F472911

General Info

Members Datasets Scaffolds Average Seq Length
655 345 650 221

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100355761|Ga0068852_1003557611
Length 236
Sequence MVSLELSRRLVAEWLGTAFLLTAVVGSGIMAQKLAGGNVALALLCNTIPTGAILVVLILIFGPVSGAHFNPAVTLAFASRGELPWAFAGCYIAAQIAGGIAGVWLAHLMFELPVWQFSLTARTGTGQWLAEGVATFGLLLTIFGCVARAPTAVPYAVGLYITSAYWFTASTSFANPAVTISRSLSDTFAGIAPGGVPAFIAAQLAGAGLAVLLARWLWQLPVSSNSRGKDINNRKR

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
4 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
5 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
6 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
7 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
104 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
118 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
121 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
123 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
178 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
187 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
188 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
190 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
193 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
194 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
195 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
196 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
197 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
200 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
201 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
202 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
203 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
204 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
205 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
206 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
207 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
208 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
209 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
210 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
211 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
213 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
215 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
216 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
217 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
224 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
225 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
226 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
227 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
228 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
230 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
234 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
239 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
240 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
241 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
242 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
243 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
254 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
255 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
256 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
257 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
258 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
259 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
260 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
261 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
262 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
263 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
264 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
265 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
266 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
267 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
268 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
269 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
270 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
271 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
272 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
273 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
274 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
275 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
278 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
279 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
280 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
281 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
282 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
283 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
284 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
285 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
286 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
287 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
288 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
289 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
290 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
293 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
294 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
295 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
298 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
299 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
300 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
301 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
302 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
305 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
306 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
307 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
308 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
309 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
310 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
311 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
312 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
313 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
318 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
319 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
320 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
321 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
322 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
323 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
324 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
325 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
326 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
327 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
328 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
329 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
330 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
331 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
332 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
333 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
334 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
335 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
336 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
337 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
338 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
339 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
340 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
341 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
342 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
343 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
344 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
345 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0.15
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.5
Nodule 0.61
Rhizoplane 9.77
Rhizosphere 81.83
Stem 0
Stem Tuber 0
Unclassified 2.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214772973 2209111006 Bacteria 13664
2 ARcpr5oldR_c000172 3300000041 Bacteria 11189
3 ARCol0yngRDRAFT_1000173 3300000652 Bacteria 11015
4 JGI24737J22298_10002941 3300001990 Bacteria 6039
5 JGI24737J22298_10077600 3300001990 Bacteria 990
6 JGI24750J21931_1027100 3300002070 Bacteria 828
7 JGI24749J21850_1013718 3300002076 Bacteria 1138
8 Ga0055535_1000632 3300003761 Bacteria 28125
9 Ga0055529_1001056 3300003763 Bacteria 12764
10 Ga0065712_10131527 3300005290 Bacteria 1544
11 Ga0065715_10001277 3300005293 Bacteria 11971
12 Ga0070676_10139206 3300005328 Bacteria 1543
13 Ga0070683_100022631 3300005329 Bacteria 5620
14 Ga0070683_101000072 3300005329 Bacteria 803
15 Ga0070690_100024004 3300005330 Bacteria 3747
16 Ga0070670_100088515 3300005331 Bacteria 2662
17 Ga0070680_100035397 3300005336 Bacteria 4030
18 Ga0070680_100052054 3300005336 Bacteria 3342
19 Ga0070680_100089806 3300005336 Bacteria 2542
20 Ga0070682_100366738 3300005337 Bacteria 1078
21 Ga0070682_100641447 3300005337 Bacteria 844
22 Ga0068868_100009330 3300005338 Bacteria 7054
23 Ga0068868_100182609 3300005338 Bacteria 1741
24 Ga0070660_100063259 3300005339 Bacteria 2876
25 Ga0070660_100127779 3300005339 Bacteria 2032
26 Ga0070689_100017860 3300005340 Bacteria 5215
27 Ga0070689_100261158 3300005340 Bacteria 1431
28 Ga0070691_10044288 3300005341 Bacteria 2110
29 Ga0070692_10007543 3300005345 Bacteria 4797
30 Ga0070668_100057388 3300005347 Bacteria 3008
31 Ga0070669_100841028 3300005353 Bacteria 782
32 Ga0070675_100032642 3300005354 Bacteria 4214
33 Ga0070675_100074917 3300005354 Bacteria 2813
34 Ga0070675_100326568 3300005354 Bacteria 1356
35 Ga0070671_100052240 3300005355 Bacteria 3398
36 Ga0070673_100548887 3300005364 Bacteria 1049
37 Ga0070659_100147296 3300005366 Bacteria 1919
38 Ga0070667_101013901 3300005367 Bacteria 775
39 Ga0070709_10113573 3300005434 Bacteria 1824
40 Ga0070709_10344284 3300005434 Bacteria 1100
41 Ga0070714_100061780 3300005435 Bacteria 3218
42 Ga0070713_100020773 3300005436 Bacteria 5040
43 Ga0070713_100240020 3300005436 Bacteria 1650
44 Ga0070713_100480628 3300005436 Bacteria 1170
45 Ga0070710_10166208 3300005437 Bacteria 1372
46 Ga0070701_10024994 3300005438 Bacteria 2895
47 Ga0070701_10189070 3300005438 Bacteria 1210
48 Ga0070711_100053755 3300005439 Bacteria 2777
49 Ga0070711_100157532 3300005439 Bacteria 1718
50 Ga0070711_100310295 3300005439 Bacteria 1257
51 Ga0070700_100037901 3300005441 Bacteria 2934
52 Ga0070694_100144058 3300005444 Bacteria 1734
53 Ga0070694_100186477 3300005444 Bacteria 1537
54 Ga0070708_100229454 3300005445 Bacteria 1742
55 Ga0070663_100041474 3300005455 Bacteria 3228
56 Ga0070663_100062660 3300005455 Bacteria 2682
57 Ga0070678_100441218 3300005456 Bacteria 1138
58 Ga0070662_100019254 3300005457 Bacteria 4632
59 Ga0070662_100061679 3300005457 Bacteria 2738
60 Ga0070662_100217336 3300005457 Bacteria 1523
61 Ga0070681_10033224 3300005458 Bacteria 5179
62 Ga0070681_10122765 3300005458 Bacteria 2530
63 Ga0068867_100167659 3300005459 Bacteria 1737
64 Ga0070685_10016136 3300005466 Bacteria 3974
65 Ga0070685_10082168 3300005466 Bacteria 1933
66 Ga0070679_100040702 3300005530 Bacteria 4623
67 Ga0070679_100190615 3300005530 Bacteria 2019
68 Ga0070684_100197377 3300005535 Bacteria 1832
69 Ga0070684_100266843 3300005535 Bacteria 1566
70 Ga0068853_100065758 3300005539 Bacteria 3147
71 Ga0068853_100074542 3300005539 Bacteria 2960
72 Ga0068853_100217202 3300005539 Bacteria 1745
73 Ga0068853_100380947 3300005539 Bacteria 1317
74 Ga0070686_100013967 3300005544 Bacteria 4614
75 Ga0070686_100031720 3300005544 Bacteria 3233
76 Ga0070695_100061606 3300005545 Bacteria 2434
77 Ga0070695_100540549 3300005545 Bacteria 907
78 Ga0070665_100297729 3300005548 Bacteria 1616
79 Ga0070665_100353289 3300005548 Bacteria 1475
80 Ga0070704_100001307 3300005549 Bacteria 13180
81 Ga0068855_100073747 3300005563 Bacteria 3965
82 Ga0068855_100297368 3300005563 Bacteria 1788
83 Ga0068855_100463200 3300005563 Bacteria 1382
84 Ga0068855_101175326 3300005563 Bacteria 799
85 Ga0070664_100073397 3300005564 Bacteria 2935
86 Ga0070664_100084762 3300005564 Bacteria 2736
87 Ga0070664_100286491 3300005564 Bacteria 1486
88 Ga0068857_100152834 3300005577 Bacteria 2092
89 Ga0068857_100189935 3300005577 Bacteria 1871
90 Ga0068854_100206404 3300005578 Bacteria 1547
91 Ga0070702_100022253 3300005615 Bacteria 3347
92 Ga0070702_100373061 3300005615 Bacteria 1012
93 Ga0068852_100173372 3300005616 Bacteria 2024
94 Ga0068852_100355761 3300005616 Bacteria 1431
95 Ga0068859_100138390 3300005617 Bacteria 2508
96 Ga0068864_100017181 3300005618 Bacteria 6034
97 Ga0068864_100085339 3300005618 Bacteria 2776
98 Ga0068861_100584760 3300005719 Bacteria 1022
99 Ga0068870_10006351 3300005840 Bacteria 5204
100 Ga0068863_100286819 3300005841 Bacteria 1595
101 Ga0068858_100078707 3300005842 Bacteria 3063
102 Ga0068858_100160790 3300005842 Bacteria 2115
103 Ga0068860_100016941 3300005843 Bacteria 7102
104 Ga0068860_100276532 3300005843 Bacteria 1640
105 Ga0068860_100711379 3300005843 Bacteria 1015
106 Ga0068862_100122722 3300005844 Bacteria 2291
107 Ga0068862_100187548 3300005844 Bacteria 1859
108 Ga0081455_10161739 3300005937 Bacteria 1715
109 Ga0075365_10347543 3300006038 Bacteria 1045
110 Ga0075368_10136844 3300006042 Bacteria 1019
111 Ga0075363_100049026 3300006048 Bacteria 2247
112 Ga0075363_100141160 3300006048 Bacteria 1356
113 Ga0075364_10390444 3300006051 Bacteria 949
114 Ga0070716_100327851 3300006173 Bacteria 1075
115 Ga0070712_100014863 3300006175 Bacteria 5003
116 Ga0070712_100331071 3300006175 Bacteria 1241
117 Ga0075362_10080107 3300006177 Bacteria 1504
118 Ga0075367_10106405 3300006178 Bacteria 1719
119 Ga0075366_10015036 3300006195 Bacteria 4426
120 Ga0097621_100102300 3300006237 Bacteria 2412
121 Ga0075370_10048120 3300006353 Bacteria 2415
122 Ga0068871_100065584 3300006358 Bacteria 2974
123 Ga0068871_100087758 3300006358 Bacteria 2587
124 Ga0075431_100621178 3300006847 Bacteria 1063
125 Ga0075434_100110126 3300006871 Bacteria 2765
126 Ga0068865_100026671 3300006881 Bacteria 3811
127 Ga0068865_100035370 3300006881 Bacteria 3358
128 Ga0097620_100138394 3300006931 Bacteria 2508
129 Ga0099823_1009325 3300006944 Bacteria 9966
130 Ga0099794_10028156 3300007265 Bacteria 2612
131 Ga0099795_10005919 3300007788 Bacteria 3295
132 Ga0105240_10121453 3300009093 Bacteria 3145
133 Ga0111539_10012295 3300009094 Bacteria 10730
134 Ga0111539_10170937 3300009094 Bacteria 2539
135 Ga0105247_10006181 3300009101 Bacteria 7433
136 Ga0105247_10015382 3300009101 Bacteria 4583
137 Ga0105243_10045733 3300009148 Bacteria 3441
138 Ga0105241_10358864 3300009174 Bacteria 1268
139 Ga0105241_10375668 3300009174 Bacteria 1240
140 Ga0105242_10233439 3300009176 Bacteria 1650
141 Ga0105248_10238787 3300009177 Bacteria 2046
142 Ga0105248_10244610 3300009177 Bacteria 2019
143 Ga0105237_10034852 3300009545 Bacteria 5093
144 Ga0105237_10043927 3300009545 Bacteria 4500
145 Ga0105237_10198544 3300009545 Bacteria 2005
146 Ga0105237_10199931 3300009545 Bacteria 1998
147 Ga0105238_10080478 3300009551 Bacteria 3247
148 Ga0105238_10689923 3300009551 Bacteria 1033
149 Ga0105249_10548460 3300009553 Bacteria 1206
150 Ga0105249_10658936 3300009553 Bacteria 1105
151 Ga0099796_10004310 3300010159 Bacteria 3425
152 Ga0105239_10035136 3300010375 Bacteria 5505
153 Ga0105239_10050077 3300010375 Bacteria 4582
154 Ga0105246_10040222 3300011119 Bacteria 3154
155 Ga0105246_10067085 3300011119 Bacteria 2514
156 Ga0157315_1001000 3300012508 Bacteria 1466
157 Ga0157338_1001700 3300012515 Bacteria 1622
158 Ga0157371_10283916 3300013102 Bacteria 1196
159 Ga0157369_10003682 3300013105 Bacteria 18215
160 Ga0157369_11053253 3300013105 Bacteria 832
161 Ga0157374_10330293 3300013296 Bacteria 1512
162 Ga0157378_10208180 3300013297 Bacteria 1853
163 Ga0157378_10426650 3300013297 Bacteria 1311
164 Ga0163162_10007555 3300013306 Bacteria 10587
165 Ga0163162_10114190 3300013306 Bacteria 2800
166 Ga0163162_10292964 3300013306 Bacteria 1759
167 Ga0163162_10294669 3300013306 Bacteria 1754
168 Ga0163162_10611474 3300013306 Bacteria 1215
169 Ga0157372_10368308 3300013307 Bacteria 1674
170 Ga0157375_10180032 3300013308 Bacteria 2265
171 Ga0157375_10703866 3300013308 Bacteria 1164
172 Ga0157375_10795229 3300013308 Bacteria 1095
173 Ga0163163_10020055 3300014325 Bacteria 6291
174 Ga0163163_10021399 3300014325 Bacteria 6103
175 Ga0163163_10214256 3300014325 Bacteria 1975
176 Ga0157380_10194015 3300014326 Bacteria 1796
177 Ga0157377_10304541 3300014745 Bacteria 1053
178 Ga0157379_10027154 3300014968 Bacteria 5096
179 Ga0157379_10060926 3300014968 Bacteria 3374
180 Ga0157379_10080253 3300014968 Bacteria 2923
181 Ga0157376_10058961 3300014969 Bacteria 3217
182 Ga0157376_10332288 3300014969 Bacteria 1448
183 Ga0213872_10023492 3300021361 Bacteria 2837
184 Ga0213874_10003885 3300021377 Bacteria 3360
185 Ga0213876_10097017 3300021384 Bacteria 1562
186 Ga0228598_1002348 3300024227 Bacteria 4135
187 Ga0209258_100453 3300025242 Bacteria 45277
188 Ga0209759_1001564 3300025256 Bacteria 12493
189 Ga0207666_1001220 3300025271 Bacteria 3024
190 Ga0209455_1000157 3300025272 Bacteria 119719
191 Ga0209256_1022068 3300025299 Bacteria 1937
192 Ga0207697_10029415 3300025315 Bacteria 2248
193 Ga0207653_10024549 3300025885 Bacteria 1924
194 Ga0207688_10006296 3300025901 Bacteria 6464
195 Ga0207688_10022635 3300025901 Bacteria 3440
196 Ga0207688_10044743 3300025901 Bacteria 2467
197 Ga0207680_10099999 3300025903 Bacteria 1861
198 Ga0207647_10003322 3300025904 Bacteria 12085
199 Ga0207647_10209839 3300025904 Bacteria 1125
200 Ga0207699_10006782 3300025906 Bacteria 5568
201 Ga0207699_10029671 3300025906 Bacteria 3052
202 Ga0207645_10063226 3300025907 Bacteria 2365
203 Ga0207643_10008573 3300025908 Bacteria 5484
204 Ga0207707_10001362 3300025912 Bacteria 22693
205 Ga0207707_10160380 3300025912 Bacteria 1966
206 Ga0207695_10662784 3300025913 Bacteria 924
207 Ga0207671_10210241 3300025914 Bacteria 1522
208 Ga0207693_10030351 3300025915 Bacteria 4269
209 Ga0207663_10175817 3300025916 Bacteria 1525
210 Ga0207660_10021958 3300025917 Bacteria 4297
211 Ga0207660_10092594 3300025917 Bacteria 2244
212 Ga0207662_10019216 3300025918 Bacteria 3884
213 Ga0207657_10033148 3300025919 Bacteria 4659
214 Ga0207652_10037929 3300025921 Bacteria 4081
215 Ga0207652_10157299 3300025921 Bacteria 2036
216 Ga0207694_10038564 3300025924 Bacteria 3674
217 Ga0207694_10150395 3300025924 Bacteria 1875
218 Ga0207694_10515340 3300025924 Bacteria 1002
219 Ga0207650_10583267 3300025925 Bacteria 939
220 Ga0207659_10050758 3300025926 Bacteria 2948
221 Ga0207659_10111117 3300025926 Bacteria 2084
222 Ga0207700_10143848 3300025928 Bacteria 1963
223 Ga0207700_10191022 3300025928 Bacteria 1721
224 Ga0207700_10223431 3300025928 Bacteria 1598
225 Ga0207690_10173942 3300025932 Bacteria 1615
226 Ga0207706_10006317 3300025933 Bacteria 11008
227 Ga0207706_10063556 3300025933 Bacteria 3250
228 Ga0207706_10070104 3300025933 Bacteria 3083
229 Ga0207709_10029796 3300025935 Bacteria 3170
230 Ga0207670_10008187 3300025936 Bacteria 5883
231 Ga0207669_10141123 3300025937 Bacteria 1672
232 Ga0207704_10192668 3300025938 Bacteria 1484
233 Ga0207665_10472924 3300025939 Bacteria 965
234 Ga0207691_10009787 3300025940 Bacteria 9202
235 Ga0207691_10041676 3300025940 Bacteria 4238
236 Ga0207711_10157710 3300025941 Bacteria 2052
237 Ga0207689_10019815 3300025942 Bacteria 5666
238 Ga0207661_10002357 3300025944 Bacteria 13009
239 Ga0207661_10179682 3300025944 Bacteria 1847
240 Ga0207679_10092090 3300025945 Bacteria 2348
241 Ga0207667_10024554 3300025949 Bacteria 6615
242 Ga0207667_10048182 3300025949 Bacteria 4506
243 Ga0207667_10142328 3300025949 Bacteria 2469
244 Ga0207667_10719093 3300025949 Bacteria 1000
245 Ga0207651_10049604 3300025960 Bacteria 2845
246 Ga0207712_10337620 3300025961 Bacteria 1248
247 Ga0207668_10024716 3300025972 Bacteria 3881
248 Ga0207640_10502993 3300025981 Bacteria 1009
249 Ga0207658_10369189 3300025986 Bacteria 1254
250 Ga0207703_10056119 3300026035 Bacteria 3207
251 Ga0207703_10096833 3300026035 Bacteria 2492
252 Ga0207703_10116701 3300026035 Bacteria 2286
253 Ga0207639_10053071 3300026041 Bacteria 3091
254 Ga0207639_10082020 3300026041 Bacteria 2556
255 Ga0207639_10262038 3300026041 Bacteria 1512
256 Ga0207639_10365579 3300026041 Bacteria 1292
257 Ga0207678_10025630 3300026067 Bacteria 5147
258 Ga0207678_10030703 3300026067 Bacteria 4692
259 Ga0207678_10061333 3300026067 Bacteria 3234
260 Ga0207708_10011723 3300026075 Bacteria 6534
261 Ga0207708_10088911 3300026075 Bacteria 2380
262 Ga0207702_10066021 3300026078 Bacteria 3100
263 Ga0207641_10017320 3300026088 Bacteria 5898
264 Ga0207641_10297567 3300026088 Bacteria 1523
265 Ga0207648_10050414 3300026089 Bacteria 3640
266 Ga0207648_10050996 3300026089 Bacteria 3617
267 Ga0207648_10213475 3300026089 Bacteria 1714
268 Ga0207676_10015307 3300026095 Bacteria 5531
269 Ga0207676_10633304 3300026095 Bacteria 1030
270 Ga0207674_10057890 3300026116 Bacteria 3928
271 Ga0207674_10083576 3300026116 Bacteria 3192
272 Ga0207674_10107865 3300026116 Bacteria 2761
273 Ga0207675_100012644 3300026118 Bacteria 7887
274 Ga0207675_100056416 3300026118 Bacteria 3664
275 Ga0207683_10092022 3300026121 Bacteria 2702
276 Ga0207698_10487817 3300026142 Bacteria 1197
277 Ga0209389_1004554 3300027296 Bacteria 11577
278 Ga0209179_1027748 3300027512 Bacteria 1144
279 Ga0209966_1000561 3300027695 Bacteria 9270
280 Ga0209998_10000337 3300027717 Bacteria 13862
281 Ga0209813_10022792 3300027866 Bacteria 1775
282 Ga0207428_10000617 3300027907 Bacteria 42011
283 Ga0268266_10121072 3300028379 Bacteria 2329
284 Ga0268266_10195487 3300028379 Bacteria 1849
285 Ga0268266_10369185 3300028379 Bacteria 1351
286 Ga0268265_10323540 3300028380 Bacteria 1398
287 Ga0268265_10635241 3300028380 Bacteria 1024
288 Ga0268264_10192887 3300028381 Bacteria 1858
289 Ga0268264_10236427 3300028381 Bacteria 1690
290 Ga0268264_10264664 3300028381 Bacteria 1604
291 Ga0265318_10007275 3300028577 Bacteria 5020
292 Ga0307517_10110399 3300028786 Bacteria 2097
293 Ga0265762_1032748 3300030760 Bacteria 992
294 Ga0265330_10095027 3300031235 Bacteria 1278
295 Ga0265320_10011536 3300031240 Bacteria 5192
296 Ga0265325_10008767 3300031241 Bacteria 5947
297 Ga0265329_10009771 3300031242 Bacteria 3557
298 Ga0265340_10002685 3300031247 Bacteria 10115
299 Ga0265339_10091937 3300031249 Bacteria 1589
300 Ga0265331_10021931 3300031250 Bacteria 3262
301 Ga0265316_10236374 3300031344 Bacteria 1344
302 Ga0307513_10003287 3300031456 Bacteria 22017
303 Ga0265314_10043915 3300031711 Bacteria 3172
304 Ga0265342_10016076 3300031712 Bacteria 4900
305 Ga0265342_10130218 3300031712 Bacteria 1410
306 Ga0373930_0000783 3300034816 Bacteria 4522
307 Ga0373948_0000589 3300034817 Bacteria 4652
308 Ga0373958_0000380 3300034819 Bacteria 5375
309 Ga0373959_0001298 3300034820 Bacteria 4007
310 Ga0373926_0024367 3300035083 Bacteria 2107
311 Ga0373928_0000205 3300035084 Bacteria 11403
312 Ga0373929_0005397 3300035085 Bacteria 2298
313 Ga0373934_0038077 3300035086 Bacteria 1894
314 Ga0373934_0098498 3300035086 Bacteria 1181
315 Ga0373944_0000948 3300035089 Bacteria 7186
316 Ga0373944_0185706 3300035089 Bacteria 747
317 Ga0373949_0001679 3300035090 Bacteria 6169
318 Ga0373952_0021214 3300035092 Bacteria 1369
319 Ga0373923_0000023 3300035111 Bacteria 23047
320 Ga0373923_0019383 3300035111 Bacteria 2634
321 Ga0373923_0085235 3300035111 Bacteria 1375
322 Ga0373923_0098524 3300035111 Bacteria 1286
323 Ga0373932_0000746 3300035112 Bacteria 9717
324 Ga0373936_0000171 3300035113 Bacteria 21558
325 Ga0373936_0016160 3300035113 Bacteria 2869
326 Ga0373936_0034409 3300035113 Bacteria 2012
327 Ga0373936_0232532 3300035113 Bacteria 820
328 Ga0373936_0273720 3300035113 Bacteria 758
329 Ga0373939_0000794 3300035114 Bacteria 7784
330 Ga0373941_0064956 3300035115 Bacteria 1197
331 Ga0373945_0012431 3300035116 Bacteria 2828
332 Ga0373945_0094072 3300035116 Bacteria 1164
333 Ga0373953_0000572 3300035117 Bacteria 10237
334 Ga0373953_0006693 3300035117 Bacteria 3814
335 Ga0373953_0014809 3300035117 Bacteria 2813
336 Ga0373954_0002827 3300035118 Bacteria 7308
337 Ga0373954_0006983 3300035118 Bacteria 4931
338 Ga0373954_0121204 3300035118 Bacteria 1269
339 Ga0373954_0416003 3300035118 Bacteria 665
340 Ga0373956_0017451 3300035119 Bacteria 3025
341 Ga0373956_0027398 3300035119 Bacteria 2474
342 Ga0373956_0028006 3300035119 Bacteria 2450
343 Ga0373957_0097152 3300035120 Bacteria 1176
344 Ga0373957_0388810 3300035120 Bacteria 599
345 Ga0373960_0001070 3300035121 Bacteria 5904
346 Ga0373943_0000022 3300035170 Bacteria 52033
347 Ga0373943_0003257 3300035170 Bacteria 7373
348 Ga0373943_0138559 3300035170 Bacteria 1309
349 Ga0373943_0238247 3300035170 Bacteria 1019
350 Ga0373946_0000384 3300035171 Bacteria 14370
351 Ga0373946_0005588 3300035171 Bacteria 4538
352 Ga0373946_0005813 3300035171 Bacteria 4462
353 Ga0373955_0000031 3300035172 Bacteria 56668
354 Ga0373955_0083306 3300035172 Bacteria 1811
355 Ga0373955_0090574 3300035172 Bacteria 1742
356 Ga0373955_0165501 3300035172 Bacteria 1307
357 Ga0373942_0000880 3300035207 Bacteria 8248
358 Ga0373961_0002053 3300035241 Bacteria 5378
359 Ga0373961_0045791 3300035241 Bacteria 1280
360 Ga0373962_0001576 3300035242 Bacteria 5408
361 Ga0373924_0003376 3300035410 Bacteria 5484
362 Ga0373924_0138213 3300035410 Bacteria 1062
363 Ga0373931_0041070 3300035691 Bacteria 2429
364 Ga0373935_0000461 3300035692 Bacteria 21136
365 Ga0373935_0004500 3300035692 Bacteria 8191
366 Ga0373935_0068360 3300035692 Bacteria 2286
367 Ga0373935_0089226 3300035692 Bacteria 2016
368 Ga0373927_0000113 3300035695 Bacteria 60608
369 Ga0373927_0020575 3300035695 Bacteria 4327
370 Ga0373927_0066897 3300035695 Bacteria 2325
371 Ga0373927_0123584 3300035695 Bacteria 1689
372 Ga0373933_0000638 3300035724 Bacteria 21867
373 Ga0373933_0002640 3300035724 Bacteria 10041
374 Ga0373933_0044251 3300035724 Bacteria 2637
375 Ga0373947_0000244 3300035725 Bacteria 30605
376 Ga0373947_0001403 3300035725 Bacteria 14824
377 Ga0373947_0025025 3300035725 Bacteria 3480
378 Ga0373937_0000098 3300036401 Bacteria 81900
379 Ga0373937_0019040 3300036401 Bacteria 6142
380 Ga0373937_0046591 3300036401 Bacteria 3965
381 Ga0373937_0046721 3300036401 Bacteria 3959
382 Ga0373937_0143963 3300036401 Bacteria 2230
383 Ga0373937_0339816 3300036401 Bacteria 1422
384 Ga0373925_0000198 3300037068 Bacteria 65543
385 Ga0373925_0001554 3300037068 Bacteria 19523
386 Ga0373925_0078607 3300037068 Bacteria 2505
387 Ga0373925_0106466 3300037068 Bacteria 2162
388 Ga0373925_0178283 3300037068 Bacteria 1680
389 Ga0373925_0340550 3300037068 Bacteria 1216
390 Ga0373925_0460797 3300037068 Bacteria 1042
391 Ga0373925_0819720 3300037068 Bacteria 767
392 Ga0436364_1556608 3300037853 Bacteria 1428
393 Ga0436365_1498030 3300039437 Bacteria 1371
394 Ga0436361_0956991 3300039447 Bacteria 4949
395 Ga0436363_0098309 3300039450 Bacteria 27510
396 Ga0451795_0506986 3300041456 Bacteria 2419
397 Ga0451798_0262741 3300041458 Bacteria 2923
398 Ga0451800_0296903 3300041459 Bacteria 2406
399 Ga0451802_0154319 3300041460 Bacteria 2599
400 Ga0451577_0260045 3300042876 Bacteria 1572
401 Ga0466968_0209838 3300044735 Bacteria 915
402 Ga0451576_0046866 3300045051 Bacteria 4549
403 Ga0466967_0297512 3300045976 Bacteria 1552
404 Ga0495592_0000119 3300046454 Bacteria 69687
405 Ga0495592_0004538 3300046454 Bacteria 10168
406 Ga0495592_0047069 3300046454 Bacteria 3213
407 Ga0495592_0080596 3300046454 Bacteria 2355
408 Ga0495592_0083439 3300046454 Bacteria 2307
409 Ga0495629_0003106 3300046459 Bacteria 12592
410 Ga0495629_0028439 3300046459 Bacteria 3969
411 Ga0495629_0029980 3300046459 Bacteria 3856
412 Ga0495629_0030274 3300046459 Bacteria 3839
413 Ga0495629_0090673 3300046459 Bacteria 2133
414 Ga0495651_0002375 3300046462 Bacteria 14542
415 Ga0495653_0000030 3300046463 Bacteria 142668
416 Ga0495653_0116712 3300046463 Bacteria 1908
417 Ga0495653_0135065 3300046463 Bacteria 1741
418 Ga0495653_0164222 3300046463 Bacteria 1539
419 Ga0495653_0443910 3300046463 Bacteria 817
420 Ga0495580_0021704 3300046472 Bacteria 4735
421 Ga0495580_0206597 3300046472 Bacteria 1352
422 Ga0495639_0007988 3300046475 Bacteria 4544
423 Ga0495639_0036452 3300046475 Bacteria 2203
424 Ga0495662_0001102 3300046476 Bacteria 13286
425 Ga0495662_0007134 3300046476 Bacteria 5538
426 Ga0495662_0021221 3300046476 Bacteria 3140
427 Ga0495662_0056954 3300046476 Bacteria 1887
428 Ga0495662_0126348 3300046476 Bacteria 1256
429 Ga0495664_0000003 3300046477 Bacteria 551602
430 Ga0495664_0002872 3300046477 Bacteria 9287
431 Ga0495664_0016526 3300046477 Bacteria 4206
432 Ga0495664_0044439 3300046477 Bacteria 2632
433 Ga0495664_0353333 3300046477 Bacteria 885
434 Ga0495585_0179113 3300046492 Bacteria 1091
435 Ga0495594_0262791 3300046499 Bacteria 983
436 Ga0495608_0000011 3300046511 Bacteria 248514
437 Ga0495608_0002101 3300046511 Bacteria 14347
438 Ga0495608_0300899 3300046511 Bacteria 993
439 Ga0495618_0000025 3300046514 Bacteria 116027
440 Ga0495618_0005719 3300046514 Bacteria 7555
441 Ga0495618_0173426 3300046514 Bacteria 1372
442 Ga0495618_0182163 3300046514 Bacteria 1334
443 Ga0495618_0284620 3300046514 Bacteria 1030
444 Ga0495628_0000001 3300046516 Bacteria 917742
445 Ga0495628_0119849 3300046516 Bacteria 2019
446 Ga0495628_0147976 3300046516 Bacteria 1790
447 Ga0495630_0000551 3300046517 Bacteria 27325
448 Ga0495630_0002011 3300046517 Bacteria 14140
449 Ga0495630_0015505 3300046517 Bacteria 5565
450 Ga0495630_0153897 3300046517 Bacteria 1750
451 Ga0495630_0254220 3300046517 Bacteria 1342
452 Ga0495632_0026673 3300046519 Bacteria 3038
453 Ga0495644_0107231 3300046523 Bacteria 1059
454 Ga0495648_0139816 3300046524 Bacteria 1276
455 Ga0495663_0070975 3300046525 Bacteria 1109
456 Ga0495666_0008360 3300046526 Bacteria 5188
457 Ga0495652_0000002 3300046529 Bacteria 946606
458 Ga0495652_0002923 3300046529 Bacteria 17195
459 Ga0495652_0012755 3300046529 Bacteria 7571
460 Ga0495652_0224146 3300046529 Bacteria 1411
461 Ga0495652_0319909 3300046529 Bacteria 1121
462 Ga0495665_0051806 3300046531 Bacteria 2173
463 Ga0495665_0192218 3300046531 Bacteria 1059
464 Ga0495665_0238181 3300046531 Bacteria 938
465 Ga0495640_0000002 3300046533 Bacteria 646434
466 Ga0495640_0006879 3300046533 Bacteria 8960
467 Ga0495640_0292782 3300046533 Bacteria 1012
468 Ga0495587_0000001 3300046536 Bacteria 724132
469 Ga0495587_0044468 3300046536 Bacteria 2641
470 Ga0495587_0356734 3300046536 Bacteria 814
471 Ga0495621_0001598 3300046539 Bacteria 5909
472 Ga0495645_0000002 3300046543 Bacteria 651644
473 Ga0495645_0023765 3300046543 Bacteria 4442
474 Ga0495667_0000004 3300046559 Bacteria 295297
475 Ga0495667_0009464 3300046559 Bacteria 6602
476 Ga0495667_0017883 3300046559 Bacteria 4789
477 Ga0495667_0268325 3300046559 Bacteria 1085
478 Ga0495668_0046435 3300046616 Bacteria 2413
479 Ga0495668_0292311 3300046616 Bacteria 893
480 Ga0495634_0000010 3300046642 Bacteria 143792
481 Ga0495634_0005170 3300046642 Bacteria 10079
482 Ga0495634_0027528 3300046642 Bacteria 3954
483 Ga0495634_0028467 3300046642 Bacteria 3878
484 Ga0495634_0054475 3300046642 Bacteria 2677
485 Ga0495634_0054733 3300046642 Bacteria 2669
486 Ga0495635_0000001 3300046663 Bacteria 704901
487 Ga0495635_0004596 3300046663 Bacteria 9573
488 Ga0495635_0025067 3300046663 Bacteria 4155
489 Ga0495635_0032643 3300046663 Bacteria 3611
490 Ga0495635_0388286 3300046663 Bacteria 928
491 Ga0495657_0000369 3300046675 Bacteria 41664
492 Ga0495657_0031002 3300046675 Bacteria 3740
493 Ga0495599_0000013 3300046678 Bacteria 179828
494 Ga0495599_0022609 3300046678 Bacteria 3926
495 Ga0495623_0000024 3300046679 Bacteria 96499
496 Ga0495623_0003190 3300046679 Bacteria 10828
497 Ga0495623_0051910 3300046679 Bacteria 2593
498 Ga0495646_0000009 3300046680 Bacteria 200698
499 Ga0495646_0029662 3300046680 Bacteria 3419
500 Ga0495646_0113321 3300046680 Bacteria 1542
501 Ga0495647_0199036 3300046681 Bacteria 878
502 Ga0495658_0021427 3300046683 Bacteria 3407
503 Ga0495658_0073899 3300046683 Bacteria 1986
504 Ga0495669_0199226 3300046684 Bacteria 957
505 Ga0495613_0006467 3300046689 Bacteria 8758
506 Ga0495624_0004319 3300046690 Bacteria 10428
507 Ga0495624_0011364 3300046690 Bacteria 6119
508 Ga0495649_0265546 3300046694 Bacteria 879
509 Ga0495600_0000071 3300046809 Bacteria 55914
510 Ga0495581_0005578 3300047315 Bacteria 7292
511 Ga0495581_0021230 3300047315 Bacteria 3766
512 Ga0495581_0105810 3300047315 Bacteria 1635
513 Ga0495604_0000129 3300047317 Bacteria 63593
514 Ga0495604_0004930 3300047317 Bacteria 10583
515 Ga0495636_0005689 3300047318 Bacteria 4887
516 Ga0495674_0000002 3300047319 Bacteria 642785
517 Ga0495674_0012602 3300047319 Bacteria 7966
518 Ga0495674_0014359 3300047319 Bacteria 7416
519 Ga0495674_0130122 3300047319 Bacteria 2121
520 Ga0495674_0372884 3300047319 Bacteria 1156
521 Ga0495672_0157625 3300047320 Bacteria 1171
522 Ga0495672_0199708 3300047320 Bacteria 1001
523 Ga0495676_0143597 3300047321 Bacteria 1708
524 Ga0495676_0229096 3300047321 Bacteria 1277
525 Ga0495680_0000853 3300047322 Bacteria 33888
526 Ga0495680_0049963 3300047322 Bacteria 3272
527 Ga0495687_011883 3300047443 Bacteria 4649
528 Ga0495675_0000274 3300047444 Bacteria 37360
529 Ga0495675_0011418 3300047444 Bacteria 5576
530 Ga0495675_0056881 3300047444 Bacteria 2480
531 Ga0495684_0000083 3300047471 Bacteria 65861
532 Ga0495684_0000845 3300047471 Bacteria 24740
533 Ga0495684_0004293 3300047471 Bacteria 11126
534 Ga0495684_0009757 3300047471 Bacteria 7409
535 Ga0495684_0019817 3300047471 Bacteria 5183
536 Ga0495684_0036691 3300047471 Bacteria 3757
537 Ga0495684_0133514 3300047471 Bacteria 1863
538 Ga0495593_0005774 3300047673 Bacteria 7299
539 Ga0495593_0013117 3300047673 Bacteria 4731
540 Ga0495602_0000024 3300048088 Bacteria 151162
541 Ga0495602_0006759 3300048088 Bacteria 12039
542 Ga0495602_0159292 3300048088 Bacteria 1764
543 Ga0495614_0086625 3300048089 Bacteria 1360
544 Ga0495614_0097718 3300048089 Bacteria 1281
545 Ga0496100_0036651 3300048903 Bacteria 3096
546 Ga0496100_0083141 3300048903 Bacteria 2166
547 Ga0496100_0133222 3300048903 Bacteria 1753
548 Ga0496101_0024098 3300048904 Bacteria 4209
549 Ga0496101_0132478 3300048904 Bacteria 1894
550 Ga0496101_0371121 3300048904 Bacteria 1125
551 Ga0496102_0015623 3300048905 Bacteria 6613
552 Ga0496102_0171047 3300048905 Bacteria 2045
553 Ga0496102_0234387 3300048905 Bacteria 1730
554 Ga0496102_0564762 3300048905 Bacteria 1060
555 Ga0496102_0821104 3300048905 Bacteria 852
556 Ga0496103_0018740 3300048906 Bacteria 4153
557 Ga0496103_0023649 3300048906 Bacteria 3706
558 Ga0496104_0000306 3300048907 Bacteria 43669
559 Ga0496104_0000955 3300048907 Bacteria 24869
560 Ga0496104_0001512 3300048907 Bacteria 20062
561 Ga0496104_0084728 3300048907 Bacteria 3025
562 Ga0496104_0109519 3300048907 Bacteria 2647
563 Ga0496104_0157341 3300048907 Bacteria 2180
564 Ga0496104_0202419 3300048907 Bacteria 1897
565 Ga0496104_0208069 3300048907 Bacteria 1868
566 Ga0496104_0277770 3300048907 Bacteria 1588
567 Ga0496105_0001292 3300048908 Bacteria 17514
568 Ga0496105_0018693 3300048908 Bacteria 5578
569 Ga0496105_0025818 3300048908 Bacteria 4785
570 Ga0496105_0115424 3300048908 Bacteria 2215
571 Ga0496105_0209217 3300048908 Bacteria 1590
572 Ga0496105_0378655 3300048908 Bacteria 1126
573 Ga0496106_0018636 3300048909 Bacteria 5137
574 Ga0496106_0024820 3300048909 Bacteria 4457
575 Ga0496106_0047405 3300048909 Bacteria 3234
576 Ga0496106_0086101 3300048909 Bacteria 2420
577 Ga0496106_0121899 3300048909 Bacteria 2038
578 Ga0496107_0048889 3300048910 Bacteria 3047
579 Ga0496107_0109391 3300048910 Bacteria 2030
580 Ga0496108_0122288 3300048911 Bacteria 2233
581 Ga0496108_0749010 3300048911 Bacteria 845
582 Ga0496108_0954121 3300048911 Bacteria 734
583 Ga0496109_0042210 3300048912 Bacteria 4131
584 Ga0496109_0082129 3300048912 Bacteria 2970
585 Ga0496109_0134540 3300048912 Bacteria 2309
586 Ga0496110_0298202 3300048913 Bacteria 1468
587 Ga0496111_0032257 3300048914 Bacteria 3734
588 Ga0496111_0095564 3300048914 Bacteria 2180
589 Ga0496112_0012515 3300048915 Bacteria 7794
590 Ga0496112_0212933 3300048915 Bacteria 1889
591 Ga0496112_0262159 3300048915 Bacteria 1678
592 Ga0496112_0295535 3300048915 Bacteria 1566
593 Ga0496112_0309792 3300048915 Bacteria 1524
594 Ga0496113_0012395 3300048916 Bacteria 5728
595 Ga0496113_0412638 3300048916 Bacteria 1084
596 Ga0496114_0294606 3300048917 Bacteria 1432
597 Ga0496114_0414327 3300048917 Bacteria 1193
598 Ga0496115_0008348 3300048918 Bacteria 7662
599 Ga0496115_0049563 3300048918 Bacteria 3362
600 Ga0496115_0052137 3300048918 Bacteria 3281
601 Ga0496115_0103121 3300048918 Bacteria 2340
602 Ga0496115_0118221 3300048918 Bacteria 2180
603 Ga0496115_0411745 3300048918 Bacteria 1096
604 Ga0496115_0506001 3300048918 Bacteria 970
605 Ga0496121_0370478 3300048924 Bacteria 948
606 Ga0496126_0027851 3300048929 Bacteria 5390
607 Ga0496126_0266241 3300048929 Bacteria 1424
608 Ga0496126_0308291 3300048929 Bacteria 1304
609 Ga0496126_0561252 3300048929 Bacteria 904
610 nmdc:mga0yw44_36490_c1 3300050492 Bacteria 2897
611 nmdc:mga0k408_153462_c1 3300050493 Bacteria 1372
612 nmdc:mga06z11_170107_c1 3300050494 Bacteria 1251
613 nmdc:mga04h51_93850_c1 3300050495 Bacteria 1084
614 nmdc:mga07m45_10104_c1 3300050496 Bacteria 4917
615 nmdc:mga07m45_16539_c1 3300050496 Bacteria 3949
616 nmdc:mga08y16_21947_c1 3300050511 Bacteria 6740
617 nmdc:mga0n895_133889_c1 3300050512 Bacteria 2504
618 Ga0495601_0000001 3300053077 Bacteria 549454
619 Ga0495601_0019342 3300053077 Bacteria 4153
620 Ga0495601_0041050 3300053077 Bacteria 2899
621 Ga0495601_0044713 3300053077 Bacteria 2784
622 Ga0495601_0054650 3300053077 Bacteria 2527
623 Ga0495601_0279501 3300053077 Bacteria 1088
624 Ga0495612_0000017 3300053078 Bacteria 152112
625 Ga0495612_0002989 3300053078 Bacteria 7016
626 Ga0495612_0039500 3300053078 Bacteria 1920
627 Ga0500635_0023486 3300053080 Bacteria 1925
628 Ga0495655_0017966 3300053083 Bacteria 1548
629 Ga0495595_0000010 3300053084 Bacteria 178819
630 Ga0495595_0000287 3300053084 Bacteria 19822
631 Ga0495595_0030593 3300053084 Bacteria 2416
632 Ga0495595_0294005 3300053084 Bacteria 816
633 Ga0495619_0000004 3300053085 Bacteria 500068
634 Ga0495619_0005220 3300053085 Bacteria 8234
635 Ga0495619_0007250 3300053085 Bacteria 7023
636 Ga0495619_0587309 3300053085 Bacteria 762
637 Ga0500578_0209750 3300053086 Bacteria 1189
638 Ga0500644_0141852 3300053088 Bacteria 955
639 Ga0500646_0019730 3300053090 Bacteria 1785
640 Ga0500651_0046070 3300053093 Bacteria 2742
641 Ga0500593_003384 3300053117 Bacteria 6014
642 Ga0500642_0056152 3300053130 Bacteria 1753
643 Ga0500652_000406 3300053131 Bacteria 15439
644 Ga0500568_0109584 3300053139 Bacteria 1032
645 Ga0500577_0006051 3300053142 Bacteria 3306
646 Ga0500579_059645 3300053143 Bacteria 2275
647 Ga0500604_0008480 3300053151 Bacteria 2726
648 Ga0500622_0001930 3300053156 Bacteria 15634
649 Ga0500637_0010767 3300053178 Bacteria 4702
650 Ga0500570_095032 3300053724 Bacteria 1280

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035120 Ga0373957_0388810 Ga0373957_0388810_13_588 183
2 3300046517 Ga0495630_0254220 Ga0495630_0254220_24_599 183
3 3300044735 Ga0466968_0209838 Ga0466968_0209838_324_905 185
4 3300035118 Ga0373954_0416003 Ga0373954_0416003_29_616 187
5 3300048929 Ga0496126_0561252 Ga0496126_0561252_25_615 188
6 iso_pu_bacteria 2906643746 2906643801 190
7 3300005338 Ga0068868_100182609 Ga0068868_1001826092 191
8 3300005354 Ga0070675_100326568 Ga0070675_1003265682 191
9 3300005539 Ga0068853_100065758 Ga0068853_1000657582 191
10 3300006051 Ga0075364_10390444 Ga0075364_103904441 191
11 3300009177 Ga0105248_10244610 Ga0105248_102446103 191
12 3300013308 Ga0157375_10795229 Ga0157375_107952291 191
13 3300014325 Ga0163163_10020055 Ga0163163_100200555 191
14 3300025901 Ga0207688_10006296 Ga0207688_100062963 191
15 3300026041 Ga0207639_10082020 Ga0207639_100820203 191
16 3300046524 Ga0495648_0139816 Ga0495648_0139816_185_877 191
17 3300048903 Ga0496100_0133222 Ga0496100_0133222_1003_1695 191
18 3300048906 Ga0496103_0023649 Ga0496103_0023649_1946_2638 191
19 3300048907 Ga0496104_0202419 Ga0496104_0202419_242_934 191
20 3300050496 nmdc:mga07m45_16539_c1 nmdc:mga07m45_16539_c1_1870_2562 191
21 3300035115 Ga0373941_0064956 Ga0373941_0064956_573_1175 192
22 3300041458 Ga0451798_0262741 Ga0451798_0262741_1085_1774 192
23 3300041459 Ga0451800_0296903 Ga0451800_0296903_1610_2299 192
24 3300041460 Ga0451802_0154319 Ga0451802_0154319_925_1614 192
25 3300046519 Ga0495632_0026673 Ga0495632_0026673_2233_2922 192
26 3300053088 Ga0500644_0141852 Ga0500644_0141852_97_786 192
27 3300053090 Ga0500646_0019730 Ga0500646_0019730_233_922 192
28 3300053093 Ga0500651_0046070 Ga0500651_0046070_375_1064 192
29 3300053130 Ga0500642_0056152 Ga0500642_0056152_958_1647 192
30 3300053131 Ga0500652_000406 Ga0500652_000406_8295_8984 192
31 3300053143 Ga0500579_059645 Ga0500579_059645_708_1397 192
32 3300053156 Ga0500622_0001930 Ga0500622_0001930_8446_9135 192
33 3300009553 Ga0105249_10658936 Ga0105249_106589362 193
34 3300025961 Ga0207712_10337620 Ga0207712_103376202 193
35 3300031456 Ga0307513_10003287 Ga0307513_1000328718 194
36 3300006847 Ga0075431_100621178 Ga0075431_1006211782 196
37 3300028786 Ga0307517_10110399 Ga0307517_101103992 196
38 3300035113 Ga0373936_0273720 Ga0373936_0273720_77_733 196
39 3300035695 Ga0373927_0123584 Ga0373927_0123584_566_1246 196
40 3300041456 Ga0451795_0506986 Ga0451795_0506986_603_1292 196
41 3300053142 Ga0500577_0006051 Ga0500577_0006051_866_1555 196
42 3300053151 Ga0500604_0008480 Ga0500604_0008480_1258_1947 196
43 3300053724 Ga0500570_095032 Ga0500570_095032_417_1106 196
44 3300035113 Ga0373936_0232532 Ga0373936_0232532_23_643 198
45 3300048907 Ga0496104_0277770 Ga0496104_0277770_538_1230 199
46 3300048915 Ga0496112_0309792 Ga0496112_0309792_382_1074 199
47 3300053117 Ga0500593_003384 Ga0500593_003384_1212_1877 199
48 3300025928 Ga0207700_10191022 Ga0207700_101910223 202
49 3300035086 Ga0373934_0098498 Ga0373934_0098498_267_899 202
50 3300035111 Ga0373923_0085235 Ga0373923_0085235_671_1303 202
51 3300035118 Ga0373954_0121204 Ga0373954_0121204_112_744 202
52 3300035119 Ga0373956_0027398 Ga0373956_0027398_199_831 202
53 3300035170 Ga0373943_0238247 Ga0373943_0238247_214_846 202
54 3300035172 Ga0373955_0083306 Ga0373955_0083306_41_673 202
55 3300035692 Ga0373935_0068360 Ga0373935_0068360_322_954 202
56 3300035695 Ga0373927_0066897 Ga0373927_0066897_499_1131 202
57 3300035724 Ga0373933_0002640 Ga0373933_0002640_8559_9191 202
58 3300036401 Ga0373937_0019040 Ga0373937_0019040_3838_4470 202
59 3300037068 Ga0373925_0106466 Ga0373925_0106466_214_846 202
60 3300046454 Ga0495592_0004538 Ga0495592_0004538_7924_8556 202
61 3300046459 Ga0495629_0029980 Ga0495629_0029980_784_1416 202
62 3300046462 Ga0495651_0002375 Ga0495651_0002375_13694_14326 202
63 3300046463 Ga0495653_0116712 Ga0495653_0116712_1090_1722 202
64 3300046476 Ga0495662_0021221 Ga0495662_0021221_624_1256 202
65 3300046477 Ga0495664_0016526 Ga0495664_0016526_2900_3532 202
66 3300046511 Ga0495608_0002101 Ga0495608_0002101_7463_8095 202
67 3300046514 Ga0495618_0284620 Ga0495618_0284620_195_827 202
68 3300046516 Ga0495628_0119849 Ga0495628_0119849_288_920 202
69 3300046517 Ga0495630_0153897 Ga0495630_0153897_237_869 202
70 3300046529 Ga0495652_0002923 Ga0495652_0002923_3768_4400 202
71 3300046531 Ga0495665_0238181 Ga0495665_0238181_49_681 202
72 3300046536 Ga0495587_0044468 Ga0495587_0044468_732_1364 202
73 3300046543 Ga0495645_0023765 Ga0495645_0023765_2030_2662 202
74 3300046559 Ga0495667_0009464 Ga0495667_0009464_687_1319 202
75 3300046642 Ga0495634_0028467 Ga0495634_0028467_1332_1964 202
76 3300046663 Ga0495635_0032643 Ga0495635_0032643_2775_3407 202
77 3300046675 Ga0495657_0031002 Ga0495657_0031002_950_1582 202
78 3300046678 Ga0495599_0022609 Ga0495599_0022609_252_884 202
79 3300046679 Ga0495623_0003190 Ga0495623_0003190_9981_10613 202
80 3300046680 Ga0495646_0113321 Ga0495646_0113321_870_1502 202
81 3300047317 Ga0495604_0004930 Ga0495604_0004930_8868_9500 202
82 3300047319 Ga0495674_0014359 Ga0495674_0014359_216_848 202
83 3300047321 Ga0495676_0229096 Ga0495676_0229096_272_904 202
84 3300047322 Ga0495680_0049963 Ga0495680_0049963_1708_2340 202
85 3300047444 Ga0495675_0011418 Ga0495675_0011418_4790_5422 202
86 3300047471 Ga0495684_0004293 Ga0495684_0004293_10439_11071 202
87 3300048088 Ga0495602_0006759 Ga0495602_0006759_1256_1888 202
88 3300048907 Ga0496104_0000955 Ga0496104_0000955_15938_16570 202
89 3300048908 Ga0496105_0001292 Ga0496105_0001292_8194_8826 202
90 3300048918 Ga0496115_0103121 Ga0496115_0103121_1614_2246 202
91 3300053077 Ga0495601_0019342 Ga0495601_0019342_741_1373 202
92 3300053078 Ga0495612_0002989 Ga0495612_0002989_3697_4329 202
93 3300053084 Ga0495595_0000287 Ga0495595_0000287_13351_13983 202
94 3300053085 Ga0495619_0007250 Ga0495619_0007250_4813_5445 202
95 3300053139 Ga0500568_0109584 Ga0500568_0109584_308_997 202
96 3300006178 Ga0075367_10106405 Ga0075367_101064053 203
97 3300006195 Ga0075366_10015036 Ga0075366_100150366 203
98 3300006353 Ga0075370_10048120 Ga0075370_100481204 203
99 3300050493 nmdc:mga0k408_153462_c1 nmdc:mga0k408_153462_c1_345_1034 203
100 3300050496 nmdc:mga07m45_10104_c1 nmdc:mga07m45_10104_c1_470_1159 203
101 3300005937 Ga0081455_10161739 Ga0081455_101617392 204
102 3300036401 Ga0373937_0046721 Ga0373937_0046721_93_731 204
103 3300006038 Ga0075365_10347543 Ga0075365_103475431 205
104 3300037068 Ga0373925_0819720 Ga0373925_0819720_22_663 205
105 3300048917 Ga0496114_0294606 Ga0496114_0294606_131_811 205
106 3300050492 nmdc:mga0yw44_36490_c1 nmdc:mga0yw44_36490_c1_784_1452 205
107 3300013296 Ga0157374_10330293 Ga0157374_103302932 206
108 3300030760 Ga0265762_1032748 Ga0265762_10327481 206
109 3300005339 Ga0070660_100127779 Ga0070660_1001277791 207
110 3300005355 Ga0070671_100052240 Ga0070671_1000522402 207
111 3300005434 Ga0070709_10344284 Ga0070709_103442841 207
112 3300005455 Ga0070663_100062660 Ga0070663_1000626603 207
113 3300005564 Ga0070664_100084762 Ga0070664_1000847625 207
114 3300005618 Ga0068864_100085339 Ga0068864_1000853394 207
115 3300005842 Ga0068858_100160790 Ga0068858_1001607902 207
116 3300005843 Ga0068860_100276532 Ga0068860_1002765322 207
117 3300006042 Ga0075368_10136844 Ga0075368_101368442 207
118 3300006048 Ga0075363_100049026 Ga0075363_1000490261 207
119 3300009101 Ga0105247_10006181 Ga0105247_100061812 207
120 3300011119 Ga0105246_10040222 Ga0105246_100402222 207
121 3300013306 Ga0163162_10114190 Ga0163162_101141904 207
122 3300014325 Ga0163163_10021399 Ga0163163_100213995 207
123 3300014968 Ga0157379_10060926 Ga0157379_100609264 207
124 3300025299 Ga0209256_1022068 Ga0209256_10220682 207
125 3300025933 Ga0207706_10070104 Ga0207706_100701045 207
126 3300025945 Ga0207679_10092090 Ga0207679_100920903 207
127 3300026035 Ga0207703_10056119 Ga0207703_100561194 207
128 3300026067 Ga0207678_10030703 Ga0207678_100307034 207
129 3300026088 Ga0207641_10017320 Ga0207641_100173206 207
130 3300026095 Ga0207676_10633304 Ga0207676_106333042 207
131 3300027866 Ga0209813_10022792 Ga0209813_100227922 207
132 3300028379 Ga0268266_10195487 Ga0268266_101954873 207
133 3300028380 Ga0268265_10323540 Ga0268265_103235401 207
134 3300028381 Ga0268264_10236427 Ga0268264_102364272 207
135 3300046616 Ga0495668_0046435 Ga0495668_0046435_974_1666 207
136 3300046694 Ga0495649_0265546 Ga0495649_0265546_175_867 207
137 3300047443 Ga0495687_011883 Ga0495687_011883_2787_3479 207
138 3300048904 Ga0496101_0132478 Ga0496101_0132478_21_713 207
139 3300048905 Ga0496102_0234387 Ga0496102_0234387_42_734 207
140 3300048905 Ga0496102_0564762 Ga0496102_0564762_117_791 207
141 3300048907 Ga0496104_0084728 Ga0496104_0084728_154_828 207
142 3300048908 Ga0496105_0115424 Ga0496105_0115424_1145_1837 207
143 3300048908 Ga0496105_0378655 Ga0496105_0378655_349_1023 207
144 3300048909 Ga0496106_0047405 Ga0496106_0047405_83_757 207
145 3300048911 Ga0496108_0749010 Ga0496108_0749010_140_814 207
146 3300048912 Ga0496109_0042210 Ga0496109_0042210_1489_2181 207
147 3300048912 Ga0496109_0082129 Ga0496109_0082129_1669_2343 207
148 3300048914 Ga0496111_0032257 Ga0496111_0032257_226_900 207
149 3300048915 Ga0496112_0212933 Ga0496112_0212933_933_1607 207
150 3300048917 Ga0496114_0414327 Ga0496114_0414327_202_876 207
151 3300048924 Ga0496121_0370478 Ga0496121_0370478_39_731 207
152 3300053083 Ga0495655_0017966 Ga0495655_0017966_66_758 207
153 3300053086 Ga0500578_0209750 Ga0500578_0209750_275_967 207
154 3300005530 Ga0070679_100190615 Ga0070679_1001906153 208
155 3300005539 Ga0068853_100217202 Ga0068853_1002172022 208
156 3300005563 Ga0068855_100073747 Ga0068855_1000737472 208
157 3300005577 Ga0068857_100189935 Ga0068857_1001899352 208
158 3300005616 Ga0068852_100173372 Ga0068852_1001733723 208
159 3300025949 Ga0207667_10024554 Ga0207667_100245543 208
160 3300026041 Ga0207639_10262038 Ga0207639_102620382 208
161 3300026116 Ga0207674_10107865 Ga0207674_101078653 208
162 3300003761 Ga0055535_1000632 Ga0055535_10006327 209
163 3300003763 Ga0055529_1001056 Ga0055529_100105611 209
164 3300006944 Ga0099823_1009325 Ga0099823_10093253 209
165 3300013306 Ga0163162_10611474 Ga0163162_106114742 209
166 3300025242 Ga0209258_100453 Ga0209258_10045314 209
167 3300025256 Ga0209759_1001564 Ga0209759_10015647 209
168 3300025272 Ga0209455_1000157 Ga0209455_100015727 209
169 3300027296 Ga0209389_1004554 Ga0209389_10045549 209
170 3300046539 Ga0495621_0001598 Ga0495621_0001598_1670_2329 209
171 3300005436 Ga0070713_100240020 Ga0070713_1002400201 210
172 3300006175 Ga0070712_100331071 Ga0070712_1003310712 210
173 3300025928 Ga0207700_10143848 Ga0207700_101438482 210
174 3300025928 Ga0207700_10223431 Ga0207700_102234311 210
175 3300035116 Ga0373945_0012431 Ga0373945_0012431_1838_2497 210
176 3300035410 Ga0373924_0138213 Ga0373924_0138213_301_960 210
177 3300035692 Ga0373935_0089226 Ga0373935_0089226_122_778 210
178 3300037068 Ga0373925_0078607 Ga0373925_0078607_782_1438 210
179 3300037068 Ga0373925_0340550 Ga0373925_0340550_158_817 210
180 3300037853 Ga0436364_1556608 Ga0436364_1556608_136_804 210
181 3300046454 Ga0495592_0080596 Ga0495592_0080596_322_981 210
182 3300046459 Ga0495629_0028439 Ga0495629_0028439_2248_2907 210
183 3300046463 Ga0495653_0135065 Ga0495653_0135065_10_669 210
184 3300046476 Ga0495662_0007134 Ga0495662_0007134_3428_4087 210
185 3300046477 Ga0495664_0002872 Ga0495664_0002872_1385_2044 210
186 3300046514 Ga0495618_0005719 Ga0495618_0005719_1176_1835 210
187 3300046516 Ga0495628_0147976 Ga0495628_0147976_549_1205 210
188 3300046529 Ga0495652_0224146 Ga0495652_0224146_251_907 210
189 3300046642 Ga0495634_0027528 Ga0495634_0027528_353_1012 210
190 3300046663 Ga0495635_0004596 Ga0495635_0004596_1229_1888 210
191 3300047319 Ga0495674_0012602 Ga0495674_0012602_6050_6709 210
192 3300047471 Ga0495684_0036691 Ga0495684_0036691_1935_2594 210
193 3300053084 Ga0495595_0030593 Ga0495595_0030593_900_1556 210
194 3300053085 Ga0495619_0005220 Ga0495619_0005220_2793_3452 210
195 iso_pu_bacteria 2524023205 2524438286 210
196 3300047320 Ga0495672_0199708 Ga0495672_0199708_74_757 211
197 3300001990 JGI24737J22298_10077600 JGI24737J22298_100776001 212
198 3300005329 Ga0070683_100022631 Ga0070683_1000226316 212
199 3300005329 Ga0070683_101000072 Ga0070683_1010000721 212
200 3300005353 Ga0070669_100841028 Ga0070669_1008410281 212
201 3300005438 Ga0070701_10189070 Ga0070701_101890701 212
202 3300005439 Ga0070711_100157532 Ga0070711_1001575322 212
203 3300005441 Ga0070700_100037901 Ga0070700_1000379011 212
204 3300005444 Ga0070694_100144058 Ga0070694_1001440583 212
205 3300005457 Ga0070662_100019254 Ga0070662_1000192546 212
206 3300005459 Ga0068867_100167659 Ga0068867_1001676591 212
207 3300005466 Ga0070685_10016136 Ga0070685_100161364 212
208 3300005535 Ga0070684_100197377 Ga0070684_1001973772 212
209 3300005535 Ga0070684_100266843 Ga0070684_1002668432 212
210 3300005539 Ga0068853_100074542 Ga0068853_1000745422 212
211 3300005544 Ga0070686_100013967 Ga0070686_1000139677 212
212 3300005548 Ga0070665_100353289 Ga0070665_1003532892 212
213 3300005563 Ga0068855_101175326 Ga0068855_1011753261 212
214 3300005564 Ga0070664_100073397 Ga0070664_1000733975 212
215 3300005578 Ga0068854_100206404 Ga0068854_1002064042 212
216 3300005615 Ga0070702_100022253 Ga0070702_1000222535 212
217 3300005719 Ga0068861_100584760 Ga0068861_1005847602 212
218 3300005840 Ga0068870_10006351 Ga0068870_100063512 212
219 3300005843 Ga0068860_100711379 Ga0068860_1007113792 212
220 3300009101 Ga0105247_10015382 Ga0105247_100153821 212
221 3300009545 Ga0105237_10034852 Ga0105237_100348522 212
222 3300013306 Ga0163162_10294669 Ga0163162_102946691 212
223 3300014325 Ga0163163_10214256 Ga0163163_102142561 212
224 3300014745 Ga0157377_10304541 Ga0157377_103045411 212
225 3300014969 Ga0157376_10058961 Ga0157376_100589613 212
226 3300021361 Ga0213872_10023492 Ga0213872_100234921 212
227 3300025901 Ga0207688_10022635 Ga0207688_100226356 212
228 3300025904 Ga0207647_10209839 Ga0207647_102098391 212
229 3300025908 Ga0207643_10008573 Ga0207643_100085736 212
230 3300025932 Ga0207690_10173942 Ga0207690_101739421 212
231 3300025933 Ga0207706_10063556 Ga0207706_100635561 212
232 3300025937 Ga0207669_10141123 Ga0207669_101411231 212
233 3300025940 Ga0207691_10041676 Ga0207691_100416761 212
234 3300025941 Ga0207711_10157710 Ga0207711_101577101 212
235 3300025942 Ga0207689_10019815 Ga0207689_100198151 212
236 3300025944 Ga0207661_10002357 Ga0207661_100023578 212
237 3300025981 Ga0207640_10502993 Ga0207640_105029931 212
238 3300025986 Ga0207658_10369189 Ga0207658_103691891 212
239 3300026035 Ga0207703_10116701 Ga0207703_101167011 212
240 3300026078 Ga0207702_10066021 Ga0207702_100660216 212
241 3300026089 Ga0207648_10050996 Ga0207648_100509961 212
242 3300026118 Ga0207675_100012644 Ga0207675_1000126441 212
243 3300028379 Ga0268266_10369185 Ga0268266_103691852 212
244 3300028381 Ga0268264_10264664 Ga0268264_102646641 212
245 3300035089 Ga0373944_0000948 Ga0373944_0000948_6367_7032 212
246 3300035111 Ga0373923_0019383 Ga0373923_0019383_1440_2105 212
247 3300035113 Ga0373936_0034409 Ga0373936_0034409_401_1066 212
248 3300035170 Ga0373943_0000022 Ga0373943_0000022_7055_7720 212
249 3300035171 Ga0373946_0005813 Ga0373946_0005813_3059_3724 212
250 3300035692 Ga0373935_0004500 Ga0373935_0004500_528_1193 212
251 3300035695 Ga0373927_0000113 Ga0373927_0000113_11054_11719 212
252 3300035725 Ga0373947_0001403 Ga0373947_0001403_2794_3459 212
253 3300037068 Ga0373925_0001554 Ga0373925_0001554_9052_9717 212
254 3300039447 Ga0436361_0956991 Ga0436361_0956991_1371_2033 212
255 3300046459 Ga0495629_0030274 Ga0495629_0030274_2125_2790 212
256 3300046463 Ga0495653_0443910 Ga0495653_0443910_114_779 212
257 3300046472 Ga0495580_0206597 Ga0495580_0206597_440_1105 212
258 3300046475 Ga0495639_0036452 Ga0495639_0036452_136_801 212
259 3300046476 Ga0495662_0126348 Ga0495662_0126348_518_1183 212
260 3300046492 Ga0495585_0179113 Ga0495585_0179113_227_898 212
261 3300046514 Ga0495618_0173426 Ga0495618_0173426_346_1011 212
262 3300046517 Ga0495630_0002011 Ga0495630_0002011_6633_7298 212
263 3300046523 Ga0495644_0107231 Ga0495644_0107231_253_921 212
264 3300046525 Ga0495663_0070975 Ga0495663_0070975_225_893 212
265 3300046526 Ga0495666_0008360 Ga0495666_0008360_689_1354 212
266 3300046529 Ga0495652_0012755 Ga0495652_0012755_6821_7486 212
267 3300046616 Ga0495668_0292311 Ga0495668_0292311_115_783 212
268 3300046642 Ga0495634_0005170 Ga0495634_0005170_8863_9528 212
269 3300046642 Ga0495634_0054475 Ga0495634_0054475_1069_1734 212
270 3300046663 Ga0495635_0025067 Ga0495635_0025067_1155_1820 212
271 3300046684 Ga0495669_0199226 Ga0495669_0199226_147_815 212
272 3300046689 Ga0495613_0006467 Ga0495613_0006467_3618_4283 212
273 3300046690 Ga0495624_0004319 Ga0495624_0004319_2921_3586 212
274 3300047315 Ga0495581_0005578 Ga0495581_0005578_1998_2663 212
275 3300047471 Ga0495684_0000845 Ga0495684_0000845_14513_15178 212
276 3300047471 Ga0495684_0019817 Ga0495684_0019817_112_777 212
277 3300047673 Ga0495593_0013117 Ga0495593_0013117_2477_3142 212
278 3300048089 Ga0495614_0097718 Ga0495614_0097718_584_1249 212
279 3300048903 Ga0496100_0036651 Ga0496100_0036651_628_1296 212
280 3300048903 Ga0496100_0083141 Ga0496100_0083141_69_737 212
281 3300048904 Ga0496101_0371121 Ga0496101_0371121_19_687 212
282 3300048906 Ga0496103_0018740 Ga0496103_0018740_2045_2713 212
283 3300048907 Ga0496104_0000306 Ga0496104_0000306_1360_2028 212
284 3300048907 Ga0496104_0001512 Ga0496104_0001512_5471_6139 212
285 3300048907 Ga0496104_0157341 Ga0496104_0157341_121_789 212
286 3300048907 Ga0496104_0208069 Ga0496104_0208069_648_1316 212
287 3300048908 Ga0496105_0018693 Ga0496105_0018693_540_1208 212
288 3300048908 Ga0496105_0025818 Ga0496105_0025818_988_1656 212
289 3300048908 Ga0496105_0209217 Ga0496105_0209217_385_1053 212
290 3300048909 Ga0496106_0024820 Ga0496106_0024820_2443_3111 212
291 3300048909 Ga0496106_0086101 Ga0496106_0086101_1303_1971 212
292 3300048910 Ga0496107_0048889 Ga0496107_0048889_415_1083 212
293 3300048910 Ga0496107_0109391 Ga0496107_0109391_1254_1922 212
294 3300048911 Ga0496108_0122288 Ga0496108_0122288_672_1340 212
295 3300048913 Ga0496110_0298202 Ga0496110_0298202_181_849 212
296 3300048915 Ga0496112_0012515 Ga0496112_0012515_2172_2840 212
297 3300048915 Ga0496112_0262159 Ga0496112_0262159_737_1405 212
298 3300048916 Ga0496113_0412638 Ga0496113_0412638_170_838 212
299 3300048918 Ga0496115_0008348 Ga0496115_0008348_3658_4326 212
300 3300048918 Ga0496115_0052137 Ga0496115_0052137_642_1310 212
301 3300048918 Ga0496115_0118221 Ga0496115_0118221_1079_1747 212
302 3300053077 Ga0495601_0044713 Ga0495601_0044713_1793_2461 212
303 iso_pu_bacteria 2508501128 2509151853 212
304 3300024227 Ga0228598_1002348 Ga0228598_10023484 213
305 3300035117 Ga0373953_0014809 Ga0373953_0014809_619_1293 213
306 3300046454 Ga0495592_0083439 Ga0495592_0083439_786_1460 213
307 3300046463 Ga0495653_0164222 Ga0495653_0164222_389_1063 213
308 3300046477 Ga0495664_0353333 Ga0495664_0353333_17_691 213
309 3300046511 Ga0495608_0300899 Ga0495608_0300899_205_879 213
310 3300046514 Ga0495618_0182163 Ga0495618_0182163_78_752 213
311 3300046533 Ga0495640_0292782 Ga0495640_0292782_14_688 213
312 3300046559 Ga0495667_0017883 Ga0495667_0017883_2716_3390 213
313 3300046679 Ga0495623_0051910 Ga0495623_0051910_289_963 213
314 3300047318 Ga0495636_0005689 Ga0495636_0005689_3250_3915 213
315 3300047319 Ga0495674_0130122 Ga0495674_0130122_795_1469 213
316 3300047444 Ga0495675_0056881 Ga0495675_0056881_1419_2093 213
317 3300047471 Ga0495684_0133514 Ga0495684_0133514_607_1281 213
318 3300048088 Ga0495602_0159292 Ga0495602_0159292_205_879 213
319 3300053077 Ga0495601_0041050 Ga0495601_0041050_1143_1817 213
320 3300053084 Ga0495595_0294005 Ga0495595_0294005_126_800 213
321 3300053085 Ga0495619_0587309 Ga0495619_0587309_73_747 213
322 iso_pu_bacteria 2885409591 2885414173 213
323 3300005548 Ga0070665_100297729 Ga0070665_1002977291 214
324 3300005563 Ga0068855_100297368 Ga0068855_1002973683 214
325 3300009545 Ga0105237_10199931 Ga0105237_101999313 214
326 3300009551 Ga0105238_10080478 Ga0105238_100804785 214
327 3300010375 Ga0105239_10050077 Ga0105239_100500772 214
328 3300013105 Ga0157369_11053253 Ga0157369_110532532 214
329 3300013306 Ga0163162_10292964 Ga0163162_102929643 214
330 3300025924 Ga0207694_10150395 Ga0207694_101503953 214
331 3300025949 Ga0207667_10142328 Ga0207667_101423282 214
332 3300028379 Ga0268266_10121072 Ga0268266_101210724 214
333 3300035117 Ga0373953_0006693 Ga0373953_0006693_2104_2772 214
334 3300035119 Ga0373956_0017451 Ga0373956_0017451_1387_2055 214
335 3300035172 Ga0373955_0165501 Ga0373955_0165501_127_795 214
336 3300035724 Ga0373933_0044251 Ga0373933_0044251_807_1475 214
337 3300036401 Ga0373937_0046591 Ga0373937_0046591_3076_3744 214
338 3300048929 Ga0496126_0027851 Ga0496126_0027851_1231_1899 214
339 3300053080 Ga0500635_0023486 Ga0500635_0023486_158_832 214
340 3300053178 Ga0500637_0010767 Ga0500637_0010767_969_1643 214
341 3300005336 Ga0070680_100035397 Ga0070680_1000353974 215
342 3300005336 Ga0070680_100052054 Ga0070680_1000520542 215
343 3300005436 Ga0070713_100480628 Ga0070713_1004806282 215
344 3300005458 Ga0070681_10033224 Ga0070681_100332247 215
345 3300005539 Ga0068853_100380947 Ga0068853_1003809472 215
346 3300006048 Ga0075363_100141160 Ga0075363_1001411602 215
347 3300006173 Ga0070716_100327851 Ga0070716_1003278511 215
348 3300006177 Ga0075362_10080107 Ga0075362_100801073 215
349 3300006358 Ga0068871_100087758 Ga0068871_1000877582 215
350 3300009093 Ga0105240_10121453 Ga0105240_101214532 215
351 3300009174 Ga0105241_10358864 Ga0105241_103588641 215
352 3300009551 Ga0105238_10689923 Ga0105238_106899231 215
353 3300013105 Ga0157369_10003682 Ga0157369_100036825 215
354 3300021384 Ga0213876_10097017 Ga0213876_100970172 215
355 3300025906 Ga0207699_10006782 Ga0207699_100067824 215
356 3300025912 Ga0207707_10001362 Ga0207707_1000136220 215
357 3300025913 Ga0207695_10662784 Ga0207695_106627841 215
358 3300025917 Ga0207660_10021958 Ga0207660_100219584 215
359 3300025917 Ga0207660_10092594 Ga0207660_100925941 215
360 3300025921 Ga0207652_10157299 Ga0207652_101572994 215
361 3300025924 Ga0207694_10515340 Ga0207694_105153402 215
362 3300025939 Ga0207665_10472924 Ga0207665_104729242 215
363 3300025944 Ga0207661_10179682 Ga0207661_101796823 215
364 3300025949 Ga0207667_10719093 Ga0207667_107190931 215
365 3300026041 Ga0207639_10053071 Ga0207639_100530715 215
366 3300035083 Ga0373926_0024367 Ga0373926_0024367_257_928 215
367 3300035111 Ga0373923_0098524 Ga0373923_0098524_428_1099 215
368 3300035113 Ga0373936_0016160 Ga0373936_0016160_1558_2229 215
369 3300035116 Ga0373945_0094072 Ga0373945_0094072_233_904 215
370 3300035118 Ga0373954_0006983 Ga0373954_0006983_272_943 215
371 3300035120 Ga0373957_0097152 Ga0373957_0097152_366_1037 215
372 3300035171 Ga0373946_0005588 Ga0373946_0005588_2047_2718 215
373 3300035172 Ga0373955_0090574 Ga0373955_0090574_955_1626 215
374 3300035725 Ga0373947_0025025 Ga0373947_0025025_133_804 215
375 3300036401 Ga0373937_0143963 Ga0373937_0143963_265_936 215
376 3300037068 Ga0373925_0178283 Ga0373925_0178283_70_741 215
377 3300037068 Ga0373925_0460797 Ga0373925_0460797_143_814 215
378 3300039437 Ga0436365_1498030 Ga0436365_1498030_572_1258 215
379 3300046454 Ga0495592_0047069 Ga0495592_0047069_658_1329 215
380 3300046459 Ga0495629_0090673 Ga0495629_0090673_995_1666 215
381 3300046472 Ga0495580_0021704 Ga0495580_0021704_70_741 215
382 3300046475 Ga0495639_0007988 Ga0495639_0007988_3049_3720 215
383 3300046476 Ga0495662_0056954 Ga0495662_0056954_248_919 215
384 3300046477 Ga0495664_0044439 Ga0495664_0044439_831_1502 215
385 3300046499 Ga0495594_0262791 Ga0495594_0262791_56_727 215
386 3300046517 Ga0495630_0015505 Ga0495630_0015505_70_741 215
387 3300046529 Ga0495652_0319909 Ga0495652_0319909_299_970 215
388 3300046531 Ga0495665_0051806 Ga0495665_0051806_1233_1904 215
389 3300046533 Ga0495640_0006879 Ga0495640_0006879_3917_4588 215
390 3300046536 Ga0495587_0356734 Ga0495587_0356734_62_733 215
391 3300046559 Ga0495667_0268325 Ga0495667_0268325_373_1044 215
392 3300046642 Ga0495634_0054733 Ga0495634_0054733_257_928 215
393 3300046663 Ga0495635_0388286 Ga0495635_0388286_223_894 215
394 3300046680 Ga0495646_0029662 Ga0495646_0029662_2601_3272 215
395 3300046681 Ga0495647_0199036 Ga0495647_0199036_18_689 215
396 3300046683 Ga0495658_0021427 Ga0495658_0021427_1612_2283 215
397 3300047315 Ga0495581_0021230 Ga0495581_0021230_1869_2540 215
398 3300047321 Ga0495676_0143597 Ga0495676_0143597_40_711 215
399 3300047471 Ga0495684_0009757 Ga0495684_0009757_3948_4619 215
400 3300048905 Ga0496102_0171047 Ga0496102_0171047_638_1318 215
401 3300048912 Ga0496109_0134540 Ga0496109_0134540_957_1637 215
402 3300048918 Ga0496115_0506001 Ga0496115_0506001_233_913 215
403 3300050494 nmdc:mga06z11_170107_c1 nmdc:mga06z11_170107_c1_482_1159 215
404 3300050495 nmdc:mga04h51_93850_c1 nmdc:mga04h51_93850_c1_156_833 215
405 3300053077 Ga0495601_0054650 Ga0495601_0054650_371_1042 215
406 3300053078 Ga0495612_0039500 Ga0495612_0039500_794_1465 215
407 iso_pu_bacteria 2585428058 2587731777 215
408 3300007265 Ga0099794_10028156 Ga0099794_100281562 216
409 3300007788 Ga0099795_10005919 Ga0099795_100059193 216
410 3300010159 Ga0099796_10004310 Ga0099796_100043105 216
411 3300027512 Ga0209179_1027748 Ga0209179_10277481 216
412 3300002070 JGI24750J21931_1027100 JGI24750J21931_10271001 217
413 3300005331 Ga0070670_100088515 Ga0070670_1000885155 217
414 3300005337 Ga0070682_100366738 Ga0070682_1003667382 217
415 3300005338 Ga0068868_100009330 Ga0068868_1000093308 217
416 3300005340 Ga0070689_100017860 Ga0070689_1000178606 217
417 3300005354 Ga0070675_100032642 Ga0070675_1000326422 217
418 3300005364 Ga0070673_100548887 Ga0070673_1005488871 217
419 3300005367 Ga0070667_101013901 Ga0070667_1010139011 217
420 3300005439 Ga0070711_100310295 Ga0070711_1003102952 217
421 3300005456 Ga0070678_100441218 Ga0070678_1004412181 217
422 3300005545 Ga0070695_100540549 Ga0070695_1005405492 217
423 3300005616 Ga0068852_100355761 Ga0068852_1003557611 217
424 3300005618 Ga0068864_100017181 Ga0068864_1000171812 217
425 3300005841 Ga0068863_100286819 Ga0068863_1002868193 217
426 3300005842 Ga0068858_100078707 Ga0068858_1000787075 217
427 3300005844 Ga0068862_100122722 Ga0068862_1001227224 217
428 3300006881 Ga0068865_100035370 Ga0068865_1000353705 217
429 3300009094 Ga0111539_10170937 Ga0111539_101709374 217
430 3300009174 Ga0105241_10375668 Ga0105241_103756682 217
431 3300009545 Ga0105237_10198544 Ga0105237_101985443 217
432 3300013297 Ga0157378_10208180 Ga0157378_102081803 217
433 3300013308 Ga0157375_10180032 Ga0157375_101800323 217
434 3300014968 Ga0157379_10027154 Ga0157379_100271546 217
435 3300021377 Ga0213874_10003885 Ga0213874_100038852 217
436 3300025916 Ga0207663_10175817 Ga0207663_101758173 217
437 3300025924 Ga0207694_10038564 Ga0207694_100385642 217
438 3300025925 Ga0207650_10583267 Ga0207650_105832671 217
439 3300025926 Ga0207659_10050758 Ga0207659_100507582 217
440 3300025936 Ga0207670_10008187 Ga0207670_100081878 217
441 3300025938 Ga0207704_10192668 Ga0207704_101926682 217
442 3300025960 Ga0207651_10049604 Ga0207651_100496045 217
443 3300026067 Ga0207678_10025630 Ga0207678_100256305 217
444 3300026075 Ga0207708_10011723 Ga0207708_100117231 217
445 3300026088 Ga0207641_10297567 Ga0207641_102975671 217
446 3300026095 Ga0207676_10015307 Ga0207676_100153076 217
447 3300026116 Ga0207674_10057890 Ga0207674_100578902 217
448 3300026121 Ga0207683_10092022 Ga0207683_100920225 217
449 3300026142 Ga0207698_10487817 Ga0207698_104878172 217
450 3300031235 Ga0265330_10095027 Ga0265330_100950272 217
451 3300031241 Ga0265325_10008767 Ga0265325_100087676 217
452 3300031249 Ga0265339_10091937 Ga0265339_100919373 217
453 3300031344 Ga0265316_10236374 Ga0265316_102363742 217
454 3300031712 Ga0265342_10130218 Ga0265342_101302182 217
455 3300035170 Ga0373943_0138559 Ga0373943_0138559_529_1209 217
456 3300036401 Ga0373937_0339816 Ga0373937_0339816_533_1213 217
457 3300039450 Ga0436363_0098309 Ga0436363_0098309_8969_9658 217
458 3300045976 Ga0466967_0297512 Ga0466967_0297512_438_1115 217
459 3300046531 Ga0495665_0192218 Ga0495665_0192218_274_954 217
460 3300047319 Ga0495674_0372884 Ga0495674_0372884_296_976 217
461 3300047320 Ga0495672_0157625 Ga0495672_0157625_188_865 217
462 3300048904 Ga0496101_0024098 Ga0496101_0024098_1482_2165 217
463 3300048905 Ga0496102_0015623 Ga0496102_0015623_5337_6020 217
464 3300048909 Ga0496106_0121899 Ga0496106_0121899_295_978 217
465 3300048914 Ga0496111_0095564 Ga0496111_0095564_1183_1866 217
466 3300048916 Ga0496113_0012395 Ga0496113_0012395_2885_3568 217
467 3300048918 Ga0496115_0049563 Ga0496115_0049563_978_1655 217
468 3300048929 Ga0496126_0266241 Ga0496126_0266241_190_867 217
469 3300053077 Ga0495601_0279501 Ga0495601_0279501_86_766 217
470 3300006237 Ga0097621_100102300 Ga0097621_1001023002 218
471 3300006358 Ga0068871_100065584 Ga0068871_1000655842 218
472 3300009176 Ga0105242_10233439 Ga0105242_102334392 218
473 3300009177 Ga0105248_10238787 Ga0105248_102387874 218
474 3300013297 Ga0157378_10426650 Ga0157378_104266502 218
475 3300013308 Ga0157375_10703866 Ga0157375_107038661 218
476 3300014969 Ga0157376_10332288 Ga0157376_103322882 218
477 3300026089 Ga0207648_10213475 Ga0207648_102134753 218
478 3300028577 Ga0265318_10007275 Ga0265318_100072753 218
479 3300031240 Ga0265320_10011536 Ga0265320_100115365 218
480 3300031242 Ga0265329_10009771 Ga0265329_100097716 218
481 3300031247 Ga0265340_10002685 Ga0265340_100026853 218
482 3300031250 Ga0265331_10021931 Ga0265331_100219313 218
483 3300031711 Ga0265314_10043915 Ga0265314_100439153 218
484 3300031712 Ga0265342_10016076 Ga0265342_100160762 218
485 3300035241 Ga0373961_0045791 Ga0373961_0045791_62_745 218
486 3300035691 Ga0373931_0041070 Ga0373931_0041070_1208_1891 218
487 3300048905 Ga0496102_0821104 Ga0496102_0821104_120_803 218
488 3300048907 Ga0496104_0109519 Ga0496104_0109519_1380_2063 218
489 3300048918 Ga0496115_0411745 Ga0496115_0411745_64_747 218
490 3300025949 Ga0207667_10048182 Ga0207667_100481824 219
491 3300035086 Ga0373934_0038077 Ga0373934_0038077_467_1156 219
492 3300035089 Ga0373944_0185706 Ga0373944_0185706_46_735 219
493 3300035111 Ga0373923_0000023 Ga0373923_0000023_20536_21225 219
494 3300035113 Ga0373936_0000171 Ga0373936_0000171_13709_14398 219
495 3300035117 Ga0373953_0000572 Ga0373953_0000572_8482_9171 219
496 3300035118 Ga0373954_0002827 Ga0373954_0002827_3893_4582 219
497 3300035119 Ga0373956_0028006 Ga0373956_0028006_356_1045 219
498 3300035170 Ga0373943_0003257 Ga0373943_0003257_5121_5810 219
499 3300035171 Ga0373946_0000384 Ga0373946_0000384_6056_6745 219
500 3300035172 Ga0373955_0000031 Ga0373955_0000031_49134_49823 219
501 3300035410 Ga0373924_0003376 Ga0373924_0003376_3096_3785 219
502 3300035692 Ga0373935_0000461 Ga0373935_0000461_13642_14331 219
503 3300035695 Ga0373927_0020575 Ga0373927_0020575_2053_2742 219
504 3300035724 Ga0373933_0000638 Ga0373933_0000638_14610_15299 219
505 3300035725 Ga0373947_0000244 Ga0373947_0000244_4190_4879 219
506 3300036401 Ga0373937_0000098 Ga0373937_0000098_45077_45766 219
507 3300037068 Ga0373925_0000198 Ga0373925_0000198_49320_50009 219
508 3300046454 Ga0495592_0000119 Ga0495592_0000119_49317_50006 219
509 3300046459 Ga0495629_0003106 Ga0495629_0003106_4464_5153 219
510 3300046463 Ga0495653_0000030 Ga0495653_0000030_122305_122994 219
511 3300046476 Ga0495662_0001102 Ga0495662_0001102_10459_11148 219
512 3300046477 Ga0495664_0000003 Ga0495664_0000003_103369_104058 219
513 3300046511 Ga0495608_0000011 Ga0495608_0000011_49373_50062 219
514 3300046514 Ga0495618_0000025 Ga0495618_0000025_19675_20364 219
515 3300046516 Ga0495628_0000001 Ga0495628_0000001_592770_593459 219
516 3300046517 Ga0495630_0000551 Ga0495630_0000551_22113_22802 219
517 3300046529 Ga0495652_0000002 Ga0495652_0000002_807304_807993 219
518 3300046533 Ga0495640_0000002 Ga0495640_0000002_47633_48322 219
519 3300046536 Ga0495587_0000001 Ga0495587_0000001_120039_120728 219
520 3300046543 Ga0495645_0000002 Ga0495645_0000002_592783_593472 219
521 3300046559 Ga0495667_0000004 Ga0495667_0000004_19686_20375 219
522 3300046642 Ga0495634_0000010 Ga0495634_0000010_49023_49712 219
523 3300046663 Ga0495635_0000001 Ga0495635_0000001_105863_106552 219
524 3300046675 Ga0495657_0000369 Ga0495657_0000369_21318_22007 219
525 3300046678 Ga0495599_0000013 Ga0495599_0000013_58154_58843 219
526 3300046679 Ga0495623_0000024 Ga0495623_0000024_60912_61601 219
527 3300046680 Ga0495646_0000009 Ga0495646_0000009_120872_121561 219
528 3300046683 Ga0495658_0073899 Ga0495658_0073899_135_824 219
529 3300046690 Ga0495624_0011364 Ga0495624_0011364_1837_2526 219
530 3300046809 Ga0495600_0000071 Ga0495600_0000071_10160_10849 219
531 3300047315 Ga0495581_0105810 Ga0495581_0105810_397_1086 219
532 3300047317 Ga0495604_0000129 Ga0495604_0000129_58134_58823 219
533 3300047319 Ga0495674_0000002 Ga0495674_0000002_592771_593460 219
534 3300047322 Ga0495680_0000853 Ga0495680_0000853_15316_16005 219
535 3300047444 Ga0495675_0000274 Ga0495675_0000274_15783_16472 219
536 3300047471 Ga0495684_0000083 Ga0495684_0000083_49332_50021 219
537 3300047673 Ga0495593_0005774 Ga0495593_0005774_3720_4409 219
538 3300048088 Ga0495602_0000024 Ga0495602_0000024_95787_96476 219
539 3300048089 Ga0495614_0086625 Ga0495614_0086625_510_1199 219
540 3300053077 Ga0495601_0000001 Ga0495601_0000001_438867_439556 219
541 3300053078 Ga0495612_0000017 Ga0495612_0000017_30652_31341 219
542 3300053084 Ga0495595_0000010 Ga0495595_0000010_58130_58819 219
543 3300053085 Ga0495619_0000004 Ga0495619_0000004_438904_439593 219
544 3300005337 Ga0070682_100641447 Ga0070682_1006414471 222
545 3300005434 Ga0070709_10113573 Ga0070709_101135731 223
546 3300005435 Ga0070714_100061780 Ga0070714_1000617801 223
547 3300005436 Ga0070713_100020773 Ga0070713_1000207733 223
548 3300005437 Ga0070710_10166208 Ga0070710_101662082 223
549 3300005439 Ga0070711_100053755 Ga0070711_1000537552 223
550 3300005457 Ga0070662_100061679 Ga0070662_1000616792 223
551 3300005549 Ga0070704_100001307 Ga0070704_10000130715 223
552 3300006175 Ga0070712_100014863 Ga0070712_1000148633 223
553 3300025906 Ga0207699_10029671 Ga0207699_100296712 223
554 3300025915 Ga0207693_10030351 Ga0207693_100303516 223
555 3300048929 Ga0496126_0308291 Ga0496126_0308291_429_1127 223
556 2209111006 2214772973 2213792742 226
557 3300000041 ARcpr5oldR_c000172 ARcpr5oldR_0001727 226
558 3300000652 ARCol0yngRDRAFT_1000173 ARCol0yngRDRAFT_10001737 226
559 3300001990 JGI24737J22298_10002941 JGI24737J22298_100029414 226
560 3300002076 JGI24749J21850_1013718 JGI24749J21850_10137182 226
561 3300005290 Ga0065712_10131527 Ga0065712_101315272 226
562 3300005293 Ga0065715_10001277 Ga0065715_100012773 226
563 3300005328 Ga0070676_10139206 Ga0070676_101392062 226
564 3300005330 Ga0070690_100024004 Ga0070690_1000240045 226
565 3300005336 Ga0070680_100089806 Ga0070680_1000898064 226
566 3300005339 Ga0070660_100063259 Ga0070660_1000632593 226
567 3300005340 Ga0070689_100261158 Ga0070689_1002611581 226
568 3300005341 Ga0070691_10044288 Ga0070691_100442884 226
569 3300005345 Ga0070692_10007543 Ga0070692_100075435 226
570 3300005347 Ga0070668_100057388 Ga0070668_1000573884 226
571 3300005354 Ga0070675_100074917 Ga0070675_1000749173 226
572 3300005366 Ga0070659_100147296 Ga0070659_1001472963 226
573 3300005438 Ga0070701_10024994 Ga0070701_100249943 226
574 3300005444 Ga0070694_100186477 Ga0070694_1001864772 226
575 3300005445 Ga0070708_100229454 Ga0070708_1002294543 226
576 3300005455 Ga0070663_100041474 Ga0070663_1000414744 226
577 3300005457 Ga0070662_100217336 Ga0070662_1002173363 226
578 3300005458 Ga0070681_10122765 Ga0070681_101227653 226
579 3300005466 Ga0070685_10082168 Ga0070685_100821683 226
580 3300005530 Ga0070679_100040702 Ga0070679_1000407027 226
581 3300005544 Ga0070686_100031720 Ga0070686_1000317203 226
582 3300005545 Ga0070695_100061606 Ga0070695_1000616062 226
583 3300005563 Ga0068855_100463200 Ga0068855_1004632002 226
584 3300005564 Ga0070664_100286491 Ga0070664_1002864912 226
585 3300005577 Ga0068857_100152834 Ga0068857_1001528344 226
586 3300005615 Ga0070702_100373061 Ga0070702_1003730612 226
587 3300005617 Ga0068859_100138390 Ga0068859_1001383902 226
588 3300005843 Ga0068860_100016941 Ga0068860_1000169415 226
589 3300005844 Ga0068862_100187548 Ga0068862_1001875482 226
590 3300006871 Ga0075434_100110126 Ga0075434_1001101262 226
591 3300006881 Ga0068865_100026671 Ga0068865_1000266714 226
592 3300006931 Ga0097620_100138394 Ga0097620_1001383942 226
593 3300009094 Ga0111539_10012295 Ga0111539_100122956 226
594 3300009148 Ga0105243_10045733 Ga0105243_100457333 226
595 3300009545 Ga0105237_10043927 Ga0105237_100439274 226
596 3300009553 Ga0105249_10548460 Ga0105249_105484602 226
597 3300010375 Ga0105239_10035136 Ga0105239_100351366 226
598 3300011119 Ga0105246_10067085 Ga0105246_100670852 226
599 3300012508 Ga0157315_1001000 Ga0157315_10010002 226
600 3300012515 Ga0157338_1001700 Ga0157338_10017002 226
601 3300013102 Ga0157371_10283916 Ga0157371_102839161 226
602 3300013306 Ga0163162_10007555 Ga0163162_1000755514 226
603 3300013307 Ga0157372_10368308 Ga0157372_103683083 226
604 3300014326 Ga0157380_10194015 Ga0157380_101940152 226
605 3300014968 Ga0157379_10080253 Ga0157379_100802534 226
606 3300025271 Ga0207666_1001220 Ga0207666_10012203 226
607 3300025315 Ga0207697_10029415 Ga0207697_100294154 226
608 3300025885 Ga0207653_10024549 Ga0207653_100245492 226
609 3300025901 Ga0207688_10044743 Ga0207688_100447433 226
610 3300025903 Ga0207680_10099999 Ga0207680_100999994 226
611 3300025904 Ga0207647_10003322 Ga0207647_1000332211 226
612 3300025907 Ga0207645_10063226 Ga0207645_100632264 226
613 3300025912 Ga0207707_10160380 Ga0207707_101603804 226
614 3300025914 Ga0207671_10210241 Ga0207671_102102412 226
615 3300025918 Ga0207662_10019216 Ga0207662_100192163 226
616 3300025919 Ga0207657_10033148 Ga0207657_100331486 226
617 3300025921 Ga0207652_10037929 Ga0207652_100379292 226
618 3300025926 Ga0207659_10111117 Ga0207659_101111172 226
619 3300025933 Ga0207706_10006317 Ga0207706_100063175 226
620 3300025935 Ga0207709_10029796 Ga0207709_100297964 226
621 3300025940 Ga0207691_10009787 Ga0207691_100097873 226
622 3300025972 Ga0207668_10024716 Ga0207668_100247163 226
623 3300026035 Ga0207703_10096833 Ga0207703_100968332 226
624 3300026041 Ga0207639_10365579 Ga0207639_103655792 226
625 3300026067 Ga0207678_10061333 Ga0207678_100613332 226
626 3300026075 Ga0207708_10088911 Ga0207708_100889113 226
627 3300026089 Ga0207648_10050414 Ga0207648_100504143 226
628 3300026116 Ga0207674_10083576 Ga0207674_100835765 226
629 3300026118 Ga0207675_100056416 Ga0207675_1000564163 226
630 3300027695 Ga0209966_1000561 Ga0209966_10005615 226
631 3300027717 Ga0209998_10000337 Ga0209998_100003379 226
632 3300027907 Ga0207428_10000617 Ga0207428_1000061720 226
633 3300028380 Ga0268265_10635241 Ga0268265_106352412 226
634 3300028381 Ga0268264_10192887 Ga0268264_101928873 226
635 3300034816 Ga0373930_0000783 Ga0373930_0000783_2572_3276 226
636 3300034817 Ga0373948_0000589 Ga0373948_0000589_925_1629 226
637 3300034819 Ga0373958_0000380 Ga0373958_0000380_602_1306 226
638 3300034820 Ga0373959_0001298 Ga0373959_0001298_2170_2874 226
639 3300035084 Ga0373928_0000205 Ga0373928_0000205_659_1363 226
640 3300035085 Ga0373929_0005397 Ga0373929_0005397_1156_1860 226
641 3300035090 Ga0373949_0001679 Ga0373949_0001679_4811_5515 226
642 3300035092 Ga0373952_0021214 Ga0373952_0021214_269_973 226
643 3300035112 Ga0373932_0000746 Ga0373932_0000746_4203_4907 226
644 3300035114 Ga0373939_0000794 Ga0373939_0000794_6997_7701 226
645 3300035121 Ga0373960_0001070 Ga0373960_0001070_558_1262 226
646 3300035207 Ga0373942_0000880 Ga0373942_0000880_3574_4278 226
647 3300035241 Ga0373961_0002053 Ga0373961_0002053_4457_5161 226
648 3300035242 Ga0373962_0001576 Ga0373962_0001576_2843_3547 226
649 3300042876 Ga0451577_0260045 Ga0451577_0260045_128_832 226
650 3300045051 Ga0451576_0046866 Ga0451576_0046866_3276_3980 226
651 3300048909 Ga0496106_0018636 Ga0496106_0018636_1033_1737 226
652 3300048911 Ga0496108_0954121 Ga0496108_0954121_14_718 226
653 3300048915 Ga0496112_0295535 Ga0496112_0295535_846_1550 226
654 3300050511 nmdc:mga08y16_21947_c1 nmdc:mga08y16_21947_c1_2589_3293 226
655 3300050512 nmdc:mga0n895_133889_c1 nmdc:mga0n895_133889_c1_280_984 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00230

MIP

Major intrinsic protein

1

152

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rc2-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.866 5 207
7cjs-assembly2.cif.gz_E structure of aquaporin 0.8541 3 207
2d57-assembly1.cif.gz_A double layered 2d crystal structure of aquaporin-4 (aqp4m23) at 3.2 a resolution by electron crystallography 0.8534 6 208
3nk5-assembly2.cif.gz_B crystal structure of aqpz mutant f43w 0.8473 2 209
5i32-assembly1.cif.gz_A ammonia permeable aquaporin attip2;1 0.8374 5 204
ID Description Score Start End Superfamily
af_I1NH56_66_171_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9176 2 103 1.20.1080.10
af_A0A0P0WDK9_2_139_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9107 1 104 1.20.1080.10
af_A0A1D6J0S8_31_279_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.8639 1 207 1.20.1080.10
af_Q54WT8_4_294_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.856 4 209 1.20.1080.10
af_A0A1D6PLK2_10_163_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.8548 4 108 1.20.1080.10
ID Description Score Start End GO Terms
AF-A5PEN6-F1-model_v4 Uncharacterized protein 0.9875 1 162 GO:0005737
GO:0005886
GO:0012505
GO:0015250
GO:0043231
AF-A0A3C1B8D7-F1-model_v4 Aquaporin family protein 0.9872 3 168 GO:0015267
GO:0016020
AF-A0A531KW06-F1-model_v4 deleted 0.9835 3 158
AF-A0A525I976-F1-model_v4 Aquaporin family protein 0.9831 1 165 GO:0015267
GO:0016020
AF-A0A7K1ADQ2-F1-model_v4 Aquaporin family protein 0.9809 6 169 GO:0005886
GO:0015250

Feature Viewer

pLDDT pTM Quality
87.09 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map