0070663_100062660 | 3300005455 | Bacteria | 2682 |
| 57 | Ga0070678_100441218 | 3300005456 | Bacteria | 1138 |
| 58 | Ga0070662_100019254 | 3300005457 | Bacteria | 4632 |
| 59 | Ga0070662_100061679 | 3300005457 | Bacteria | 2738 |
| 60 | Ga0070662_100217336 | 3300005457 | Bacteria | 1523 |
| 61 | Ga0070681_10033224 | 3300005458 | Bacteria | 5179 |
| 62 | Ga0070681_10122765 | 3300005458 | Bacteria | 2530 |
| 63 | Ga0068867_100167659 | 3300005459 | Bacteria | 1737 |
| 64 | Ga0070685_10016136 | 3300005466 | Bacteria | 3974 |
| 65 | Ga0070685_10082168 | 3300005466 | Bacteria | 1933 |
| 66 | Ga0070679_100040702 | 3300005530 | Bacteria | 4623 |
| 67 | Ga0070679_100190615 | 3300005530 | Bacteria | 2019 |
| 68 | Ga0070684_100197377 | 3300005535 | Bacteria | 1832 |
| 69 | Ga0070684_100266843 | 3300005535 | Bacteria | 1566 |
| 70 | Ga0068853_100065758 | 3300005539 | Bacteria | 3147 |
| 71 | Ga0068853_100074542 | 3300005539 | Bacteria | 2960 |
| 72 | Ga0068853_100217202 | 3300005539 | Bacteria | 1745 |
| 73 | Ga0068853_100380947 | 3300005539 | Bacteria | 1317 |
| 74 | Ga0070686_100013967 | 3300005544 | Bacteria | 4614 |
| 75 | Ga0070686_100031720 | 3300005544 | Bacteria | 3233 |
| 76 | Ga0070695_100061606 | 3300005545 | Bacteria | 2434 |
| 77 | Ga0070695_100540549 | 3300005545 | Bacteria | 907 |
| 78 | Ga0070665_100297729 | 3300005548 | Bacteria | 1616 |
| 79 | Ga0070665_100353289 | 3300005548 | Bacteria | 1475 |
| 80 | Ga0070704_100001307 | 3300005549 | Bacteria | 13180 |
| 81 | Ga0068855_100073747 | 3300005563 | Bacteria | 3965 |
| 82 | Ga0068855_100297368 | 3300005563 | Bacteria | 1788 |
| 83 | Ga0068855_100463200 | 3300005563 | Bacteria | 1382 |
| 84 | Ga0068855_101175326 | 3300005563 | Bacteria | 799 |
| 85 | Ga0070664_100073397 | 3300005564 | Bacteria | 2935 |
| 86 | Ga0070664_100084762 | 3300005564 | Bacteria | 2736 |
| 87 | Ga0070664_100286491 | 3300005564 | Bacteria | 1486 |
| 88 | Ga0068857_100152834 | 3300005577 | Bacteria | 2092 |
| 89 | Ga0068857_100189935 | 3300005577 | Bacteria | 1871 |
| 90 | Ga0068854_100206404 | 3300005578 | Bacteria | 1547 |
| 91 | Ga0070702_100022253 | 3300005615 | Bacteria | 3347 |
| 92 | Ga0070702_100373061 | 3300005615 | Bacteria | 1012 |
| 93 | Ga0068852_100173372 | 3300005616 | Bacteria | 2024 |
| 94 | Ga0068852_100355761 | 3300005616 | Bacteria | 1431 |
| 95 | Ga0068859_100138390 | 3300005617 | Bacteria | 2508 |
| 96 | Ga0068864_100017181 | 3300005618 | Bacteria | 6034 |
| 97 | Ga0068864_100085339 | 3300005618 | Bacteria | 2776 |
| 98 | Ga0068861_100584760 | 3300005719 | Bacteria | 1022 |
| 99 | Ga0068870_10006351 | 3300005840 | Bacteria | 5204 |
| 100 | Ga0068863_100286819 | 3300005841 | Bacteria | 1595 |
| 101 | Ga0068858_100078707 | 3300005842 | Bacteria | 3063 |
| 102 | Ga0068858_100160790 | 3300005842 | Bacteria | 2115 |
| 103 | Ga0068860_100016941 | 3300005843 | Bacteria | 7102 |
| 104 | Ga0068860_100276532 | 3300005843 | Bacteria | 1640 |
| 105 | Ga0068860_100711379 | 3300005843 | Bacteria | 1015 |
| 106 | Ga0068862_100122722 | 3300005844 | Bacteria | 2291 |
| 107 | Ga0068862_100187548 | 3300005844 | Bacteria | 1859 |
| 108 | Ga0081455_10161739 | 3300005937 | Bacteria | 1715 |
| 109 | Ga0075365_10347543 | 3300006038 | Bacteria | 1045 |
| 110 | Ga0075368_10136844 | 3300006042 | Bacteria | 1019 |
| 111 | Ga0075363_100049026 | 3300006048 | Bacteria | 2247 |
| 112 | Ga0075363_100141160 | 3300006048 | Bacteria | 1356 |
| 113 | Ga0075364_10390444 | 3300006051 | Bacteria | 949 |
| 114 | Ga0070716_100327851 | 3300006173 | Bacteria | 1075 |
| 115 | Ga0070712_100014863 | 3300006175 | Bacteria | 5003 |
| 116 | Ga0070712_100331071 | 3300006175 | Bacteria | 1241 |
| 117 | Ga0075362_10080107 | 3300006177 | Bacteria | 1504 |
| 118 | Ga0075367_10106405 | 3300006178 | Bacteria | 1719 |
| 119 | Ga0075366_10015036 | 3300006195 | Bacteria | 4426 |
| 120 | Ga0097621_100102300 | 3300006237 | Bacteria | 2412 |
| 121 | Ga0075370_10048120 | 3300006353 | Bacteria | 2415 |
| 122 | Ga0068871_100065584 | 3300006358 | Bacteria | 2974 |
| 123 | Ga0068871_100087758 | 3300006358 | Bacteria | 2587 |
| 124 | Ga0075431_100621178 | 3300006847 | Bacteria | 1063 |
| 125 | Ga0075434_100110126 | 3300006871 | Bacteria | 2765 |
| 126 | Ga0068865_100026671 | 3300006881 | Bacteria | 3811 |
| 127 | Ga0068865_100035370 | 3300006881 | Bacteria | 3358 |
| 128 | Ga0097620_100138394 | 3300006931 | Bacteria | 2508 |
| 129 | Ga0099823_1009325 | 3300006944 | Bacteria | 9966 |
| 130 | Ga0099794_10028156 | 3300007265 | Bacteria | 2612 |
| 131 | Ga0099795_10005919 | 3300007788 | Bacteria | 3295 |
| 132 | Ga0105240_10121453 | 3300009093 | Bacteria | 3145 |
| 133 | Ga0111539_10012295 | 3300009094 | Bacteria | 10730 |
| 134 | Ga0111539_10170937 | 3300009094 | Bacteria | 2539 |
| 135 | Ga0105247_10006181 | 3300009101 | Bacteria | 7433 |
| 136 | Ga0105247_10015382 | 3300009101 | Bacteria | 4583 |
| 137 | Ga0105243_10045733 | 3300009148 | Bacteria | 3441 |
| 138 | Ga0105241_10358864 | 3300009174 | Bacteria | 1268 |
| 139 | Ga0105241_10375668 | 3300009174 | Bacteria | 1240 |
| 140 | Ga0105242_10233439 | 3300009176 | Bacteria | 1650 |
| 141 | Ga0105248_10238787 | 3300009177 | Bacteria | 2046 |
| 142 | Ga0105248_10244610 | 3300009177 | Bacteria | 2019 |
| 143 | Ga0105237_10034852 | 3300009545 | Bacteria | 5093 |
| 144 | Ga0105237_10043927 | 3300009545 | Bacteria | 4500 |
| 145 | Ga0105237_10198544 | 3300009545 | Bacteria | 2005 |
| 146 | Ga0105237_10199931 | 3300009545 | Bacteria | 1998 |
| 147 | Ga0105238_10080478 | 3300009551 | Bacteria | 3247 |
| 148 | Ga0105238_10689923 | 3300009551 | Bacteria | 1033 |
| 149 | Ga0105249_10548460 | 3300009553 | Bacteria | 1206 |
| 150 | Ga0105249_10658936 | 3300009553 | Bacteria | 1105 |
| 151 | Ga0099796_10004310 | 3300010159 | Bacteria | 3425 |
| 152 | Ga0105239_10035136 | 3300010375 | Bacteria | 5505 |
| 153 | Ga0105239_10050077 | 3300010375 | Bacteria | 4582 |
| 154 | Ga0105246_10040222 | 3300011119 | Bacteria | 3154 |
| 155 | Ga0105246_10067085 | 3300011119 | Bacteria | 2514 |
| 156 | Ga0157315_1001000 | 3300012508 | Bacteria | 1466 |
| 157 | Ga0157338_1001700 | 3300012515 | Bacteria | 1622 |
| 158 | Ga0157371_10283916 | 3300013102 | Bacteria | 1196 |
| 159 | Ga0157369_10003682 | 3300013105 | Bacteria | 18215 |
| 160 | Ga0157369_11053253 | 3300013105 | Bacteria | 832 |
| 161 | Ga0157374_10330293 | 3300013296 | Bacteria | 1512 |
| 162 | Ga0157378_10208180 | 3300013297 | Bacteria | 1853 |
| 163 | Ga0157378_10426650 | 3300013297 | Bacteria | 1311 |
| 164 | Ga0163162_10007555 | 3300013306 | Bacteria | 10587 |
| 165 | Ga0163162_10114190 | 3300013306 | Bacteria | 2800 |
| 166 | Ga0163162_10292964 | 3300013306 | Bacteria | 1759 |
| 167 | Ga0163162_10294669 | 3300013306 | Bacteria | 1754 |
| 168 | Ga0163162_10611474 | 3300013306 | Bacteria | 1215 |
| 169 | Ga0157372_10368308 | 3300013307 | Bacteria | 1674 |
| 170 | Ga0157375_10180032 | 3300013308 | Bacteria | 2265 |
| 171 | Ga0157375_10703866 | 3300013308 | Bacteria | 1164 |
| 172 | Ga0157375_10795229 | 3300013308 | Bacteria | 1095 |
| 173 | Ga0163163_10020055 | 3300014325 | Bacteria | 6291 |
| 174 | Ga0163163_10021399 | 3300014325 | Bacteria | 6103 |
| 175 | Ga0163163_10214256 | 3300014325 | Bacteria | 1975 |
| 176 | Ga0157380_10194015 | 3300014326 | Bacteria | 1796 |
| 177 | Ga0157377_10304541 | 3300014745 | Bacteria | 1053 |
| 178 | Ga0157379_10027154 | 3300014968 | Bacteria | 5096 |
| 179 | Ga0157379_10060926 | 3300014968 | Bacteria | 3374 |
| 180 | Ga0157379_10080253 | 3300014968 | Bacteria | 2923 |
| 181 | Ga0157376_10058961 | 3300014969 | Bacteria | 3217 |
| 182 | Ga0157376_10332288 | 3300014969 | Bacteria | 1448 |
| 183 | Ga0213872_10023492 | 3300021361 | Bacteria | 2837 |
| 184 | Ga0213874_10003885 | 3300021377 | Bacteria | 3360 |
| 185 | Ga0213876_10097017 | 3300021384 | Bacteria | 1562 |
| 186 | Ga0228598_1002348 | 3300024227 | Bacteria | 4135 |
| 187 | Ga0209258_100453 | 3300025242 | Bacteria | 45277 |
| 188 | Ga0209759_1001564 | 3300025256 | Bacteria | 12493 |
| 189 | Ga0207666_1001220 | 3300025271 | Bacteria | 3024 |
| 190 | Ga0209455_1000157 | 3300025272 | Bacteria | 119719 |
| 191 | Ga0209256_1022068 | 3300025299 | Bacteria | 1937 |
| 192 | Ga0207697_10029415 | 3300025315 | Bacteria | 2248 |
| 193 | Ga0207653_10024549 | 3300025885 | Bacteria | 1924 |
| 194 | Ga0207688_10006296 | 3300025901 | Bacteria | 6464 |
| 195 | Ga0207688_10022635 | 3300025901 | Bacteria | 3440 |
| 196 | Ga0207688_10044743 | 3300025901 | Bacteria | 2467 |
| 197 | Ga0207680_10099999 | 3300025903 | Bacteria | 1861 |
| 198 | Ga0207647_10003322 | 3300025904 | Bacteria | 12085 |
| 199 | Ga0207647_10209839 | 3300025904 | Bacteria | 1125 |
| 200 | Ga0207699_10006782 | 3300025906 | Bacteria | 5568 |
| 201 | Ga0207699_10029671 | 3300025906 | Bacteria | 3052 |
| 202 | Ga0207645_10063226 | 3300025907 | Bacteria | 2365 |
| 203 | Ga0207643_10008573 | 3300025908 | Bacteria | 5484 |
| 204 | Ga0207707_10001362 | 3300025912 | Bacteria | 22693 |
| 205 | Ga0207707_10160380 | 3300025912 | Bacteria | 1966 |
| 206 | Ga0207695_10662784 | 3300025913 | Bacteria | 924 |
| 207 | Ga0207671_10210241 | 3300025914 | Bacteria | 1522 |
| 208 | Ga0207693_10030351 | 3300025915 | Bacteria | 4269 |
| 209 | Ga0207663_10175817 | 3300025916 | Bacteria | 1525 |
| 210 | Ga0207660_10021958 | 3300025917 | Bacteria | 4297 |
| 211 | Ga0207660_10092594 | 3300025917 | Bacteria | 2244 |
| 212 | Ga0207662_10019216 | 3300025918 | Bacteria | 3884 |
| 213 | Ga0207657_10033148 | 3300025919 | Bacteria | 4659 |
| 214 | Ga0207652_10037929 | 3300025921 | Bacteria | 4081 |
| 215 | Ga0207652_10157299 | 3300025921 | Bacteria | 2036 |
| 216 | Ga0207694_10038564 | 3300025924 | Bacteria | 3674 |
| 217 | Ga0207694_10150395 | 3300025924 | Bacteria | 1875 |
| 218 | Ga0207694_10515340 | 3300025924 | Bacteria | 1002 |
| 219 | Ga0207650_10583267 | 3300025925 | Bacteria | 939 |
| 220 | Ga0207659_10050758 | 3300025926 | Bacteria | 2948 |
| 221 | Ga0207659_10111117 | 3300025926 | Bacteria | 2084 |
| 222 | Ga0207700_10143848 | 3300025928 | Bacteria | 1963 |
| 223 | Ga0207700_10191022 | 3300025928 | Bacteria | 1721 |
| 224 | Ga0207700_10223431 | 3300025928 | Bacteria | 1598 |
| 225 | Ga0207690_10173942 | 3300025932 | Bacteria | 1615 |
| 226 | Ga0207706_10006317 | 3300025933 | Bacteria | 11008 |
| 227 | Ga0207706_10063556 | 3300025933 | Bacteria | 3250 |
| 228 | Ga0207706_10070104 | 3300025933 | Bacteria | 3083 |
| 229 | Ga0207709_10029796 | 3300025935 | Bacteria | 3170 |
| 230 | Ga0207670_10008187 | 3300025936 | Bacteria | 5883 |
| 231 | Ga0207669_10141123 | 3300025937 | Bacteria | 1672 |
| 232 | Ga0207704_10192668 | 3300025938 | Bacteria | 1484 |
| 233 | Ga0207665_10472924 | 3300025939 | Bacteria | 965 |
| 234 | Ga0207691_10009787 | 3300025940 | Bacteria | 9202 |
| 235 | Ga0207691_10041676 | 3300025940 | Bacteria | 4238 |
| 236 | Ga0207711_10157710 | 3300025941 | Bacteria | 2052 |
| 237 | Ga0207689_10019815 | 3300025942 | Bacteria | 5666 |
| 238 | Ga0207661_10002357 | 3300025944 | Bacteria | 13009 |
| 239 | Ga0207661_10179682 | 3300025944 | Bacteria | 1847 |
| 240 | Ga0207679_10092090 | 3300025945 | Bacteria | 2348 |
| 241 | Ga0207667_10024554 | 3300025949 | Bacteria | 6615 |
| 242 | Ga0207667_10048182 | 3300025949 | Bacteria | 4506 |
| 243 | Ga0207667_10142328 | 3300025949 | Bacteria | 2469 |
| 244 | Ga0207667_10719093 | 3300025949 | Bacteria | 1000 |
| 245 | Ga0207651_10049604 | 3300025960 | Bacteria | 2845 |
| 246 | Ga0207712_10337620 | 3300025961 | Bacteria | 1248 |
| 247 | Ga0207668_10024716 | 3300025972 | Bacteria | 3881 |
| 248 | Ga0207640_10502993 | 3300025981 | Bacteria | 1009 |
| 249 | Ga0207658_10369189 | 3300025986 | Bacteria | 1254 |
| 250 | Ga0207703_10056119 | 3300026035 | Bacteria | 3207 |
| 251 | Ga0207703_10096833 | 3300026035 | Bacteria | 2492 |
| 252 | Ga0207703_10116701 | 3300026035 | Bacteria | 2286 |
| 253 | Ga0207639_10053071 | 3300026041 | Bacteria | 3091 |
| 254 | Ga0207639_10082020 | 3300026041 | Bacteria | 2556 |
| 255 | Ga0207639_10262038 | 3300026041 | Bacteria | 1512 |
| 256 | Ga0207639_10365579 | 3300026041 | Bacteria | 1292 |
| 257 | Ga0207678_10025630 | 3300026067 | Bacteria | 5147 |
| 258 | Ga0207678_10030703 | 3300026067 | Bacteria | 4692 |
| 259 | Ga0207678_10061333 | 3300026067 | Bacteria | 3234 |
| 260 | Ga0207708_10011723 | 3300026075 | Bacteria | 6534 |
| 261 | Ga0207708_10088911 | 3300026075 | Bacteria | 2380 |
| 262 | Ga0207702_10066021 | 3300026078 | Bacteria | 3100 |
| 263 | Ga0207641_10017320 | 3300026088 | Bacteria | 5898 |
| 264 | Ga0207641_10297567 | 3300026088 | Bacteria | 1523 |
| 265 | Ga0207648_10050414 | 3300026089 | Bacteria | 3640 |
| 266 | Ga0207648_10050996 | 3300026089 | Bacteria | 3617 |
| 267 | Ga0207648_10213475 | 3300026089 | Bacteria | 1714 |
| 268 | Ga0207676_10015307 | 3300026095 | Bacteria | 5531 |
| 269 | Ga0207676_10633304 | 3300026095 | Bacteria | 1030 |
| 270 | Ga0207674_10057890 | 3300026116 | Bacteria | 3928 |
| 271 | Ga0207674_10083576 | 3300026116 | Bacteria | 3192 |
| 272 | Ga0207674_10107865 | 3300026116 | Bacteria | 2761 |
| 273 | Ga0207675_100012644 | 3300026118 | Bacteria | 7887 |
| 274 | Ga0207675_100056416 | 3300026118 | Bacteria | 3664 |
| 275 | Ga0207683_10092022 | 3300026121 | Bacteria | 2702 |
| 276 | Ga0207698_10487817 | 3300026142 | Bacteria | 1197 |
| 277 | Ga0209389_1004554 | 3300027296 | Bacteria | 11577 |
| 278 | Ga0209179_1027748 | 3300027512 | Bacteria | 1144 |
| 279 | Ga0209966_1000561 | 3300027695 | Bacteria | 9270 |
| 280 | Ga0209998_10000337 | 3300027717 | Bacteria | 13862 |
| 281 | Ga0209813_10022792 | 3300027866 | Bacteria | 1775 |
| 282 | Ga0207428_10000617 | 3300027907 | Bacteria | 42011 |
| 283 | Ga0268266_10121072 | 3300028379 | Bacteria | 2329 |
| 284 | Ga0268266_10195487 | 3300028379 | Bacteria | 1849 |
| 285 | Ga0268266_10369185 | 3300028379 | Bacteria | 1351 |
| 286 | Ga0268265_10323540 | 3300028380 | Bacteria | 1398 |
| 287 | Ga0268265_10635241 | 3300028380 | Bacteria | 1024 |
| 288 | Ga0268264_10192887 | 3300028381 | Bacteria | 1858 |
| 289 | Ga0268264_10236427 | 3300028381 | Bacteria | 1690 |
| 290 | Ga0268264_10264664 | 3300028381 | Bacteria | 1604 |
| 291 | Ga0265318_10007275 | 3300028577 | Bacteria | 5020 |
| 292 | Ga0307517_10110399 | 3300028786 | Bacteria | 2097 |
| 293 | Ga0265762_1032748 | 3300030760 | Bacteria | 992 |
| 294 | Ga0265330_10095027 | 3300031235 | Bacteria | 1278 |
| 295 | Ga0265320_10011536 | 3300031240 | Bacteria | 5192 |
| 296 | Ga0265325_10008767 | 3300031241 | Bacteria | 5947 |
| 297 | Ga0265329_10009771 | 3300031242 | Bacteria | 3557 |
| 298 | Ga0265340_10002685 | 3300031247 | Bacteria | 10115 |
| 299 | Ga0265339_10091937 | 3300031249 | Bacteria | 1589 |
| 300 | Ga0265331_10021931 | 3300031250 | Bacteria | 3262 |
| 301 | Ga0265316_10236374 | 3300031344 | Bacteria | 1344 |
| 302 | Ga0307513_10003287 | 3300031456 | Bacteria | 22017 |
| 303 | Ga0265314_10043915 | 3300031711 | Bacteria | 3172 |
| 304 | Ga0265342_10016076 | 3300031712 | Bacteria | 4900 |
| 305 | Ga0265342_10130218 | 3300031712 | Bacteria | 1410 |
| 306 | Ga0373930_0000783 | 3300034816 | Bacteria | 4522 |
| 307 | Ga0373948_0000589 | 3300034817 | Bacteria | 4652 |
| 308 | Ga0373958_0000380 | 3300034819 | Bacteria | 5375 |
| 309 | Ga0373959_0001298 | 3300034820 | Bacteria | 4007 |
| 310 | Ga0373926_0024367 | 3300035083 | Bacteria | 2107 |
| 311 | Ga0373928_0000205 | 3300035084 | Bacteria | 11403 |
| 312 | Ga0373929_0005397 | 3300035085 | Bacteria | 2298 |
| 313 | Ga0373934_0038077 | 3300035086 | Bacteria | 1894 |
| 314 | Ga0373934_0098498 | 3300035086 | Bacteria | 1181 |
| 315 | Ga0373944_0000948 | 3300035089 | Bacteria | 7186 |
| 316 | Ga0373944_0185706 | 3300035089 | Bacteria | 747 |
| 317 | Ga0373949_0001679 | 3300035090 | Bacteria | 6169 |
| 318 | Ga0373952_0021214 | 3300035092 | Bacteria | 1369 |
| 319 | Ga0373923_0000023 | 3300035111 | Bacteria | 23047 |
| 320 | Ga0373923_0019383 | 3300035111 | Bacteria | 2634 |
| 321 | Ga0373923_0085235 | 3300035111 | Bacteria | 1375 |
| 322 | Ga0373923_0098524 | 3300035111 | Bacteria | 1286 |
| 323 | Ga0373932_0000746 | 3300035112 | Bacteria | 9717 |
| 324 | Ga0373936_0000171 | 3300035113 | Bacteria | 21558 |
| 325 | Ga0373936_0016160 | 3300035113 | Bacteria | 2869 |
| 326 | Ga0373936_0034409 | 3300035113 | Bacteria | 2012 |
| 327 | Ga0373936_0232532 | 3300035113 | Bacteria | 820 |
| 328 | Ga0373936_0273720 | 3300035113 | Bacteria | 758 |
| 329 | Ga0373939_0000794 | 3300035114 | Bacteria | 7784 |
| 330 | Ga0373941_0064956 | 3300035115 | Bacteria | 1197 |
| 331 | Ga0373945_0012431 | 3300035116 | Bacteria | 2828 |
| 332 | Ga0373945_0094072 | 3300035116 | Bacteria | 1164 |
| 333 | Ga0373953_0000572 | 3300035117 | Bacteria | 10237 |
| 334 | Ga0373953_0006693 | 3300035117 | Bacteria | 3814 |
| 335 | Ga0373953_0014809 | 3300035117 | Bacteria | 2813 |
| 336 | Ga0373954_0002827 | 3300035118 | Bacteria | 7308 |
| 337 | Ga0373954_0006983 | 3300035118 | Bacteria | 4931 |
| 338 | Ga0373954_0121204 | 3300035118 | Bacteria | 1269 |
| 339 | Ga0373954_0416003 | 3300035118 | Bacteria | 665 |
| 340 | Ga0373956_0017451 | 3300035119 | Bacteria | 3025 |
| 341 | Ga0373956_0027398 | 3300035119 | Bacteria | 2474 |
| 342 | Ga0373956_0028006 | 3300035119 | Bacteria | 2450 |
| 343 | Ga0373957_0097152 | 3300035120 | Bacteria | 1176 |
| 344 | Ga0373957_0388810 | 3300035120 | Bacteria | 599 |
| 345 | Ga0373960_0001070 | 3300035121 | Bacteria | 5904 |
| 346 | Ga0373943_0000022 | 3300035170 | Bacteria | 52033 |
| 347 | Ga0373943_0003257 | 3300035170 | Bacteria | 7373 |
| 348 | Ga0373943_0138559 | 3300035170 | Bacteria | 1309 |
| 349 | Ga0373943_0238247 | 3300035170 | Bacteria | 1019 |
| 350 | Ga0373946_0000384 | 3300035171 | Bacteria | 14370 |
| 351 | Ga0373946_0005588 | 3300035171 | Bacteria | 4538 |
| 352 | Ga0373946_0005813 | 3300035171 | Bacteria | 4462 |
| 353 | Ga0373955_0000031 | 3300035172 | Bacteria | 56668 |
| 354 | Ga0373955_0083306 | 3300035172 | Bacteria | 1811 |
| 355 | Ga0373955_0090574 | 3300035172 | Bacteria | 1742 |
| 356 | Ga0373955_0165501 | 3300035172 | Bacteria | 1307 |
| 357 | Ga0373942_0000880 | 3300035207 | Bacteria | 8248 |
| 358 | Ga0373961_0002053 | 3300035241 | Bacteria | 5378 |
| 359 | Ga0373961_0045791 | 3300035241 | Bacteria | 1280 |
| 360 | Ga0373962_0001576 | 3300035242 | Bacteria | 5408 |
| 361 | Ga0373924_0003376 | 3300035410 | Bacteria | 5484 |
| 362 | Ga0373924_0138213 | 3300035410 | Bacteria | 1062 |
| 363 | Ga0373931_0041070 | 3300035691 | Bacteria | 2429 |
| 364 | Ga0373935_0000461 | 3300035692 | Bacteria | 21136 |
| 365 | Ga0373935_0004500 | 3300035692 | Bacteria | 8191 |
| 366 | Ga0373935_0068360 | 3300035692 | Bacteria | 2286 |
| 367 | Ga0373935_0089226 | 3300035692 | Bacteria | 2016 |
| 368 | Ga0373927_0000113 | 3300035695 | Bacteria | 60608 |
| 369 | Ga0373927_0020575 | 3300035695 | Bacteria | 4327 |
| 370 | Ga0373927_0066897 | 3300035695 | Bacteria | 2325 |
| 371 | Ga0373927_0123584 | 3300035695 | Bacteria | 1689 |
| 372 | Ga0373933_0000638 | 3300035724 | Bacteria | 21867 |
| 373 | Ga0373933_0002640 | 3300035724 | Bacteria | 10041 |
| 374 | Ga0373933_0044251 | 3300035724 | Bacteria | 2637 |
| 375 | Ga0373947_0000244 | 3300035725 | Bacteria | 30605 |
| 376 | Ga0373947_0001403 | 3300035725 | Bacteria | 14824 |
| 377 | Ga0373947_0025025 | 3300035725 | Bacteria | 3480 |
| 378 | Ga0373937_0000098 | 3300036401 | Bacteria | 81900 |
| 379 | Ga0373937_0019040 | 3300036401 | Bacteria | 6142 |
| 380 | Ga0373937_0046591 | 3300036401 | Bacteria | 3965 |
| 381 | Ga0373937_0046721 | 3300036401 | Bacteria | 3959 |
| 382 | Ga0373937_0143963 | 3300036401 | Bacteria | 2230 |
| 383 | Ga0373937_0339816 | 3300036401 | Bacteria | 1422 |
| 384 | Ga0373925_0000198 | 3300037068 | Bacteria | 65543 |
| 385 | Ga0373925_0001554 | 3300037068 | Bacteria | 19523 |
| 386 | Ga0373925_0078607 | 3300037068 | Bacteria | 2505 |
| 387 | Ga0373925_0106466 | 3300037068 | Bacteria | 2162 |
| 388 | Ga0373925_0178283 | 3300037068 | Bacteria | 1680 |
| 389 | Ga0373925_0340550 | 3300037068 | Bacteria | 1216 |
| 390 | Ga0373925_0460797 | 3300037068 | Bacteria | 1042 |
| 391 | Ga0373925_0819720 | 3300037068 | Bacteria | 767 |
| 392 | Ga0436364_1556608 | 3300037853 | Bacteria | 1428 |
| 393 | Ga0436365_1498030 | 3300039437 | Bacteria | 1371 |
| 394 | Ga0436361_0956991 | 3300039447 | Bacteria | 4949 |
| 395 | Ga0436363_0098309 | 3300039450 | Bacteria | 27510 |
| 396 | Ga0451795_0506986 | 3300041456 | Bacteria | 2419 |
| 397 | Ga0451798_0262741 | 3300041458 | Bacteria | 2923 |
| 398 | Ga0451800_0296903 | 3300041459 | Bacteria | 2406 |
| 399 | Ga0451802_0154319 | 3300041460 | Bacteria | 2599 |
| 400 | Ga0451577_0260045 | 3300042876 | Bacteria | 1572 |
| 401 | Ga0466968_0209838 | 3300044735 | Bacteria | 915 |
| 402 | Ga0451576_0046866 | 3300045051 | Bacteria | 4549 |
| 403 | Ga0466967_0297512 | 3300045976 | Bacteria | 1552 |
| 404 | Ga0495592_0000119 | 3300046454 | Bacteria | 69687 |
| 405 | Ga0495592_0004538 | 3300046454 | Bacteria | 10168 |
| 406 | Ga0495592_0047069 | 3300046454 | Bacteria | 3213 |
| 407 | Ga0495592_0080596 | 3300046454 | Bacteria | 2355 |
| 408 | Ga0495592_0083439 | 3300046454 | Bacteria | 2307 |
| 409 | Ga0495629_0003106 | 3300046459 | Bacteria | 12592 |
| 410 | Ga0495629_0028439 | 3300046459 | Bacteria | 3969 |
| 411 | Ga0495629_0029980 | 3300046459 | Bacteria | 3856 |
| 412 | Ga0495629_0030274 | 3300046459 | Bacteria | 3839 |
| 413 | Ga0495629_0090673 | 3300046459 | Bacteria | 2133 |
| 414 | Ga0495651_0002375 | 3300046462 | Bacteria | 14542 |
| 415 | Ga0495653_0000030 | 3300046463 | Bacteria | 142668 |
| 416 | Ga0495653_0116712 | 3300046463 | Bacteria | 1908 |
| 417 | Ga0495653_0135065 | 3300046463 | Bacteria | 1741 |
| 418 | Ga0495653_0164222 | 3300046463 | Bacteria | 1539 |
| 419 | Ga0495653_0443910 | 3300046463 | Bacteria | 817 |
| 420 | Ga0495580_0021704 | 3300046472 | Bacteria | 4735 |
| 421 | Ga0495580_0206597 | 3300046472 | Bacteria | 1352 |
| 422 | Ga0495639_0007988 | 3300046475 | Bacteria | 4544 |
| 423 | Ga0495639_0036452 | 3300046475 | Bacteria | 2203 |
| 424 | Ga0495662_0001102 | 3300046476 | Bacteria | 13286 |
| 425 | Ga0495662_0007134 | 3300046476 | Bacteria | 5538 |
| 426 | Ga0495662_0021221 | 3300046476 | Bacteria | 3140 |
| 427 | Ga0495662_0056954 | 3300046476 | Bacteria | 1887 |
| 428 | Ga0495662_0126348 | 3300046476 | Bacteria | 1256 |
| 429 | Ga0495664_0000003 | 3300046477 | Bacteria | 551602 |
| 430 | Ga0495664_0002872 | 3300046477 | Bacteria | 9287 |
| 431 | Ga0495664_0016526 | 3300046477 | Bacteria | 4206 |
| 432 | Ga0495664_0044439 | 3300046477 | Bacteria | 2632 |
| 433 | Ga0495664_0353333 | 3300046477 | Bacteria | 885 |
| 434 | Ga0495585_0179113 | 3300046492 | Bacteria | 1091 |
| 435 | Ga0495594_0262791 | 3300046499 | Bacteria | 983 |
| 436 | Ga0495608_0000011 | 3300046511 | Bacteria | 248514 |
| 437 | Ga0495608_0002101 | 3300046511 | Bacteria | 14347 |
| 438 | Ga0495608_0300899 | 3300046511 | Bacteria | 993 |
| 439 | Ga0495618_0000025 | 3300046514 | Bacteria | 116027 |
| 440 | Ga0495618_0005719 | 3300046514 | Bacteria | 7555 |
| 441 | Ga0495618_0173426 | 3300046514 | Bacteria | 1372 |
| 442 | Ga0495618_0182163 | 3300046514 | Bacteria | 1334 |
| 443 | Ga0495618_0284620 | 3300046514 | Bacteria | 1030 |
| 444 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 445 | Ga0495628_0119849 | 3300046516 | Bacteria | 2019 |
| 446 | Ga0495628_0147976 | 3300046516 | Bacteria | 1790 |
| 447 | Ga0495630_0000551 | 3300046517 | Bacteria | 27325 |
| 448 | Ga0495630_0002011 | 3300046517 | Bacteria | 14140 |
| 449 | Ga0495630_0015505 | 3300046517 | Bacteria | 5565 |
| 450 | Ga0495630_0153897 | 3300046517 | Bacteria | 1750 |
| 451 | Ga0495630_0254220 | 3300046517 | Bacteria | 1342 |
| 452 | Ga0495632_0026673 | 3300046519 | Bacteria | 3038 |
| 453 | Ga0495644_0107231 | 3300046523 | Bacteria | 1059 |
| 454 | Ga0495648_0139816 | 3300046524 | Bacteria | 1276 |
| 455 | Ga0495663_0070975 | 3300046525 | Bacteria | 1109 |
| 456 | Ga0495666_0008360 | 3300046526 | Bacteria | 5188 |
| 457 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 458 | Ga0495652_0002923 | 3300046529 | Bacteria | 17195 |
| 459 | Ga0495652_0012755 | 3300046529 | Bacteria | 7571 |
| 460 | Ga0495652_0224146 | 3300046529 | Bacteria | 1411 |
| 461 | Ga0495652_0319909 | 3300046529 | Bacteria | 1121 |
| 462 | Ga0495665_0051806 | 3300046531 | Bacteria | 2173 |
| 463 | Ga0495665_0192218 | 3300046531 | Bacteria | 1059 |
| 464 | Ga0495665_0238181 | 3300046531 | Bacteria | 938 |
| 465 | Ga0495640_0000002 | 3300046533 | Bacteria | 646434 |
| 466 | Ga0495640_0006879 | 3300046533 | Bacteria | 8960 |
| 467 | Ga0495640_0292782 | 3300046533 | Bacteria | 1012 |
| 468 | Ga0495587_0000001 | 3300046536 | Bacteria | 724132 |
| 469 | Ga0495587_0044468 | 3300046536 | Bacteria | 2641 |
| 470 | Ga0495587_0356734 | 3300046536 | Bacteria | 814 |
| 471 | Ga0495621_0001598 | 3300046539 | Bacteria | 5909 |
| 472 | Ga0495645_0000002 | 3300046543 | Bacteria | 651644 |
| 473 | Ga0495645_0023765 | 3300046543 | Bacteria | 4442 |
| 474 | Ga0495667_0000004 | 3300046559 | Bacteria | 295297 |
| 475 | Ga0495667_0009464 | 3300046559 | Bacteria | 6602 |
| 476 | Ga0495667_0017883 | 3300046559 | Bacteria | 4789 |
| 477 | Ga0495667_0268325 | 3300046559 | Bacteria | 1085 |
| 478 | Ga0495668_0046435 | 3300046616 | Bacteria | 2413 |
| 479 | Ga0495668_0292311 | 3300046616 | Bacteria | 893 |
| 480 | Ga0495634_0000010 | 3300046642 | Bacteria | 143792 |
| 481 | Ga0495634_0005170 | 3300046642 | Bacteria | 10079 |
| 482 | Ga0495634_0027528 | 3300046642 | Bacteria | 3954 |
| 483 | Ga0495634_0028467 | 3300046642 | Bacteria | 3878 |
| 484 | Ga0495634_0054475 | 3300046642 | Bacteria | 2677 |
| 485 | Ga0495634_0054733 | 3300046642 | Bacteria | 2669 |
| 486 | Ga0495635_0000001 | 3300046663 | Bacteria | 704901 |
| 487 | Ga0495635_0004596 | 3300046663 | Bacteria | 9573 |
| 488 | Ga0495635_0025067 | 3300046663 | Bacteria | 4155 |
| 489 | Ga0495635_0032643 | 3300046663 | Bacteria | 3611 |
| 490 | Ga0495635_0388286 | 3300046663 | Bacteria | 928 |
| 491 | Ga0495657_0000369 | 3300046675 | Bacteria | 41664 |
| 492 | Ga0495657_0031002 | 3300046675 | Bacteria | 3740 |
| 493 | Ga0495599_0000013 | 3300046678 | Bacteria | 179828 |
| 494 | Ga0495599_0022609 | 3300046678 | Bacteria | 3926 |
| 495 | Ga0495623_0000024 | 3300046679 | Bacteria | 96499 |
| 496 | Ga0495623_0003190 | 3300046679 | Bacteria | 10828 |
| 497 | Ga0495623_0051910 | 3300046679 | Bacteria | 2593 |
| 498 | Ga0495646_0000009 | 3300046680 | Bacteria | 200698 |
| 499 | Ga0495646_0029662 | 3300046680 | Bacteria | 3419 |
| 500 | Ga0495646_0113321 | 3300046680 | Bacteria | 1542 |
| 501 | Ga0495647_0199036 | 3300046681 | Bacteria | 878 |
| 502 | Ga0495658_0021427 | 3300046683 | Bacteria | 3407 |
| 503 | Ga0495658_0073899 | 3300046683 | Bacteria | 1986 |
| 504 | Ga0495669_0199226 | 3300046684 | Bacteria | 957 |
| 505 | Ga0495613_0006467 | 3300046689 | Bacteria | 8758 |
| 506 | Ga0495624_0004319 | 3300046690 | Bacteria | 10428 |
| 507 | Ga0495624_0011364 | 3300046690 | Bacteria | 6119 |
| 508 | Ga0495649_0265546 | 3300046694 | Bacteria | 879 |
| 509 | Ga0495600_0000071 | 3300046809 | Bacteria | 55914 |
| 510 | Ga0495581_0005578 | 3300047315 | Bacteria | 7292 |
| 511 | Ga0495581_0021230 | 3300047315 | Bacteria | 3766 |
| 512 | Ga0495581_0105810 | 3300047315 | Bacteria | 1635 |
| 513 | Ga0495604_0000129 | 3300047317 | Bacteria | 63593 |
| 514 | Ga0495604_0004930 | 3300047317 | Bacteria | 10583 |
| 515 | Ga0495636_0005689 | 3300047318 | Bacteria | 4887 |
| 516 | Ga0495674_0000002 | 3300047319 | Bacteria | 642785 |
| 517 | Ga0495674_0012602 | 3300047319 | Bacteria | 7966 |
| 518 | Ga0495674_0014359 | 3300047319 | Bacteria | 7416 |
| 519 | Ga0495674_0130122 | 3300047319 | Bacteria | 2121 |
| 520 | Ga0495674_0372884 | 3300047319 | Bacteria | 1156 |
| 521 | Ga0495672_0157625 | 3300047320 | Bacteria | 1171 |
| 522 | Ga0495672_0199708 | 3300047320 | Bacteria | 1001 |
| 523 | Ga0495676_0143597 | 3300047321 | Bacteria | 1708 |
| 524 | Ga0495676_0229096 | 3300047321 | Bacteria | 1277 |
| 525 | Ga0495680_0000853 | 3300047322 | Bacteria | 33888 |
| 526 | Ga0495680_0049963 | 3300047322 | Bacteria | 3272 |
| 527 | Ga0495687_011883 | 3300047443 | Bacteria | 4649 |
| 528 | Ga0495675_0000274 | 3300047444 | Bacteria | 37360 |
| 529 | Ga0495675_0011418 | 3300047444 | Bacteria | 5576 |
| 530 | Ga0495675_0056881 | 3300047444 | Bacteria | 2480 |
| 531 | Ga0495684_0000083 | 3300047471 | Bacteria | 65861 |
| 532 | Ga0495684_0000845 | 3300047471 | Bacteria | 24740 |
| 533 | Ga0495684_0004293 | 3300047471 | Bacteria | 11126 |
| 534 | Ga0495684_0009757 | 3300047471 | Bacteria | 7409 |
| 535 | Ga0495684_0019817 | 3300047471 | Bacteria | 5183 |
| 536 | Ga0495684_0036691 | 3300047471 | Bacteria | 3757 |
| 537 | Ga0495684_0133514 | 3300047471 | Bacteria | 1863 |
| 538 | Ga0495593_0005774 | 3300047673 | Bacteria | 7299 |
| 539 | Ga0495593_0013117 | 3300047673 | Bacteria | 4731 |
| 540 | Ga0495602_0000024 | 3300048088 | Bacteria | 151162 |
| 541 | Ga0495602_0006759 | 3300048088 | Bacteria | 12039 |
| 542 | Ga0495602_0159292 | 3300048088 | Bacteria | 1764 |
| 543 | Ga0495614_0086625 | 3300048089 | Bacteria | 1360 |
| 544 | Ga0495614_0097718 | 3300048089 | Bacteria | 1281 |
| 545 | Ga0496100_0036651 | 3300048903 | Bacteria | 3096 |
| 546 | Ga0496100_0083141 | 3300048903 | Bacteria | 2166 |
| 547 | Ga0496100_0133222 | 3300048903 | Bacteria | 1753 |
| 548 | Ga0496101_0024098 | 3300048904 | Bacteria | 4209 |
| 549 | Ga0496101_0132478 | 3300048904 | Bacteria | 1894 |
| 550 | Ga0496101_0371121 | 3300048904 | Bacteria | 1125 |
| 551 | Ga0496102_0015623 | 3300048905 | Bacteria | 6613 |
| 552 | Ga0496102_0171047 | 3300048905 | Bacteria | 2045 |
| 553 | Ga0496102_0234387 | 3300048905 | Bacteria | 1730 |
| 554 | Ga0496102_0564762 | 3300048905 | Bacteria | 1060 |
| 555 | Ga0496102_0821104 | 3300048905 | Bacteria | 852 |
| 556 | Ga0496103_0018740 | 3300048906 | Bacteria | 4153 |
| 557 | Ga0496103_0023649 | 3300048906 | Bacteria | 3706 |
| 558 | Ga0496104_0000306 | 3300048907 | Bacteria | 43669 |
| 559 | Ga0496104_0000955 | 3300048907 | Bacteria | 24869 |
| 560 | Ga0496104_0001512 | 3300048907 | Bacteria | 20062 |
| 561 | Ga0496104_0084728 | 3300048907 | Bacteria | 3025 |
| 562 | Ga0496104_0109519 | 3300048907 | Bacteria | 2647 |
| 563 | Ga0496104_0157341 | 3300048907 | Bacteria | 2180 |
| 564 | Ga0496104_0202419 | 3300048907 | Bacteria | 1897 |
| 565 | Ga0496104_0208069 | 3300048907 | Bacteria | 1868 |
| 566 | Ga0496104_0277770 | 3300048907 | Bacteria | 1588 |
| 567 | Ga0496105_0001292 | 3300048908 | Bacteria | 17514 |
| 568 | Ga0496105_0018693 | 3300048908 | Bacteria | 5578 |
| 569 | Ga0496105_0025818 | 3300048908 | Bacteria | 4785 |
| 570 | Ga0496105_0115424 | 3300048908 | Bacteria | 2215 |
| 571 | Ga0496105_0209217 | 3300048908 | Bacteria | 1590 |
| 572 | Ga0496105_0378655 | 3300048908 | Bacteria | 1126 |
| 573 | Ga0496106_0018636 | 3300048909 | Bacteria | 5137 |
| 574 | Ga0496106_0024820 | 3300048909 | Bacteria | 4457 |
| 575 | Ga0496106_0047405 | 3300048909 | Bacteria | 3234 |
| 576 | Ga0496106_0086101 | 3300048909 | Bacteria | 2420 |
| 577 | Ga0496106_0121899 | 3300048909 | Bacteria | 2038 |
| 578 | Ga0496107_0048889 | 3300048910 | Bacteria | 3047 |
| 579 | Ga0496107_0109391 | 3300048910 | Bacteria | 2030 |
| 580 | Ga0496108_0122288 | 3300048911 | Bacteria | 2233 |
| 581 | Ga0496108_0749010 | 3300048911 | Bacteria | 845 |
| 582 | Ga0496108_0954121 | 3300048911 | Bacteria | 734 |
| 583 | Ga0496109_0042210 | 3300048912 | Bacteria | 4131 |
| 584 | Ga0496109_0082129 | 3300048912 | Bacteria | 2970 |
| 585 | Ga0496109_0134540 | 3300048912 | Bacteria | 2309 |
| 586 | Ga0496110_0298202 | 3300048913 | Bacteria | 1468 |
| 587 | Ga0496111_0032257 | 3300048914 | Bacteria | 3734 |
| 588 | Ga0496111_0095564 | 3300048914 | Bacteria | 2180 |
| 589 | Ga0496112_0012515 | 3300048915 | Bacteria | 7794 |
| 590 | Ga0496112_0212933 | 3300048915 | Bacteria | 1889 |
| 591 | Ga0496112_0262159 | 3300048915 | Bacteria | 1678 |
| 592 | Ga0496112_0295535 | 3300048915 | Bacteria | 1566 |
| 593 | Ga0496112_0309792 | 3300048915 | Bacteria | 1524 |
| 594 | Ga0496113_0012395 | 3300048916 | Bacteria | 5728 |
| 595 | Ga0496113_0412638 | 3300048916 | Bacteria | 1084 |
| 596 | Ga0496114_0294606 | 3300048917 | Bacteria | 1432 |
| 597 | Ga0496114_0414327 | 3300048917 | Bacteria | 1193 |
| 598 | Ga0496115_0008348 | 3300048918 | Bacteria | 7662 |
| 599 | Ga0496115_0049563 | 3300048918 | Bacteria | 3362 |
| 600 | Ga0496115_0052137 | 3300048918 | Bacteria | 3281 |
| 601 | Ga0496115_0103121 | 3300048918 | Bacteria | 2340 |
| 602 | Ga0496115_0118221 | 3300048918 | Bacteria | 2180 |
| 603 | Ga0496115_0411745 | 3300048918 | Bacteria | 1096 |
| 604 | Ga0496115_0506001 | 3300048918 | Bacteria | 970 |
| 605 | Ga0496121_0370478 | 3300048924 | Bacteria | 948 |
| 606 | Ga0496126_0027851 | 3300048929 | Bacteria | 5390 |
| 607 | Ga0496126_0266241 | 3300048929 | Bacteria | 1424 |
| 608 | Ga0496126_0308291 | 3300048929 | Bacteria | 1304 |
| 609 | Ga0496126_0561252 | 3300048929 | Bacteria | 904 |
| 610 | nmdc:mga0yw44_36490_c1 | 3300050492 | Bacteria | 2897 |
| 611 | nmdc:mga0k408_153462_c1 | 3300050493 | Bacteria | 1372 |
| 612 | nmdc:mga06z11_170107_c1 | 3300050494 | Bacteria | 1251 |
| 613 | nmdc:mga04h51_93850_c1 | 3300050495 | Bacteria | 1084 |
| 614 | nmdc:mga07m45_10104_c1 | 3300050496 | Bacteria | 4917 |
| 615 | nmdc:mga07m45_16539_c1 | 3300050496 | Bacteria | 3949 |
| 616 | nmdc:mga08y16_21947_c1 | 3300050511 | Bacteria | 6740 |
| 617 | nmdc:mga0n895_133889_c1 | 3300050512 | Bacteria | 2504 |
| 618 | Ga0495601_0000001 | 3300053077 | Bacteria | 549454 |
| 619 | Ga0495601_0019342 | 3300053077 | Bacteria | 4153 |
| 620 | Ga0495601_0041050 | 3300053077 | Bacteria | 2899 |
| 621 | Ga0495601_0044713 | 3300053077 | Bacteria | 2784 |
| 622 | Ga0495601_0054650 | 3300053077 | Bacteria | 2527 |
| 623 | Ga0495601_0279501 | 3300053077 | Bacteria | 1088 |
| 624 | Ga0495612_0000017 | 3300053078 | Bacteria | 152112 |
| 625 | Ga0495612_0002989 | 3300053078 | Bacteria | 7016 |
| 626 | Ga0495612_0039500 | 3300053078 | Bacteria | 1920 |
| 627 | Ga0500635_0023486 | 3300053080 | Bacteria | 1925 |
| 628 | Ga0495655_0017966 | 3300053083 | Bacteria | 1548 |
| 629 | Ga0495595_0000010 | 3300053084 | Bacteria | 178819 |
| 630 | Ga0495595_0000287 | 3300053084 | Bacteria | 19822 |
| 631 | Ga0495595_0030593 | 3300053084 | Bacteria | 2416 |
| 632 | Ga0495595_0294005 | 3300053084 | Bacteria | 816 |
| 633 | Ga0495619_0000004 | 3300053085 | Bacteria | 500068 |
| 634 | Ga0495619_0005220 | 3300053085 | Bacteria | 8234 |
| 635 | Ga0495619_0007250 | 3300053085 | Bacteria | 7023 |
| 636 | Ga0495619_0587309 | 3300053085 | Bacteria | 762 |
| 637 | Ga0500578_0209750 | 3300053086 | Bacteria | 1189 |
| 638 | Ga0500644_0141852 | 3300053088 | Bacteria | 955 |
| 639 | Ga0500646_0019730 | 3300053090 | Bacteria | 1785 |
| 640 | Ga0500651_0046070 | 3300053093 | Bacteria | 2742 |
| 641 | Ga0500593_003384 | 3300053117 | Bacteria | 6014 |
| 642 | Ga0500642_0056152 | 3300053130 | Bacteria | 1753 |
| 643 | Ga0500652_000406 | 3300053131 | Bacteria | 15439 |
| 644 | Ga0500568_0109584 | 3300053139 | Bacteria | 1032 |
| 645 | Ga0500577_0006051 | 3300053142 | Bacteria | 3306 |
| 646 | Ga0500579_059645 | 3300053143 | Bacteria | 2275 |
| 647 | Ga0500604_0008480 | 3300053151 | Bacteria | 2726 |
| 648 | Ga0500622_0001930 | 3300053156 | Bacteria | 15634 |
| 649 | Ga0500637_0010767 | 3300053178 | Bacteria | 4702 |
| 650 | Ga0500570_095032 | 3300053724 | Bacteria | 1280 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035120 | Ga0373957_0388810 | Ga0373957_0388810_13_588 | 183 |
| 2 | 3300046517 | Ga0495630_0254220 | Ga0495630_0254220_24_599 | 183 |
| 3 | 3300044735 | Ga0466968_0209838 | Ga0466968_0209838_324_905 | 185 |
| 4 | 3300035118 | Ga0373954_0416003 | Ga0373954_0416003_29_616 | 187 |
| 5 | 3300048929 | Ga0496126_0561252 | Ga0496126_0561252_25_615 | 188 |
| 6 | iso_pu_bacteria | 2906643746 | 2906643801 | 190 |
| 7 | 3300005338 | Ga0068868_100182609 | Ga0068868_1001826092 | 191 |
| 8 | 3300005354 | Ga0070675_100326568 | Ga0070675_1003265682 | 191 |
| 9 | 3300005539 | Ga0068853_100065758 | Ga0068853_1000657582 | 191 |
| 10 | 3300006051 | Ga0075364_10390444 | Ga0075364_103904441 | 191 |
| 11 | 3300009177 | Ga0105248_10244610 | Ga0105248_102446103 | 191 |
| 12 | 3300013308 | Ga0157375_10795229 | Ga0157375_107952291 | 191 |
| 13 | 3300014325 | Ga0163163_10020055 | Ga0163163_100200555 | 191 |
| 14 | 3300025901 | Ga0207688_10006296 | Ga0207688_100062963 | 191 |
| 15 | 3300026041 | Ga0207639_10082020 | Ga0207639_100820203 | 191 |
| 16 | 3300046524 | Ga0495648_0139816 | Ga0495648_0139816_185_877 | 191 |
| 17 | 3300048903 | Ga0496100_0133222 | Ga0496100_0133222_1003_1695 | 191 |
| 18 | 3300048906 | Ga0496103_0023649 | Ga0496103_0023649_1946_2638 | 191 |
| 19 | 3300048907 | Ga0496104_0202419 | Ga0496104_0202419_242_934 | 191 |
| 20 | 3300050496 | nmdc:mga07m45_16539_c1 | nmdc:mga07m45_16539_c1_1870_2562 | 191 |
| 21 | 3300035115 | Ga0373941_0064956 | Ga0373941_0064956_573_1175 | 192 |
| 22 | 3300041458 | Ga0451798_0262741 | Ga0451798_0262741_1085_1774 | 192 |
| 23 | 3300041459 | Ga0451800_0296903 | Ga0451800_0296903_1610_2299 | 192 |
| 24 | 3300041460 | Ga0451802_0154319 | Ga0451802_0154319_925_1614 | 192 |
| 25 | 3300046519 | Ga0495632_0026673 | Ga0495632_0026673_2233_2922 | 192 |
| 26 | 3300053088 | Ga0500644_0141852 | Ga0500644_0141852_97_786 | 192 |
| 27 | 3300053090 | Ga0500646_0019730 | Ga0500646_0019730_233_922 | 192 |
| 28 | 3300053093 | Ga0500651_0046070 | Ga0500651_0046070_375_1064 | 192 |
| 29 | 3300053130 | Ga0500642_0056152 | Ga0500642_0056152_958_1647 | 192 |
| 30 | 3300053131 | Ga0500652_000406 | Ga0500652_000406_8295_8984 | 192 |
| 31 | 3300053143 | Ga0500579_059645 | Ga0500579_059645_708_1397 | 192 |
| 32 | 3300053156 | Ga0500622_0001930 | Ga0500622_0001930_8446_9135 | 192 |
| 33 | 3300009553 | Ga0105249_10658936 | Ga0105249_106589362 | 193 |
| 34 | 3300025961 | Ga0207712_10337620 | Ga0207712_103376202 | 193 |
| 35 | 3300031456 | Ga0307513_10003287 | Ga0307513_1000328718 | 194 |
| 36 | 3300006847 | Ga0075431_100621178 | Ga0075431_1006211782 | 196 |
| 37 | 3300028786 | Ga0307517_10110399 | Ga0307517_101103992 | 196 |
| 38 | 3300035113 | Ga0373936_0273720 | Ga0373936_0273720_77_733 | 196 |
| 39 | 3300035695 | Ga0373927_0123584 | Ga0373927_0123584_566_1246 | 196 |
| 40 | 3300041456 | Ga0451795_0506986 | Ga0451795_0506986_603_1292 | 196 |
| 41 | 3300053142 | Ga0500577_0006051 | Ga0500577_0006051_866_1555 | 196 |
| 42 | 3300053151 | Ga0500604_0008480 | Ga0500604_0008480_1258_1947 | 196 |
| 43 | 3300053724 | Ga0500570_095032 | Ga0500570_095032_417_1106 | 196 |
| 44 | 3300035113 | Ga0373936_0232532 | Ga0373936_0232532_23_643 | 198 |
| 45 | 3300048907 | Ga0496104_0277770 | Ga0496104_0277770_538_1230 | 199 |
| 46 | 3300048915 | Ga0496112_0309792 | Ga0496112_0309792_382_1074 | 199 |
| 47 | 3300053117 | Ga0500593_003384 | Ga0500593_003384_1212_1877 | 199 |
| 48 | 3300025928 | Ga0207700_10191022 | Ga0207700_101910223 | 202 |
| 49 | 3300035086 | Ga0373934_0098498 | Ga0373934_0098498_267_899 | 202 |
| 50 | 3300035111 | Ga0373923_0085235 | Ga0373923_0085235_671_1303 | 202 |
| 51 | 3300035118 | Ga0373954_0121204 | Ga0373954_0121204_112_744 | 202 |
| 52 | 3300035119 | Ga0373956_0027398 | Ga0373956_0027398_199_831 | 202 |
| 53 | 3300035170 | Ga0373943_0238247 | Ga0373943_0238247_214_846 | 202 |
| 54 | 3300035172 | Ga0373955_0083306 | Ga0373955_0083306_41_673 | 202 |
| 55 | 3300035692 | Ga0373935_0068360 | Ga0373935_0068360_322_954 | 202 |
| 56 | 3300035695 | Ga0373927_0066897 | Ga0373927_0066897_499_1131 | 202 |
| 57 | 3300035724 | Ga0373933_0002640 | Ga0373933_0002640_8559_9191 | 202 |
| 58 | 3300036401 | Ga0373937_0019040 | Ga0373937_0019040_3838_4470 | 202 |
| 59 | 3300037068 | Ga0373925_0106466 | Ga0373925_0106466_214_846 | 202 |
| 60 | 3300046454 | Ga0495592_0004538 | Ga0495592_0004538_7924_8556 | 202 |
| 61 | 3300046459 | Ga0495629_0029980 | Ga0495629_0029980_784_1416 | 202 |
| 62 | 3300046462 | Ga0495651_0002375 | Ga0495651_0002375_13694_14326 | 202 |
| 63 | 3300046463 | Ga0495653_0116712 | Ga0495653_0116712_1090_1722 | 202 |
| 64 | 3300046476 | Ga0495662_0021221 | Ga0495662_0021221_624_1256 | 202 |
| 65 | 3300046477 | Ga0495664_0016526 | Ga0495664_0016526_2900_3532 | 202 |
| 66 | 3300046511 | Ga0495608_0002101 | Ga0495608_0002101_7463_8095 | 202 |
| 67 | 3300046514 | Ga0495618_0284620 | Ga0495618_0284620_195_827 | 202 |
| 68 | 3300046516 | Ga0495628_0119849 | Ga0495628_0119849_288_920 | 202 |
| 69 | 3300046517 | Ga0495630_0153897 | Ga0495630_0153897_237_869 | 202 |
| 70 | 3300046529 | Ga0495652_0002923 | Ga0495652_0002923_3768_4400 | 202 |
| 71 | 3300046531 | Ga0495665_0238181 | Ga0495665_0238181_49_681 | 202 |
| 72 | 3300046536 | Ga0495587_0044468 | Ga0495587_0044468_732_1364 | 202 |
| 73 | 3300046543 | Ga0495645_0023765 | Ga0495645_0023765_2030_2662 | 202 |
| 74 | 3300046559 | Ga0495667_0009464 | Ga0495667_0009464_687_1319 | 202 |
| 75 | 3300046642 | Ga0495634_0028467 | Ga0495634_0028467_1332_1964 | 202 |
| 76 | 3300046663 | Ga0495635_0032643 | Ga0495635_0032643_2775_3407 | 202 |
| 77 | 3300046675 | Ga0495657_0031002 | Ga0495657_0031002_950_1582 | 202 |
| 78 | 3300046678 | Ga0495599_0022609 | Ga0495599_0022609_252_884 | 202 |
| 79 | 3300046679 | Ga0495623_0003190 | Ga0495623_0003190_9981_10613 | 202 |
| 80 | 3300046680 | Ga0495646_0113321 | Ga0495646_0113321_870_1502 | 202 |
| 81 | 3300047317 | Ga0495604_0004930 | Ga0495604_0004930_8868_9500 | 202 |
| 82 | 3300047319 | Ga0495674_0014359 | Ga0495674_0014359_216_848 | 202 |
| 83 | 3300047321 | Ga0495676_0229096 | Ga0495676_0229096_272_904 | 202 |
| 84 | 3300047322 | Ga0495680_0049963 | Ga0495680_0049963_1708_2340 | 202 |
| 85 | 3300047444 | Ga0495675_0011418 | Ga0495675_0011418_4790_5422 | 202 |
| 86 | 3300047471 | Ga0495684_0004293 | Ga0495684_0004293_10439_11071 | 202 |
| 87 | 3300048088 | Ga0495602_0006759 | Ga0495602_0006759_1256_1888 | 202 |
| 88 | 3300048907 | Ga0496104_0000955 | Ga0496104_0000955_15938_16570 | 202 |
| 89 | 3300048908 | Ga0496105_0001292 | Ga0496105_0001292_8194_8826 | 202 |
| 90 | 3300048918 | Ga0496115_0103121 | Ga0496115_0103121_1614_2246 | 202 |
| 91 | 3300053077 | Ga0495601_0019342 | Ga0495601_0019342_741_1373 | 202 |
| 92 | 3300053078 | Ga0495612_0002989 | Ga0495612_0002989_3697_4329 | 202 |
| 93 | 3300053084 | Ga0495595_0000287 | Ga0495595_0000287_13351_13983 | 202 |
| 94 | 3300053085 | Ga0495619_0007250 | Ga0495619_0007250_4813_5445 | 202 |
| 95 | 3300053139 | Ga0500568_0109584 | Ga0500568_0109584_308_997 | 202 |
| 96 | 3300006178 | Ga0075367_10106405 | Ga0075367_101064053 | 203 |
| 97 | 3300006195 | Ga0075366_10015036 | Ga0075366_100150366 | 203 |
| 98 | 3300006353 | Ga0075370_10048120 | Ga0075370_100481204 | 203 |
| 99 | 3300050493 | nmdc:mga0k408_153462_c1 | nmdc:mga0k408_153462_c1_345_1034 | 203 |
| 100 | 3300050496 | nmdc:mga07m45_10104_c1 | nmdc:mga07m45_10104_c1_470_1159 | 203 |
| 101 | 3300005937 | Ga0081455_10161739 | Ga0081455_101617392 | 204 |
| 102 | 3300036401 | Ga0373937_0046721 | Ga0373937_0046721_93_731 | 204 |
| 103 | 3300006038 | Ga0075365_10347543 | Ga0075365_103475431 | 205 |
| 104 | 3300037068 | Ga0373925_0819720 | Ga0373925_0819720_22_663 | 205 |
| 105 | 3300048917 | Ga0496114_0294606 | Ga0496114_0294606_131_811 | 205 |
| 106 | 3300050492 | nmdc:mga0yw44_36490_c1 | nmdc:mga0yw44_36490_c1_784_1452 | 205 |
| 107 | 3300013296 | Ga0157374_10330293 | Ga0157374_103302932 | 206 |
| 108 | 3300030760 | Ga0265762_1032748 | Ga0265762_10327481 | 206 |
| 109 | 3300005339 | Ga0070660_100127779 | Ga0070660_1001277791 | 207 |
| 110 | 3300005355 | Ga0070671_100052240 | Ga0070671_1000522402 | 207 |
| 111 | 3300005434 | Ga0070709_10344284 | Ga0070709_103442841 | 207 |
| 112 | 3300005455 | Ga0070663_100062660 | Ga0070663_1000626603 | 207 |
| 113 | 3300005564 | Ga0070664_100084762 | Ga0070664_1000847625 | 207 |
| 114 | 3300005618 | Ga0068864_100085339 | Ga0068864_1000853394 | 207 |
| 115 | 3300005842 | Ga0068858_100160790 | Ga0068858_1001607902 | 207 |
| 116 | 3300005843 | Ga0068860_100276532 | Ga0068860_1002765322 | 207 |
| 117 | 3300006042 | Ga0075368_10136844 | Ga0075368_101368442 | 207 |
| 118 | 3300006048 | Ga0075363_100049026 | Ga0075363_1000490261 | 207 |
| 119 | 3300009101 | Ga0105247_10006181 | Ga0105247_100061812 | 207 |
| 120 | 3300011119 | Ga0105246_10040222 | Ga0105246_100402222 | 207 |
| 121 | 3300013306 | Ga0163162_10114190 | Ga0163162_101141904 | 207 |
| 122 | 3300014325 | Ga0163163_10021399 | Ga0163163_100213995 | 207 |
| 123 | 3300014968 | Ga0157379_10060926 | Ga0157379_100609264 | 207 |
| 124 | 3300025299 | Ga0209256_1022068 | Ga0209256_10220682 | 207 |
| 125 | 3300025933 | Ga0207706_10070104 | Ga0207706_100701045 | 207 |
| 126 | 3300025945 | Ga0207679_10092090 | Ga0207679_100920903 | 207 |
| 127 | 3300026035 | Ga0207703_10056119 | Ga0207703_100561194 | 207 |
| 128 | 3300026067 | Ga0207678_10030703 | Ga0207678_100307034 | 207 |
| 129 | 3300026088 | Ga0207641_10017320 | Ga0207641_100173206 | 207 |
| 130 | 3300026095 | Ga0207676_10633304 | Ga0207676_106333042 | 207 |
| 131 | 3300027866 | Ga0209813_10022792 | Ga0209813_100227922 | 207 |
| 132 | 3300028379 | Ga0268266_10195487 | Ga0268266_101954873 | 207 |
| 133 | 3300028380 | Ga0268265_10323540 | Ga0268265_103235401 | 207 |
| 134 | 3300028381 | Ga0268264_10236427 | Ga0268264_102364272 | 207 |
| 135 | 3300046616 | Ga0495668_0046435 | Ga0495668_0046435_974_1666 | 207 |
| 136 | 3300046694 | Ga0495649_0265546 | Ga0495649_0265546_175_867 | 207 |
| 137 | 3300047443 | Ga0495687_011883 | Ga0495687_011883_2787_3479 | 207 |
| 138 | 3300048904 | Ga0496101_0132478 | Ga0496101_0132478_21_713 | 207 |
| 139 | 3300048905 | Ga0496102_0234387 | Ga0496102_0234387_42_734 | 207 |
| 140 | 3300048905 | Ga0496102_0564762 | Ga0496102_0564762_117_791 | 207 |
| 141 | 3300048907 | Ga0496104_0084728 | Ga0496104_0084728_154_828 | 207 |
| 142 | 3300048908 | Ga0496105_0115424 | Ga0496105_0115424_1145_1837 | 207 |
| 143 | 3300048908 | Ga0496105_0378655 | Ga0496105_0378655_349_1023 | 207 |
| 144 | 3300048909 | Ga0496106_0047405 | Ga0496106_0047405_83_757 | 207 |
| 145 | 3300048911 | Ga0496108_0749010 | Ga0496108_0749010_140_814 | 207 |
| 146 | 3300048912 | Ga0496109_0042210 | Ga0496109_0042210_1489_2181 | 207 |
| 147 | 3300048912 | Ga0496109_0082129 | Ga0496109_0082129_1669_2343 | 207 |
| 148 | 3300048914 | Ga0496111_0032257 | Ga0496111_0032257_226_900 | 207 |
| 149 | 3300048915 | Ga0496112_0212933 | Ga0496112_0212933_933_1607 | 207 |
| 150 | 3300048917 | Ga0496114_0414327 | Ga0496114_0414327_202_876 | 207 |
| 151 | 3300048924 | Ga0496121_0370478 | Ga0496121_0370478_39_731 | 207 |
| 152 | 3300053083 | Ga0495655_0017966 | Ga0495655_0017966_66_758 | 207 |
| 153 | 3300053086 | Ga0500578_0209750 | Ga0500578_0209750_275_967 | 207 |
| 154 | 3300005530 | Ga0070679_100190615 | Ga0070679_1001906153 | 208 |
| 155 | 3300005539 | Ga0068853_100217202 | Ga0068853_1002172022 | 208 |
| 156 | 3300005563 | Ga0068855_100073747 | Ga0068855_1000737472 | 208 |
| 157 | 3300005577 | Ga0068857_100189935 | Ga0068857_1001899352 | 208 |
| 158 | 3300005616 | Ga0068852_100173372 | Ga0068852_1001733723 | 208 |
| 159 | 3300025949 | Ga0207667_10024554 | Ga0207667_100245543 | 208 |
| 160 | 3300026041 | Ga0207639_10262038 | Ga0207639_102620382 | 208 |
| 161 | 3300026116 | Ga0207674_10107865 | Ga0207674_101078653 | 208 |
| 162 | 3300003761 | Ga0055535_1000632 | Ga0055535_10006327 | 209 |
| 163 | 3300003763 | Ga0055529_1001056 | Ga0055529_100105611 | 209 |
| 164 | 3300006944 | Ga0099823_1009325 | Ga0099823_10093253 | 209 |
| 165 | 3300013306 | Ga0163162_10611474 | Ga0163162_106114742 | 209 |
| 166 | 3300025242 | Ga0209258_100453 | Ga0209258_10045314 | 209 |
| 167 | 3300025256 | Ga0209759_1001564 | Ga0209759_10015647 | 209 |
| 168 | 3300025272 | Ga0209455_1000157 | Ga0209455_100015727 | 209 |
| 169 | 3300027296 | Ga0209389_1004554 | Ga0209389_10045549 | 209 |
| 170 | 3300046539 | Ga0495621_0001598 | Ga0495621_0001598_1670_2329 | 209 |
| 171 | 3300005436 | Ga0070713_100240020 | Ga0070713_1002400201 | 210 |
| 172 | 3300006175 | Ga0070712_100331071 | Ga0070712_1003310712 | 210 |
| 173 | 3300025928 | Ga0207700_10143848 | Ga0207700_101438482 | 210 |
| 174 | 3300025928 | Ga0207700_10223431 | Ga0207700_102234311 | 210 |
| 175 | 3300035116 | Ga0373945_0012431 | Ga0373945_0012431_1838_2497 | 210 |
| 176 | 3300035410 | Ga0373924_0138213 | Ga0373924_0138213_301_960 | 210 |
| 177 | 3300035692 | Ga0373935_0089226 | Ga0373935_0089226_122_778 | 210 |
| 178 | 3300037068 | Ga0373925_0078607 | Ga0373925_0078607_782_1438 | 210 |
| 179 | 3300037068 | Ga0373925_0340550 | Ga0373925_0340550_158_817 | 210 |
| 180 | 3300037853 | Ga0436364_1556608 | Ga0436364_1556608_136_804 | 210 |
| 181 | 3300046454 | Ga0495592_0080596 | Ga0495592_0080596_322_981 | 210 |
| 182 | 3300046459 | Ga0495629_0028439 | Ga0495629_0028439_2248_2907 | 210 |
| 183 | 3300046463 | Ga0495653_0135065 | Ga0495653_0135065_10_669 | 210 |
| 184 | 3300046476 | Ga0495662_0007134 | Ga0495662_0007134_3428_4087 | 210 |
| 185 | 3300046477 | Ga0495664_0002872 | Ga0495664_0002872_1385_2044 | 210 |
| 186 | 3300046514 | Ga0495618_0005719 | Ga0495618_0005719_1176_1835 | 210 |
| 187 | 3300046516 | Ga0495628_0147976 | Ga0495628_0147976_549_1205 | 210 |
| 188 | 3300046529 | Ga0495652_0224146 | Ga0495652_0224146_251_907 | 210 |
| 189 | 3300046642 | Ga0495634_0027528 | Ga0495634_0027528_353_1012 | 210 |
| 190 | 3300046663 | Ga0495635_0004596 | Ga0495635_0004596_1229_1888 | 210 |
| 191 | 3300047319 | Ga0495674_0012602 | Ga0495674_0012602_6050_6709 | 210 |
| 192 | 3300047471 | Ga0495684_0036691 | Ga0495684_0036691_1935_2594 | 210 |
| 193 | 3300053084 | Ga0495595_0030593 | Ga0495595_0030593_900_1556 | 210 |
| 194 | 3300053085 | Ga0495619_0005220 | Ga0495619_0005220_2793_3452 | 210 |
| 195 | iso_pu_bacteria | 2524023205 | 2524438286 | 210 |
| 196 | 3300047320 | Ga0495672_0199708 | Ga0495672_0199708_74_757 | 211 |
| 197 | 3300001990 | JGI24737J22298_10077600 | JGI24737J22298_100776001 | 212 |
| 198 | 3300005329 | Ga0070683_100022631 | Ga0070683_1000226316 | 212 |
| 199 | 3300005329 | Ga0070683_101000072 | Ga0070683_1010000721 | 212 |
| 200 | 3300005353 | Ga0070669_100841028 | Ga0070669_1008410281 | 212 |
| 201 | 3300005438 | Ga0070701_10189070 | Ga0070701_101890701 | 212 |
| 202 | 3300005439 | Ga0070711_100157532 | Ga0070711_1001575322 | 212 |
| 203 | 3300005441 | Ga0070700_100037901 | Ga0070700_1000379011 | 212 |
| 204 | 3300005444 | Ga0070694_100144058 | Ga0070694_1001440583 | 212 |
| 205 | 3300005457 | Ga0070662_100019254 | Ga0070662_1000192546 | 212 |
| 206 | 3300005459 | Ga0068867_100167659 | Ga0068867_1001676591 | 212 |
| 207 | 3300005466 | Ga0070685_10016136 | Ga0070685_100161364 | 212 |
| 208 | 3300005535 | Ga0070684_100197377 | Ga0070684_1001973772 | 212 |
| 209 | 3300005535 | Ga0070684_100266843 | Ga0070684_1002668432 | 212 |
| 210 | 3300005539 | Ga0068853_100074542 | Ga0068853_1000745422 | 212 |
| 211 | 3300005544 | Ga0070686_100013967 | Ga0070686_1000139677 | 212 |
| 212 | 3300005548 | Ga0070665_100353289 | Ga0070665_1003532892 | 212 |
| 213 | 3300005563 | Ga0068855_101175326 | Ga0068855_1011753261 | 212 |
| 214 | 3300005564 | Ga0070664_100073397 | Ga0070664_1000733975 | 212 |
| 215 | 3300005578 | Ga0068854_100206404 | Ga0068854_1002064042 | 212 |
| 216 | 3300005615 | Ga0070702_100022253 | Ga0070702_1000222535 | 212 |
| 217 | 3300005719 | Ga0068861_100584760 | Ga0068861_1005847602 | 212 |
| 218 | 3300005840 | Ga0068870_10006351 | Ga0068870_100063512 | 212 |
| 219 | 3300005843 | Ga0068860_100711379 | Ga0068860_1007113792 | 212 |
| 220 | 3300009101 | Ga0105247_10015382 | Ga0105247_100153821 | 212 |
| 221 | 3300009545 | Ga0105237_10034852 | Ga0105237_100348522 | 212 |
| 222 | 3300013306 | Ga0163162_10294669 | Ga0163162_102946691 | 212 |
| 223 | 3300014325 | Ga0163163_10214256 | Ga0163163_102142561 | 212 |
| 224 | 3300014745 | Ga0157377_10304541 | Ga0157377_103045411 | 212 |
| 225 | 3300014969 | Ga0157376_10058961 | Ga0157376_100589613 | 212 |
| 226 | 3300021361 | Ga0213872_10023492 | Ga0213872_100234921 | 212 |
| 227 | 3300025901 | Ga0207688_10022635 | Ga0207688_100226356 | 212 |
| 228 | 3300025904 | Ga0207647_10209839 | Ga0207647_102098391 | 212 |
| 229 | 3300025908 | Ga0207643_10008573 | Ga0207643_100085736 | 212 |
| 230 | 3300025932 | Ga0207690_10173942 | Ga0207690_101739421 | 212 |
| 231 | 3300025933 | Ga0207706_10063556 | Ga0207706_100635561 | 212 |
| 232 | 3300025937 | Ga0207669_10141123 | Ga0207669_101411231 | 212 |
| 233 | 3300025940 | Ga0207691_10041676 | Ga0207691_100416761 | 212 |
| 234 | 3300025941 | Ga0207711_10157710 | Ga0207711_101577101 | 212 |
| 235 | 3300025942 | Ga0207689_10019815 | Ga0207689_100198151 | 212 |
| 236 | 3300025944 | Ga0207661_10002357 | Ga0207661_100023578 | 212 |
| 237 | 3300025981 | Ga0207640_10502993 | Ga0207640_105029931 | 212 |
| 238 | 3300025986 | Ga0207658_10369189 | Ga0207658_103691891 | 212 |
| 239 | 3300026035 | Ga0207703_10116701 | Ga0207703_101167011 | 212 |
| 240 | 3300026078 | Ga0207702_10066021 | Ga0207702_100660216 | 212 |
| 241 | 3300026089 | Ga0207648_10050996 | Ga0207648_100509961 | 212 |
| 242 | 3300026118 | Ga0207675_100012644 | Ga0207675_1000126441 | 212 |
| 243 | 3300028379 | Ga0268266_10369185 | Ga0268266_103691852 | 212 |
| 244 | 3300028381 | Ga0268264_10264664 | Ga0268264_102646641 | 212 |
| 245 | 3300035089 | Ga0373944_0000948 | Ga0373944_0000948_6367_7032 | 212 |
| 246 | 3300035111 | Ga0373923_0019383 | Ga0373923_0019383_1440_2105 | 212 |
| 247 | 3300035113 | Ga0373936_0034409 | Ga0373936_0034409_401_1066 | 212 |
| 248 | 3300035170 | Ga0373943_0000022 | Ga0373943_0000022_7055_7720 | 212 |
| 249 | 3300035171 | Ga0373946_0005813 | Ga0373946_0005813_3059_3724 | 212 |
| 250 | 3300035692 | Ga0373935_0004500 | Ga0373935_0004500_528_1193 | 212 |
| 251 | 3300035695 | Ga0373927_0000113 | Ga0373927_0000113_11054_11719 | 212 |
| 252 | 3300035725 | Ga0373947_0001403 | Ga0373947_0001403_2794_3459 | 212 |
| 253 | 3300037068 | Ga0373925_0001554 | Ga0373925_0001554_9052_9717 | 212 |
| 254 | 3300039447 | Ga0436361_0956991 | Ga0436361_0956991_1371_2033 | 212 |
| 255 | 3300046459 | Ga0495629_0030274 | Ga0495629_0030274_2125_2790 | 212 |
| 256 | 3300046463 | Ga0495653_0443910 | Ga0495653_0443910_114_779 | 212 |
| 257 | 3300046472 | Ga0495580_0206597 | Ga0495580_0206597_440_1105 | 212 |
| 258 | 3300046475 | Ga0495639_0036452 | Ga0495639_0036452_136_801 | 212 |
| 259 | 3300046476 | Ga0495662_0126348 | Ga0495662_0126348_518_1183 | 212 |
| 260 | 3300046492 | Ga0495585_0179113 | Ga0495585_0179113_227_898 | 212 |
| 261 | 3300046514 | Ga0495618_0173426 | Ga0495618_0173426_346_1011 | 212 |
| 262 | 3300046517 | Ga0495630_0002011 | Ga0495630_0002011_6633_7298 | 212 |
| 263 | 3300046523 | Ga0495644_0107231 | Ga0495644_0107231_253_921 | 212 |
| 264 | 3300046525 | Ga0495663_0070975 | Ga0495663_0070975_225_893 | 212 |
| 265 | 3300046526 | Ga0495666_0008360 | Ga0495666_0008360_689_1354 | 212 |
| 266 | 3300046529 | Ga0495652_0012755 | Ga0495652_0012755_6821_7486 | 212 |
| 267 | 3300046616 | Ga0495668_0292311 | Ga0495668_0292311_115_783 | 212 |
| 268 | 3300046642 | Ga0495634_0005170 | Ga0495634_0005170_8863_9528 | 212 |
| 269 | 3300046642 | Ga0495634_0054475 | Ga0495634_0054475_1069_1734 | 212 |
| 270 | 3300046663 | Ga0495635_0025067 | Ga0495635_0025067_1155_1820 | 212 |
| 271 | 3300046684 | Ga0495669_0199226 | Ga0495669_0199226_147_815 | 212 |
| 272 | 3300046689 | Ga0495613_0006467 | Ga0495613_0006467_3618_4283 | 212 |
| 273 | 3300046690 | Ga0495624_0004319 | Ga0495624_0004319_2921_3586 | 212 |
| 274 | 3300047315 | Ga0495581_0005578 | Ga0495581_0005578_1998_2663 | 212 |
| 275 | 3300047471 | Ga0495684_0000845 | Ga0495684_0000845_14513_15178 | 212 |
| 276 | 3300047471 | Ga0495684_0019817 | Ga0495684_0019817_112_777 | 212 |
| 277 | 3300047673 | Ga0495593_0013117 | Ga0495593_0013117_2477_3142 | 212 |
| 278 | 3300048089 | Ga0495614_0097718 | Ga0495614_0097718_584_1249 | 212 |
| 279 | 3300048903 | Ga0496100_0036651 | Ga0496100_0036651_628_1296 | 212 |
| 280 | 3300048903 | Ga0496100_0083141 | Ga0496100_0083141_69_737 | 212 |
| 281 | 3300048904 | Ga0496101_0371121 | Ga0496101_0371121_19_687 | 212 |
| 282 | 3300048906 | Ga0496103_0018740 | Ga0496103_0018740_2045_2713 | 212 |
| 283 | 3300048907 | Ga0496104_0000306 | Ga0496104_0000306_1360_2028 | 212 |
| 284 | 3300048907 | Ga0496104_0001512 | Ga0496104_0001512_5471_6139 | 212 |
| 285 | 3300048907 | Ga0496104_0157341 | Ga0496104_0157341_121_789 | 212 |
| 286 | 3300048907 | Ga0496104_0208069 | Ga0496104_0208069_648_1316 | 212 |
| 287 | 3300048908 | Ga0496105_0018693 | Ga0496105_0018693_540_1208 | 212 |
| 288 | 3300048908 | Ga0496105_0025818 | Ga0496105_0025818_988_1656 | 212 |
| 289 | 3300048908 | Ga0496105_0209217 | Ga0496105_0209217_385_1053 | 212 |
| 290 | 3300048909 | Ga0496106_0024820 | Ga0496106_0024820_2443_3111 | 212 |
| 291 | 3300048909 | Ga0496106_0086101 | Ga0496106_0086101_1303_1971 | 212 |
| 292 | 3300048910 | Ga0496107_0048889 | Ga0496107_0048889_415_1083 | 212 |
| 293 | 3300048910 | Ga0496107_0109391 | Ga0496107_0109391_1254_1922 | 212 |
| 294 | 3300048911 | Ga0496108_0122288 | Ga0496108_0122288_672_1340 | 212 |
| 295 | 3300048913 | Ga0496110_0298202 | Ga0496110_0298202_181_849 | 212 |
| 296 | 3300048915 | Ga0496112_0012515 | Ga0496112_0012515_2172_2840 | 212 |
| 297 | 3300048915 | Ga0496112_0262159 | Ga0496112_0262159_737_1405 | 212 |
| 298 | 3300048916 | Ga0496113_0412638 | Ga0496113_0412638_170_838 | 212 |
| 299 | 3300048918 | Ga0496115_0008348 | Ga0496115_0008348_3658_4326 | 212 |
| 300 | 3300048918 | Ga0496115_0052137 | Ga0496115_0052137_642_1310 | 212 |
| 301 | 3300048918 | Ga0496115_0118221 | Ga0496115_0118221_1079_1747 | 212 |
| 302 | 3300053077 | Ga0495601_0044713 | Ga0495601_0044713_1793_2461 | 212 |
| 303 | iso_pu_bacteria | 2508501128 | 2509151853 | 212 |
| 304 | 3300024227 | Ga0228598_1002348 | Ga0228598_10023484 | 213 |
| 305 | 3300035117 | Ga0373953_0014809 | Ga0373953_0014809_619_1293 | 213 |
| 306 | 3300046454 | Ga0495592_0083439 | Ga0495592_0083439_786_1460 | 213 |
| 307 | 3300046463 | Ga0495653_0164222 | Ga0495653_0164222_389_1063 | 213 |
| 308 | 3300046477 | Ga0495664_0353333 | Ga0495664_0353333_17_691 | 213 |
| 309 | 3300046511 | Ga0495608_0300899 | Ga0495608_0300899_205_879 | 213 |
| 310 | 3300046514 | Ga0495618_0182163 | Ga0495618_0182163_78_752 | 213 |
| 311 | 3300046533 | Ga0495640_0292782 | Ga0495640_0292782_14_688 | 213 |
| 312 | 3300046559 | Ga0495667_0017883 | Ga0495667_0017883_2716_3390 | 213 |
| 313 | 3300046679 | Ga0495623_0051910 | Ga0495623_0051910_289_963 | 213 |
| 314 | 3300047318 | Ga0495636_0005689 | Ga0495636_0005689_3250_3915 | 213 |
| 315 | 3300047319 | Ga0495674_0130122 | Ga0495674_0130122_795_1469 | 213 |
| 316 | 3300047444 | Ga0495675_0056881 | Ga0495675_0056881_1419_2093 | 213 |
| 317 | 3300047471 | Ga0495684_0133514 | Ga0495684_0133514_607_1281 | 213 |
| 318 | 3300048088 | Ga0495602_0159292 | Ga0495602_0159292_205_879 | 213 |
| 319 | 3300053077 | Ga0495601_0041050 | Ga0495601_0041050_1143_1817 | 213 |
| 320 | 3300053084 | Ga0495595_0294005 | Ga0495595_0294005_126_800 | 213 |
| 321 | 3300053085 | Ga0495619_0587309 | Ga0495619_0587309_73_747 | 213 |
| 322 | iso_pu_bacteria | 2885409591 | 2885414173 | 213 |
| 323 | 3300005548 | Ga0070665_100297729 | Ga0070665_1002977291 | 214 |
| 324 | 3300005563 | Ga0068855_100297368 | Ga0068855_1002973683 | 214 |
| 325 | 3300009545 | Ga0105237_10199931 | Ga0105237_101999313 | 214 |
| 326 | 3300009551 | Ga0105238_10080478 | Ga0105238_100804785 | 214 |
| 327 | 3300010375 | Ga0105239_10050077 | Ga0105239_100500772 | 214 |
| 328 | 3300013105 | Ga0157369_11053253 | Ga0157369_110532532 | 214 |
| 329 | 3300013306 | Ga0163162_10292964 | Ga0163162_102929643 | 214 |
| 330 | 3300025924 | Ga0207694_10150395 | Ga0207694_101503953 | 214 |
| 331 | 3300025949 | Ga0207667_10142328 | Ga0207667_101423282 | 214 |
| 332 | 3300028379 | Ga0268266_10121072 | Ga0268266_101210724 | 214 |
| 333 | 3300035117 | Ga0373953_0006693 | Ga0373953_0006693_2104_2772 | 214 |
| 334 | 3300035119 | Ga0373956_0017451 | Ga0373956_0017451_1387_2055 | 214 |
| 335 | 3300035172 | Ga0373955_0165501 | Ga0373955_0165501_127_795 | 214 |
| 336 | 3300035724 | Ga0373933_0044251 | Ga0373933_0044251_807_1475 | 214 |
| 337 | 3300036401 | Ga0373937_0046591 | Ga0373937_0046591_3076_3744 | 214 |
| 338 | 3300048929 | Ga0496126_0027851 | Ga0496126_0027851_1231_1899 | 214 |
| 339 | 3300053080 | Ga0500635_0023486 | Ga0500635_0023486_158_832 | 214 |
| 340 | 3300053178 | Ga0500637_0010767 | Ga0500637_0010767_969_1643 | 214 |
| 341 | 3300005336 | Ga0070680_100035397 | Ga0070680_1000353974 | 215 |
| 342 | 3300005336 | Ga0070680_100052054 | Ga0070680_1000520542 | 215 |
| 343 | 3300005436 | Ga0070713_100480628 | Ga0070713_1004806282 | 215 |
| 344 | 3300005458 | Ga0070681_10033224 | Ga0070681_100332247 | 215 |
| 345 | 3300005539 | Ga0068853_100380947 | Ga0068853_1003809472 | 215 |
| 346 | 3300006048 | Ga0075363_100141160 | Ga0075363_1001411602 | 215 |
| 347 | 3300006173 | Ga0070716_100327851 | Ga0070716_1003278511 | 215 |
| 348 | 3300006177 | Ga0075362_10080107 | Ga0075362_100801073 | 215 |
| 349 | 3300006358 | Ga0068871_100087758 | Ga0068871_1000877582 | 215 |
| 350 | 3300009093 | Ga0105240_10121453 | Ga0105240_101214532 | 215 |
| 351 | 3300009174 | Ga0105241_10358864 | Ga0105241_103588641 | 215 |
| 352 | 3300009551 | Ga0105238_10689923 | Ga0105238_106899231 | 215 |
| 353 | 3300013105 | Ga0157369_10003682 | Ga0157369_100036825 | 215 |
| 354 | 3300021384 | Ga0213876_10097017 | Ga0213876_100970172 | 215 |
| 355 | 3300025906 | Ga0207699_10006782 | Ga0207699_100067824 | 215 |
| 356 | 3300025912 | Ga0207707_10001362 | Ga0207707_1000136220 | 215 |
| 357 | 3300025913 | Ga0207695_10662784 | Ga0207695_106627841 | 215 |
| 358 | 3300025917 | Ga0207660_10021958 | Ga0207660_100219584 | 215 |
| 359 | 3300025917 | Ga0207660_10092594 | Ga0207660_100925941 | 215 |
| 360 | 3300025921 | Ga0207652_10157299 | Ga0207652_101572994 | 215 |
| 361 | 3300025924 | Ga0207694_10515340 | Ga0207694_105153402 | 215 |
| 362 | 3300025939 | Ga0207665_10472924 | Ga0207665_104729242 | 215 |
| 363 | 3300025944 | Ga0207661_10179682 | Ga0207661_101796823 | 215 |
| 364 | 3300025949 | Ga0207667_10719093 | Ga0207667_107190931 | 215 |
| 365 | 3300026041 | Ga0207639_10053071 | Ga0207639_100530715 | 215 |
| 366 | 3300035083 | Ga0373926_0024367 | Ga0373926_0024367_257_928 | 215 |
| 367 | 3300035111 | Ga0373923_0098524 | Ga0373923_0098524_428_1099 | 215 |
| 368 | 3300035113 | Ga0373936_0016160 | Ga0373936_0016160_1558_2229 | 215 |
| 369 | 3300035116 | Ga0373945_0094072 | Ga0373945_0094072_233_904 | 215 |
| 370 | 3300035118 | Ga0373954_0006983 | Ga0373954_0006983_272_943 | 215 |
| 371 | 3300035120 | Ga0373957_0097152 | Ga0373957_0097152_366_1037 | 215 |
| 372 | 3300035171 | Ga0373946_0005588 | Ga0373946_0005588_2047_2718 | 215 |
| 373 | 3300035172 | Ga0373955_0090574 | Ga0373955_0090574_955_1626 | 215 |
| 374 | 3300035725 | Ga0373947_0025025 | Ga0373947_0025025_133_804 | 215 |
| 375 | 3300036401 | Ga0373937_0143963 | Ga0373937_0143963_265_936 | 215 |
| 376 | 3300037068 | Ga0373925_0178283 | Ga0373925_0178283_70_741 | 215 |
| 377 | 3300037068 | Ga0373925_0460797 | Ga0373925_0460797_143_814 | 215 |
| 378 | 3300039437 | Ga0436365_1498030 | Ga0436365_1498030_572_1258 | 215 |
| 379 | 3300046454 | Ga0495592_0047069 | Ga0495592_0047069_658_1329 | 215 |
| 380 | 3300046459 | Ga0495629_0090673 | Ga0495629_0090673_995_1666 | 215 |
| 381 | 3300046472 | Ga0495580_0021704 | Ga0495580_0021704_70_741 | 215 |
| 382 | 3300046475 | Ga0495639_0007988 | Ga0495639_0007988_3049_3720 | 215 |
| 383 | 3300046476 | Ga0495662_0056954 | Ga0495662_0056954_248_919 | 215 |
| 384 | 3300046477 | Ga0495664_0044439 | Ga0495664_0044439_831_1502 | 215 |
| 385 | 3300046499 | Ga0495594_0262791 | Ga0495594_0262791_56_727 | 215 |
| 386 | 3300046517 | Ga0495630_0015505 | Ga0495630_0015505_70_741 | 215 |
| 387 | 3300046529 | Ga0495652_0319909 | Ga0495652_0319909_299_970 | 215 |
| 388 | 3300046531 | Ga0495665_0051806 | Ga0495665_0051806_1233_1904 | 215 |
| 389 | 3300046533 | Ga0495640_0006879 | Ga0495640_0006879_3917_4588 | 215 |
| 390 | 3300046536 | Ga0495587_0356734 | Ga0495587_0356734_62_733 | 215 |
| 391 | 3300046559 | Ga0495667_0268325 | Ga0495667_0268325_373_1044 | 215 |
| 392 | 3300046642 | Ga0495634_0054733 | Ga0495634_0054733_257_928 | 215 |
| 393 | 3300046663 | Ga0495635_0388286 | Ga0495635_0388286_223_894 | 215 |
| 394 | 3300046680 | Ga0495646_0029662 | Ga0495646_0029662_2601_3272 | 215 |
| 395 | 3300046681 | Ga0495647_0199036 | Ga0495647_0199036_18_689 | 215 |
| 396 | 3300046683 | Ga0495658_0021427 | Ga0495658_0021427_1612_2283 | 215 |
| 397 | 3300047315 | Ga0495581_0021230 | Ga0495581_0021230_1869_2540 | 215 |
| 398 | 3300047321 | Ga0495676_0143597 | Ga0495676_0143597_40_711 | 215 |
| 399 | 3300047471 | Ga0495684_0009757 | Ga0495684_0009757_3948_4619 | 215 |
| 400 | 3300048905 | Ga0496102_0171047 | Ga0496102_0171047_638_1318 | 215 |
| 401 | 3300048912 | Ga0496109_0134540 | Ga0496109_0134540_957_1637 | 215 |
| 402 | 3300048918 | Ga0496115_0506001 | Ga0496115_0506001_233_913 | 215 |
| 403 | 3300050494 | nmdc:mga06z11_170107_c1 | nmdc:mga06z11_170107_c1_482_1159 | 215 |
| 404 | 3300050495 | nmdc:mga04h51_93850_c1 | nmdc:mga04h51_93850_c1_156_833 | 215 |
| 405 | 3300053077 | Ga0495601_0054650 | Ga0495601_0054650_371_1042 | 215 |
| 406 | 3300053078 | Ga0495612_0039500 | Ga0495612_0039500_794_1465 | 215 |
| 407 | iso_pu_bacteria | 2585428058 | 2587731777 | 215 |
| 408 | 3300007265 | Ga0099794_10028156 | Ga0099794_100281562 | 216 |
| 409 | 3300007788 | Ga0099795_10005919 | Ga0099795_100059193 | 216 |
| 410 | 3300010159 | Ga0099796_10004310 | Ga0099796_100043105 | 216 |
| 411 | 3300027512 | Ga0209179_1027748 | Ga0209179_10277481 | 216 |
| 412 | 3300002070 | JGI24750J21931_1027100 | JGI24750J21931_10271001 | 217 |
| 413 | 3300005331 | Ga0070670_100088515 | Ga0070670_1000885155 | 217 |
| 414 | 3300005337 | Ga0070682_100366738 | Ga0070682_1003667382 | 217 |
| 415 | 3300005338 | Ga0068868_100009330 | Ga0068868_1000093308 | 217 |
| 416 | 3300005340 | Ga0070689_100017860 | Ga0070689_1000178606 | 217 |
| 417 | 3300005354 | Ga0070675_100032642 | Ga0070675_1000326422 | 217 |
| 418 | 3300005364 | Ga0070673_100548887 | Ga0070673_1005488871 | 217 |
| 419 | 3300005367 | Ga0070667_101013901 | Ga0070667_1010139011 | 217 |
| 420 | 3300005439 | Ga0070711_100310295 | Ga0070711_1003102952 | 217 |
| 421 | 3300005456 | Ga0070678_100441218 | Ga0070678_1004412181 | 217 |
| 422 | 3300005545 | Ga0070695_100540549 | Ga0070695_1005405492 | 217 |
| 423 | 3300005616 | Ga0068852_100355761 | Ga0068852_1003557611 | 217 |
| 424 | 3300005618 | Ga0068864_100017181 | Ga0068864_1000171812 | 217 |
| 425 | 3300005841 | Ga0068863_100286819 | Ga0068863_1002868193 | 217 |
| 426 | 3300005842 | Ga0068858_100078707 | Ga0068858_1000787075 | 217 |
| 427 | 3300005844 | Ga0068862_100122722 | Ga0068862_1001227224 | 217 |
| 428 | 3300006881 | Ga0068865_100035370 | Ga0068865_1000353705 | 217 |
| 429 | 3300009094 | Ga0111539_10170937 | Ga0111539_101709374 | 217 |
| 430 | 3300009174 | Ga0105241_10375668 | Ga0105241_103756682 | 217 |
| 431 | 3300009545 | Ga0105237_10198544 | Ga0105237_101985443 | 217 |
| 432 | 3300013297 | Ga0157378_10208180 | Ga0157378_102081803 | 217 |
| 433 | 3300013308 | Ga0157375_10180032 | Ga0157375_101800323 | 217 |
| 434 | 3300014968 | Ga0157379_10027154 | Ga0157379_100271546 | 217 |
| 435 | 3300021377 | Ga0213874_10003885 | Ga0213874_100038852 | 217 |
| 436 | 3300025916 | Ga0207663_10175817 | Ga0207663_101758173 | 217 |
| 437 | 3300025924 | Ga0207694_10038564 | Ga0207694_100385642 | 217 |
| 438 | 3300025925 | Ga0207650_10583267 | Ga0207650_105832671 | 217 |
| 439 | 3300025926 | Ga0207659_10050758 | Ga0207659_100507582 | 217 |
| 440 | 3300025936 | Ga0207670_10008187 | Ga0207670_100081878 | 217 |
| 441 | 3300025938 | Ga0207704_10192668 | Ga0207704_101926682 | 217 |
| 442 | 3300025960 | Ga0207651_10049604 | Ga0207651_100496045 | 217 |
| 443 | 3300026067 | Ga0207678_10025630 | Ga0207678_100256305 | 217 |
| 444 | 3300026075 | Ga0207708_10011723 | Ga0207708_100117231 | 217 |
| 445 | 3300026088 | Ga0207641_10297567 | Ga0207641_102975671 | 217 |
| 446 | 3300026095 | Ga0207676_10015307 | Ga0207676_100153076 | 217 |
| 447 | 3300026116 | Ga0207674_10057890 | Ga0207674_100578902 | 217 |
| 448 | 3300026121 | Ga0207683_10092022 | Ga0207683_100920225 | 217 |
| 449 | 3300026142 | Ga0207698_10487817 | Ga0207698_104878172 | 217 |
| 450 | 3300031235 | Ga0265330_10095027 | Ga0265330_100950272 | 217 |
| 451 | 3300031241 | Ga0265325_10008767 | Ga0265325_100087676 | 217 |
| 452 | 3300031249 | Ga0265339_10091937 | Ga0265339_100919373 | 217 |
| 453 | 3300031344 | Ga0265316_10236374 | Ga0265316_102363742 | 217 |
| 454 | 3300031712 | Ga0265342_10130218 | Ga0265342_101302182 | 217 |
| 455 | 3300035170 | Ga0373943_0138559 | Ga0373943_0138559_529_1209 | 217 |
| 456 | 3300036401 | Ga0373937_0339816 | Ga0373937_0339816_533_1213 | 217 |
| 457 | 3300039450 | Ga0436363_0098309 | Ga0436363_0098309_8969_9658 | 217 |
| 458 | 3300045976 | Ga0466967_0297512 | Ga0466967_0297512_438_1115 | 217 |
| 459 | 3300046531 | Ga0495665_0192218 | Ga0495665_0192218_274_954 | 217 |
| 460 | 3300047319 | Ga0495674_0372884 | Ga0495674_0372884_296_976 | 217 |
| 461 | 3300047320 | Ga0495672_0157625 | Ga0495672_0157625_188_865 | 217 |
| 462 | 3300048904 | Ga0496101_0024098 | Ga0496101_0024098_1482_2165 | 217 |
| 463 | 3300048905 | Ga0496102_0015623 | Ga0496102_0015623_5337_6020 | 217 |
| 464 | 3300048909 | Ga0496106_0121899 | Ga0496106_0121899_295_978 | 217 |
| 465 | 3300048914 | Ga0496111_0095564 | Ga0496111_0095564_1183_1866 | 217 |
| 466 | 3300048916 | Ga0496113_0012395 | Ga0496113_0012395_2885_3568 | 217 |
| 467 | 3300048918 | Ga0496115_0049563 | Ga0496115_0049563_978_1655 | 217 |
| 468 | 3300048929 | Ga0496126_0266241 | Ga0496126_0266241_190_867 | 217 |
| 469 | 3300053077 | Ga0495601_0279501 | Ga0495601_0279501_86_766 | 217 |
| 470 | 3300006237 | Ga0097621_100102300 | Ga0097621_1001023002 | 218 |
| 471 | 3300006358 | Ga0068871_100065584 | Ga0068871_1000655842 | 218 |
| 472 | 3300009176 | Ga0105242_10233439 | Ga0105242_102334392 | 218 |
| 473 | 3300009177 | Ga0105248_10238787 | Ga0105248_102387874 | 218 |
| 474 | 3300013297 | Ga0157378_10426650 | Ga0157378_104266502 | 218 |
| 475 | 3300013308 | Ga0157375_10703866 | Ga0157375_107038661 | 218 |
| 476 | 3300014969 | Ga0157376_10332288 | Ga0157376_103322882 | 218 |
| 477 | 3300026089 | Ga0207648_10213475 | Ga0207648_102134753 | 218 |
| 478 | 3300028577 | Ga0265318_10007275 | Ga0265318_100072753 | 218 |
| 479 | 3300031240 | Ga0265320_10011536 | Ga0265320_100115365 | 218 |
| 480 | 3300031242 | Ga0265329_10009771 | Ga0265329_100097716 | 218 |
| 481 | 3300031247 | Ga0265340_10002685 | Ga0265340_100026853 | 218 |
| 482 | 3300031250 | Ga0265331_10021931 | Ga0265331_100219313 | 218 |
| 483 | 3300031711 | Ga0265314_10043915 | Ga0265314_100439153 | 218 |
| 484 | 3300031712 | Ga0265342_10016076 | Ga0265342_100160762 | 218 |
| 485 | 3300035241 | Ga0373961_0045791 | Ga0373961_0045791_62_745 | 218 |
| 486 | 3300035691 | Ga0373931_0041070 | Ga0373931_0041070_1208_1891 | 218 |
| 487 | 3300048905 | Ga0496102_0821104 | Ga0496102_0821104_120_803 | 218 |
| 488 | 3300048907 | Ga0496104_0109519 | Ga0496104_0109519_1380_2063 | 218 |
| 489 | 3300048918 | Ga0496115_0411745 | Ga0496115_0411745_64_747 | 218 |
| 490 | 3300025949 | Ga0207667_10048182 | Ga0207667_100481824 | 219 |
| 491 | 3300035086 | Ga0373934_0038077 | Ga0373934_0038077_467_1156 | 219 |
| 492 | 3300035089 | Ga0373944_0185706 | Ga0373944_0185706_46_735 | 219 |
| 493 | 3300035111 | Ga0373923_0000023 | Ga0373923_0000023_20536_21225 | 219 |
| 494 | 3300035113 | Ga0373936_0000171 | Ga0373936_0000171_13709_14398 | 219 |
| 495 | 3300035117 | Ga0373953_0000572 | Ga0373953_0000572_8482_9171 | 219 |
| 496 | 3300035118 | Ga0373954_0002827 | Ga0373954_0002827_3893_4582 | 219 |
| 497 | 3300035119 | Ga0373956_0028006 | Ga0373956_0028006_356_1045 | 219 |
| 498 | 3300035170 | Ga0373943_0003257 | Ga0373943_0003257_5121_5810 | 219 |
| 499 | 3300035171 | Ga0373946_0000384 | Ga0373946_0000384_6056_6745 | 219 |
| 500 | 3300035172 | Ga0373955_0000031 | Ga0373955_0000031_49134_49823 | 219 |
| 501 | 3300035410 | Ga0373924_0003376 | Ga0373924_0003376_3096_3785 | 219 |
| 502 | 3300035692 | Ga0373935_0000461 | Ga0373935_0000461_13642_14331 | 219 |
| 503 | 3300035695 | Ga0373927_0020575 | Ga0373927_0020575_2053_2742 | 219 |
| 504 | 3300035724 | Ga0373933_0000638 | Ga0373933_0000638_14610_15299 | 219 |
| 505 | 3300035725 | Ga0373947_0000244 | Ga0373947_0000244_4190_4879 | 219 |
| 506 | 3300036401 | Ga0373937_0000098 | Ga0373937_0000098_45077_45766 | 219 |
| 507 | 3300037068 | Ga0373925_0000198 | Ga0373925_0000198_49320_50009 | 219 |
| 508 | 3300046454 | Ga0495592_0000119 | Ga0495592_0000119_49317_50006 | 219 |
| 509 | 3300046459 | Ga0495629_0003106 | Ga0495629_0003106_4464_5153 | 219 |
| 510 | 3300046463 | Ga0495653_0000030 | Ga0495653_0000030_122305_122994 | 219 |
| 511 | 3300046476 | Ga0495662_0001102 | Ga0495662_0001102_10459_11148 | 219 |
| 512 | 3300046477 | Ga0495664_0000003 | Ga0495664_0000003_103369_104058 | 219 |
| 513 | 3300046511 | Ga0495608_0000011 | Ga0495608_0000011_49373_50062 | 219 |
| 514 | 3300046514 | Ga0495618_0000025 | Ga0495618_0000025_19675_20364 | 219 |
| 515 | 3300046516 | Ga0495628_0000001 | Ga0495628_0000001_592770_593459 | 219 |
| 516 | 3300046517 | Ga0495630_0000551 | Ga0495630_0000551_22113_22802 | 219 |
| 517 | 3300046529 | Ga0495652_0000002 | Ga0495652_0000002_807304_807993 | 219 |
| 518 | 3300046533 | Ga0495640_0000002 | Ga0495640_0000002_47633_48322 | 219 |
| 519 | 3300046536 | Ga0495587_0000001 | Ga0495587_0000001_120039_120728 | 219 |
| 520 | 3300046543 | Ga0495645_0000002 | Ga0495645_0000002_592783_593472 | 219 |
| 521 | 3300046559 | Ga0495667_0000004 | Ga0495667_0000004_19686_20375 | 219 |
| 522 | 3300046642 | Ga0495634_0000010 | Ga0495634_0000010_49023_49712 | 219 |
| 523 | 3300046663 | Ga0495635_0000001 | Ga0495635_0000001_105863_106552 | 219 |
| 524 | 3300046675 | Ga0495657_0000369 | Ga0495657_0000369_21318_22007 | 219 |
| 525 | 3300046678 | Ga0495599_0000013 | Ga0495599_0000013_58154_58843 | 219 |
| 526 | 3300046679 | Ga0495623_0000024 | Ga0495623_0000024_60912_61601 | 219 |
| 527 | 3300046680 | Ga0495646_0000009 | Ga0495646_0000009_120872_121561 | 219 |
| 528 | 3300046683 | Ga0495658_0073899 | Ga0495658_0073899_135_824 | 219 |
| 529 | 3300046690 | Ga0495624_0011364 | Ga0495624_0011364_1837_2526 | 219 |
| 530 | 3300046809 | Ga0495600_0000071 | Ga0495600_0000071_10160_10849 | 219 |
| 531 | 3300047315 | Ga0495581_0105810 | Ga0495581_0105810_397_1086 | 219 |
| 532 | 3300047317 | Ga0495604_0000129 | Ga0495604_0000129_58134_58823 | 219 |
| 533 | 3300047319 | Ga0495674_0000002 | Ga0495674_0000002_592771_593460 | 219 |
| 534 | 3300047322 | Ga0495680_0000853 | Ga0495680_0000853_15316_16005 | 219 |
| 535 | 3300047444 | Ga0495675_0000274 | Ga0495675_0000274_15783_16472 | 219 |
| 536 | 3300047471 | Ga0495684_0000083 | Ga0495684_0000083_49332_50021 | 219 |
| 537 | 3300047673 | Ga0495593_0005774 | Ga0495593_0005774_3720_4409 | 219 |
| 538 | 3300048088 | Ga0495602_0000024 | Ga0495602_0000024_95787_96476 | 219 |
| 539 | 3300048089 | Ga0495614_0086625 | Ga0495614_0086625_510_1199 | 219 |
| 540 | 3300053077 | Ga0495601_0000001 | Ga0495601_0000001_438867_439556 | 219 |
| 541 | 3300053078 | Ga0495612_0000017 | Ga0495612_0000017_30652_31341 | 219 |
| 542 | 3300053084 | Ga0495595_0000010 | Ga0495595_0000010_58130_58819 | 219 |
| 543 | 3300053085 | Ga0495619_0000004 | Ga0495619_0000004_438904_439593 | 219 |
| 544 | 3300005337 | Ga0070682_100641447 | Ga0070682_1006414471 | 222 |
| 545 | 3300005434 | Ga0070709_10113573 | Ga0070709_101135731 | 223 |
| 546 | 3300005435 | Ga0070714_100061780 | Ga0070714_1000617801 | 223 |
| 547 | 3300005436 | Ga0070713_100020773 | Ga0070713_1000207733 | 223 |
| 548 | 3300005437 | Ga0070710_10166208 | Ga0070710_101662082 | 223 |
| 549 | 3300005439 | Ga0070711_100053755 | Ga0070711_1000537552 | 223 |
| 550 | 3300005457 | Ga0070662_100061679 | Ga0070662_1000616792 | 223 |
| 551 | 3300005549 | Ga0070704_100001307 | Ga0070704_10000130715 | 223 |
| 552 | 3300006175 | Ga0070712_100014863 | Ga0070712_1000148633 | 223 |
| 553 | 3300025906 | Ga0207699_10029671 | Ga0207699_100296712 | 223 |
| 554 | 3300025915 | Ga0207693_10030351 | Ga0207693_100303516 | 223 |
| 555 | 3300048929 | Ga0496126_0308291 | Ga0496126_0308291_429_1127 | 223 |
| 556 | 2209111006 | 2214772973 | 2213792742 | 226 |
| 557 | 3300000041 | ARcpr5oldR_c000172 | ARcpr5oldR_0001727 | 226 |
| 558 | 3300000652 | ARCol0yngRDRAFT_1000173 | ARCol0yngRDRAFT_10001737 | 226 |
| 559 | 3300001990 | JGI24737J22298_10002941 | JGI24737J22298_100029414 | 226 |
| 560 | 3300002076 | JGI24749J21850_1013718 | JGI24749J21850_10137182 | 226 |
| 561 | 3300005290 | Ga0065712_10131527 | Ga0065712_101315272 | 226 |
| 562 | 3300005293 | Ga0065715_10001277 | Ga0065715_100012773 | 226 |
| 563 | 3300005328 | Ga0070676_10139206 | Ga0070676_101392062 | 226 |
| 564 | 3300005330 | Ga0070690_100024004 | Ga0070690_1000240045 | 226 |
| 565 | 3300005336 | Ga0070680_100089806 | Ga0070680_1000898064 | 226 |
| 566 | 3300005339 | Ga0070660_100063259 | Ga0070660_1000632593 | 226 |
| 567 | 3300005340 | Ga0070689_100261158 | Ga0070689_1002611581 | 226 |
| 568 | 3300005341 | Ga0070691_10044288 | Ga0070691_100442884 | 226 |
| 569 | 3300005345 | Ga0070692_10007543 | Ga0070692_100075435 | 226 |
| 570 | 3300005347 | Ga0070668_100057388 | Ga0070668_1000573884 | 226 |
| 571 | 3300005354 | Ga0070675_100074917 | Ga0070675_1000749173 | 226 |
| 572 | 3300005366 | Ga0070659_100147296 | Ga0070659_1001472963 | 226 |
| 573 | 3300005438 | Ga0070701_10024994 | Ga0070701_100249943 | 226 |
| 574 | 3300005444 | Ga0070694_100186477 | Ga0070694_1001864772 | 226 |
| 575 | 3300005445 | Ga0070708_100229454 | Ga0070708_1002294543 | 226 |
| 576 | 3300005455 | Ga0070663_100041474 | Ga0070663_1000414744 | 226 |
| 577 | 3300005457 | Ga0070662_100217336 | Ga0070662_1002173363 | 226 |
| 578 | 3300005458 | Ga0070681_10122765 | Ga0070681_101227653 | 226 |
| 579 | 3300005466 | Ga0070685_10082168 | Ga0070685_100821683 | 226 |
| 580 | 3300005530 | Ga0070679_100040702 | Ga0070679_1000407027 | 226 |
| 581 | 3300005544 | Ga0070686_100031720 | Ga0070686_1000317203 | 226 |
| 582 | 3300005545 | Ga0070695_100061606 | Ga0070695_1000616062 | 226 |
| 583 | 3300005563 | Ga0068855_100463200 | Ga0068855_1004632002 | 226 |
| 584 | 3300005564 | Ga0070664_100286491 | Ga0070664_1002864912 | 226 |
| 585 | 3300005577 | Ga0068857_100152834 | Ga0068857_1001528344 | 226 |
| 586 | 3300005615 | Ga0070702_100373061 | Ga0070702_1003730612 | 226 |
| 587 | 3300005617 | Ga0068859_100138390 | Ga0068859_1001383902 | 226 |
| 588 | 3300005843 | Ga0068860_100016941 | Ga0068860_1000169415 | 226 |
| 589 | 3300005844 | Ga0068862_100187548 | Ga0068862_1001875482 | 226 |
| 590 | 3300006871 | Ga0075434_100110126 | Ga0075434_1001101262 | 226 |
| 591 | 3300006881 | Ga0068865_100026671 | Ga0068865_1000266714 | 226 |
| 592 | 3300006931 | Ga0097620_100138394 | Ga0097620_1001383942 | 226 |
| 593 | 3300009094 | Ga0111539_10012295 | Ga0111539_100122956 | 226 |
| 594 | 3300009148 | Ga0105243_10045733 | Ga0105243_100457333 | 226 |
| 595 | 3300009545 | Ga0105237_10043927 | Ga0105237_100439274 | 226 |
| 596 | 3300009553 | Ga0105249_10548460 | Ga0105249_105484602 | 226 |
| 597 | 3300010375 | Ga0105239_10035136 | Ga0105239_100351366 | 226 |
| 598 | 3300011119 | Ga0105246_10067085 | Ga0105246_100670852 | 226 |
| 599 | 3300012508 | Ga0157315_1001000 | Ga0157315_10010002 | 226 |
| 600 | 3300012515 | Ga0157338_1001700 | Ga0157338_10017002 | 226 |
| 601 | 3300013102 | Ga0157371_10283916 | Ga0157371_102839161 | 226 |
| 602 | 3300013306 | Ga0163162_10007555 | Ga0163162_1000755514 | 226 |
| 603 | 3300013307 | Ga0157372_10368308 | Ga0157372_103683083 | 226 |
| 604 | 3300014326 | Ga0157380_10194015 | Ga0157380_101940152 | 226 |
| 605 | 3300014968 | Ga0157379_10080253 | Ga0157379_100802534 | 226 |
| 606 | 3300025271 | Ga0207666_1001220 | Ga0207666_10012203 | 226 |
| 607 | 3300025315 | Ga0207697_10029415 | Ga0207697_100294154 | 226 |
| 608 | 3300025885 | Ga0207653_10024549 | Ga0207653_100245492 | 226 |
| 609 | 3300025901 | Ga0207688_10044743 | Ga0207688_100447433 | 226 |
| 610 | 3300025903 | Ga0207680_10099999 | Ga0207680_100999994 | 226 |
| 611 | 3300025904 | Ga0207647_10003322 | Ga0207647_1000332211 | 226 |
| 612 | 3300025907 | Ga0207645_10063226 | Ga0207645_100632264 | 226 |
| 613 | 3300025912 | Ga0207707_10160380 | Ga0207707_101603804 | 226 |
| 614 | 3300025914 | Ga0207671_10210241 | Ga0207671_102102412 | 226 |
| 615 | 3300025918 | Ga0207662_10019216 | Ga0207662_100192163 | 226 |
| 616 | 3300025919 | Ga0207657_10033148 | Ga0207657_100331486 | 226 |
| 617 | 3300025921 | Ga0207652_10037929 | Ga0207652_100379292 | 226 |
| 618 | 3300025926 | Ga0207659_10111117 | Ga0207659_101111172 | 226 |
| 619 | 3300025933 | Ga0207706_10006317 | Ga0207706_100063175 | 226 |
| 620 | 3300025935 | Ga0207709_10029796 | Ga0207709_100297964 | 226 |
| 621 | 3300025940 | Ga0207691_10009787 | Ga0207691_100097873 | 226 |
| 622 | 3300025972 | Ga0207668_10024716 | Ga0207668_100247163 | 226 |
| 623 | 3300026035 | Ga0207703_10096833 | Ga0207703_100968332 | 226 |
| 624 | 3300026041 | Ga0207639_10365579 | Ga0207639_103655792 | 226 |
| 625 | 3300026067 | Ga0207678_10061333 | Ga0207678_100613332 | 226 |
| 626 | 3300026075 | Ga0207708_10088911 | Ga0207708_100889113 | 226 |
| 627 | 3300026089 | Ga0207648_10050414 | Ga0207648_100504143 | 226 |
| 628 | 3300026116 | Ga0207674_10083576 | Ga0207674_100835765 | 226 |
| 629 | 3300026118 | Ga0207675_100056416 | Ga0207675_1000564163 | 226 |
| 630 | 3300027695 | Ga0209966_1000561 | Ga0209966_10005615 | 226 |
| 631 | 3300027717 | Ga0209998_10000337 | Ga0209998_100003379 | 226 |
| 632 | 3300027907 | Ga0207428_10000617 | Ga0207428_1000061720 | 226 |
| 633 | 3300028380 | Ga0268265_10635241 | Ga0268265_106352412 | 226 |
| 634 | 3300028381 | Ga0268264_10192887 | Ga0268264_101928873 | 226 |
| 635 | 3300034816 | Ga0373930_0000783 | Ga0373930_0000783_2572_3276 | 226 |
| 636 | 3300034817 | Ga0373948_0000589 | Ga0373948_0000589_925_1629 | 226 |
| 637 | 3300034819 | Ga0373958_0000380 | Ga0373958_0000380_602_1306 | 226 |
| 638 | 3300034820 | Ga0373959_0001298 | Ga0373959_0001298_2170_2874 | 226 |
| 639 | 3300035084 | Ga0373928_0000205 | Ga0373928_0000205_659_1363 | 226 |
| 640 | 3300035085 | Ga0373929_0005397 | Ga0373929_0005397_1156_1860 | 226 |
| 641 | 3300035090 | Ga0373949_0001679 | Ga0373949_0001679_4811_5515 | 226 |
| 642 | 3300035092 | Ga0373952_0021214 | Ga0373952_0021214_269_973 | 226 |
| 643 | 3300035112 | Ga0373932_0000746 | Ga0373932_0000746_4203_4907 | 226 |
| 644 | 3300035114 | Ga0373939_0000794 | Ga0373939_0000794_6997_7701 | 226 |
| 645 | 3300035121 | Ga0373960_0001070 | Ga0373960_0001070_558_1262 | 226 |
| 646 | 3300035207 | Ga0373942_0000880 | Ga0373942_0000880_3574_4278 | 226 |
| 647 | 3300035241 | Ga0373961_0002053 | Ga0373961_0002053_4457_5161 | 226 |
| 648 | 3300035242 | Ga0373962_0001576 | Ga0373962_0001576_2843_3547 | 226 |
| 649 | 3300042876 | Ga0451577_0260045 | Ga0451577_0260045_128_832 | 226 |
| 650 | 3300045051 | Ga0451576_0046866 | Ga0451576_0046866_3276_3980 | 226 |
| 651 | 3300048909 | Ga0496106_0018636 | Ga0496106_0018636_1033_1737 | 226 |
| 652 | 3300048911 | Ga0496108_0954121 | Ga0496108_0954121_14_718 | 226 |
| 653 | 3300048915 | Ga0496112_0295535 | Ga0496112_0295535_846_1550 | 226 |
| 654 | 3300050511 | nmdc:mga08y16_21947_c1 | nmdc:mga08y16_21947_c1_2589_3293 | 226 |
| 655 | 3300050512 | nmdc:mga0n895_133889_c1 | nmdc:mga0n895_133889_c1_280_984 | 226 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1rc2-assembly1.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.866 | 5 | 207 |
| 7cjs-assembly2.cif.gz_E | structure of aquaporin | 0.8541 | 3 | 207 |
| 2d57-assembly1.cif.gz_A | double layered 2d crystal structure of aquaporin-4 (aqp4m23) at 3.2 a resolution by electron crystallography | 0.8534 | 6 | 208 |
| 3nk5-assembly2.cif.gz_B | crystal structure of aqpz mutant f43w | 0.8473 | 2 | 209 |
| 5i32-assembly1.cif.gz_A | ammonia permeable aquaporin attip2;1 | 0.8374 | 5 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1NH56_66_171_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.9176 | 2 | 103 | 1.20.1080.10 |
| af_A0A0P0WDK9_2_139_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.9107 | 1 | 104 | 1.20.1080.10 |
| af_A0A1D6J0S8_31_279_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.8639 | 1 | 207 | 1.20.1080.10 |
| af_Q54WT8_4_294_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.856 | 4 | 209 | 1.20.1080.10 |
| af_A0A1D6PLK2_10_163_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.8548 | 4 | 108 | 1.20.1080.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A5PEN6-F1-model_v4 | Uncharacterized protein | 0.9875 | 1 | 162 |
GO:0005737
GO:0005886 GO:0012505 GO:0015250 GO:0043231 |
| AF-A0A3C1B8D7-F1-model_v4 | Aquaporin family protein | 0.9872 | 3 | 168 |
GO:0015267
GO:0016020 |
| AF-A0A531KW06-F1-model_v4 | deleted | 0.9835 | 3 | 158 |
|
| AF-A0A525I976-F1-model_v4 | Aquaporin family protein | 0.9831 | 1 | 165 |
GO:0015267
GO:0016020 |
| AF-A0A7K1ADQ2-F1-model_v4 | Aquaporin family protein | 0.9809 | 6 | 169 |
GO:0005886
GO:0015250 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar