F472775

General Info

Members Datasets Scaffolds Average Seq Length
653 282 1306 395

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100149861|Ga0307416_1001498612
Length 405
Sequence MATFAFSGRTRSGENVTGERIGDTMDAVVAALRREQIQVTKIQPAQAKAGAVAAARKLKPRGVPAKNLAVFTRQFSVMIDAGLPLVQCLDILGNQEEHKYFAQVILATRSDVEGGMSLAEAMKRHPKCFDGLFCNMIAAGEAGGILDTILKRLATYIEKAVKLKAQVKSAMIYPIAVITIACVVIGVILWKVIPTFASLFAGLGAELPLPTRIVIALSNNLVRFMPFIIVGIVGLGWAFKSYYATEKGRRVIDRITLKMPILGPILRKIAVARFCRTLSTLMASGVPILDGLDITAKTSGNAIIEDAIMTTRTSIERGETIAAPLKETGVFPGMVVQMIGVGEATGALDTMLGKIADFYEEEVDVAVEGLLTLLEPVMIAFLGGAVGGIVITMYMPIFDLISKLT

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
168 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
177 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
178 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
179 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
180 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
181 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
184 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
185 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
186 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
187 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
192 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
193 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
199 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
202 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
213 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
219 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
220 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
221 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
226 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
259 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
260 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
261 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
262 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
277 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
278 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
279 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.76
Nodule 0
Rhizoplane 0.61
Rhizosphere 96.48
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100149861 3300032002 Bacteria 2137
2 JGI24746J21847_1004554 3300001977 Bacteria 2184
3 Ga0065715_10002901 3300005293 Bacteria 4382
4 Ga0065715_10016067 3300005293 Bacteria 2426
5 Ga0065715_10096704 3300005293 Bacteria 3836
6 Ga0065715_10180756 3300005293 Bacteria 1454
7 Ga0070658_10097344 3300005327 Bacteria 2430
8 Ga0070676_10006026 3300005328 Bacteria 6472
9 Ga0070690_100004292 3300005330 Bacteria 7897
10 Ga0070690_100006300 3300005330 Bacteria 6729
11 Ga0070690_100020049 3300005330 Bacteria 4069
12 Ga0070670_100041008 3300005331 Bacteria 3978
13 Ga0070670_100282038 3300005331 Bacteria 1450
14 Ga0070677_10001620 3300005333 Bacteria 7120
15 Ga0070677_10036084 3300005333 Bacteria 1921
16 Ga0068869_100009550 3300005334 Bacteria 6298
17 Ga0070666_10009137 3300005335 Bacteria 6179
18 Ga0070666_10014769 3300005335 Bacteria 4976
19 Ga0070666_10115131 3300005335 Bacteria 1862
20 Ga0068868_100133778 3300005338 Bacteria 2031
21 Ga0070660_100019776 3300005339 Bacteria 4940
22 Ga0070689_100001814 3300005340 Bacteria 13733
23 Ga0070689_100035334 3300005340 Bacteria 3819
24 Ga0070691_10023885 3300005341 Bacteria 2839
25 Ga0070691_10041995 3300005341 Bacteria 2164
26 Ga0070687_100005406 3300005343 Bacteria 5166
27 Ga0070687_100007780 3300005343 Bacteria 4496
28 Ga0070661_100014667 3300005344 Bacteria 5525
29 Ga0070661_100071634 3300005344 Bacteria 2551
30 Ga0070692_10061993 3300005345 Bacteria 1972
31 Ga0070692_10064112 3300005345 Bacteria 1943
32 Ga0070668_100017400 3300005347 Bacteria 5385
33 Ga0070668_100052668 3300005347 Bacteria 3137
34 Ga0070669_100009397 3300005353 Bacteria 6962
35 Ga0070669_100012205 3300005353 Bacteria 6097
36 Ga0070675_100004405 3300005354 Bacteria 10739
37 Ga0070675_100019527 3300005354 Bacteria 5404
38 Ga0070671_100053639 3300005355 Bacteria 3351
39 Ga0070674_100008302 3300005356 Bacteria 6177
40 Ga0070673_100040033 3300005364 Bacteria 3593
41 Ga0070673_100108570 3300005364 Bacteria 2298
42 Ga0070673_100157978 3300005364 Bacteria 1926
43 Ga0070688_100016475 3300005365 Bacteria 4226
44 Ga0070688_100035747 3300005365 Bacteria 3019
45 Ga0070688_100083291 3300005365 Bacteria 2075
46 Ga0070659_100021622 3300005366 Bacteria 4903
47 Ga0070667_100015485 3300005367 Bacteria 6306
48 Ga0070667_100023860 3300005367 Bacteria 5079
49 Ga0070667_100025882 3300005367 Bacteria 4880
50 Ga0070667_100069830 3300005367 Bacteria 2990
51 Ga0070709_10024813 3300005434 Bacteria 3534
52 Ga0070714_100068631 3300005435 Bacteria 3059
53 Ga0070713_100222567 3300005436 Bacteria 1712
54 Ga0070701_10004437 3300005438 Bacteria 5684
55 Ga0070701_10010140 3300005438 Bacteria 4155
56 Ga0070701_10079899 3300005438 Bacteria 1768
57 Ga0070701_10101280 3300005438 Bacteria 1596
58 Ga0070705_100003878 3300005440 Bacteria 7313
59 Ga0070705_100006069 3300005440 Bacteria 5913
60 Ga0070700_100044153 3300005441 Bacteria 2744
61 Ga0070694_100031441 3300005444 Bacteria 3480
62 Ga0070694_100055432 3300005444 Bacteria 2688
63 Ga0070663_100022300 3300005455 Bacteria 4231
64 Ga0070678_100018881 3300005456 Bacteria 4478
65 Ga0070678_100035093 3300005456 Bacteria 3498
66 Ga0070662_100005323 3300005457 Bacteria 8221
67 Ga0070662_100093457 3300005457 Bacteria 2262
68 Ga0068867_100002364 3300005459 Bacteria 13271
69 Ga0068867_100006184 3300005459 Bacteria 8477
70 Ga0068867_100008712 3300005459 Bacteria 7163
71 Ga0068867_100028307 3300005459 Bacteria 4034
72 Ga0068867_100101557 3300005459 Bacteria 2197
73 Ga0070685_10000947 3300005466 Bacteria 15612
74 Ga0070706_100170575 3300005467 Bacteria 2032
75 Ga0070707_100138300 3300005468 Bacteria 2370
76 Ga0070707_100204127 3300005468 Bacteria 1927
77 Ga0070698_100014683 3300005471 Bacteria 8272
78 Ga0070698_100041238 3300005471 Bacteria 4739
79 Ga0070699_100110920 3300005518 Bacteria 2409
80 Ga0070699_100325146 3300005518 Bacteria 1383
81 Ga0070679_100158474 3300005530 Bacteria 2238
82 Ga0070684_100057701 3300005535 Bacteria 3390
83 Ga0070697_100103349 3300005536 Bacteria 2368
84 Ga0070672_100008411 3300005543 Bacteria 7054
85 Ga0070672_100020774 3300005543 Bacteria 4794
86 Ga0070672_100056469 3300005543 Bacteria 3079
87 Ga0070672_100078160 3300005543 Bacteria 2647
88 Ga0070672_100185127 3300005543 Bacteria 1736
89 Ga0070672_100194243 3300005543 Bacteria 1696
90 Ga0070686_100002001 3300005544 Bacteria 11301
91 Ga0070686_100002261 3300005544 Bacteria 10623
92 Ga0070695_100000939 3300005545 Bacteria 15776
93 Ga0070695_100001569 3300005545 Bacteria 12757
94 Ga0070695_100004855 3300005545 Bacteria 7914
95 Ga0070695_100039325 3300005545 Bacteria 2989
96 Ga0070696_100003733 3300005546 Bacteria 10169
97 Ga0070696_100008018 3300005546 Bacteria 7055
98 Ga0070665_100142524 3300005548 Bacteria 2400
99 Ga0070665_100280897 3300005548 Bacteria 1667
100 Ga0070704_100001081 3300005549 Bacteria 14115
101 Ga0070704_100001249 3300005549 Bacteria 13402
102 Ga0070704_100002895 3300005549 Bacteria 9742
103 Ga0070704_100027688 3300005549 Bacteria 3762
104 Ga0070704_100204301 3300005549 Bacteria 1597
105 Ga0070664_100002505 3300005564 Bacteria 14808
106 Ga0070664_100020286 3300005564 Bacteria 5472
107 Ga0068857_100021444 3300005577 Bacteria 5686
108 Ga0068857_100071500 3300005577 Bacteria 3091
109 Ga0068854_100009320 3300005578 Bacteria 6336
110 Ga0068854_100086191 3300005578 Bacteria 2327
111 Ga0070702_100003206 3300005615 Bacteria 7269
112 Ga0070702_100057576 3300005615 Bacteria 2249
113 Ga0070702_100109392 3300005615 Unclassified 1711
114 Ga0068859_100007632 3300005617 Bacteria 10990
115 Ga0068859_100015687 3300005617 Bacteria 7614
116 Ga0068859_100018612 3300005617 Bacteria 6982
117 Ga0068859_100018795 3300005617 Bacteria 6945
118 Ga0068859_100083102 3300005617 Bacteria 3245
119 Ga0068859_100295827 3300005617 Bacteria 1712
120 Ga0068864_100015511 3300005618 Bacteria 6334
121 Ga0068864_100025542 3300005618 Bacteria 4977
122 Ga0068864_100082145 3300005618 Bacteria 2827
123 Ga0068864_100169460 3300005618 Bacteria 1990
124 Ga0068866_10007473 3300005718 Bacteria 4576
125 Ga0068861_100009262 3300005719 Bacteria 6794
126 Ga0068870_10007540 3300005840 Bacteria 4856
127 Ga0068870_10007601 3300005840 Bacteria 4842
128 Ga0068863_100001998 3300005841 Bacteria 20231
129 Ga0068863_100010305 3300005841 Bacteria 9082
130 Ga0068863_100219506 3300005841 Bacteria 1831
131 Ga0068858_100001639 3300005842 Bacteria 22842
132 Ga0068858_100015731 3300005842 Bacteria 7115
133 Ga0068860_100008368 3300005843 Bacteria 10299
134 Ga0068860_100020384 3300005843 Bacteria 6422
135 Ga0068860_100033923 3300005843 Bacteria 4897
136 Ga0068862_100006212 3300005844 Bacteria 9950
137 Ga0068862_100006424 3300005844 Bacteria 9772
138 Ga0068862_100027540 3300005844 Bacteria 4784
139 Ga0068862_100230061 3300005844 Bacteria 1681
140 Ga0081455_10019601 3300005937 Bacteria 6391
141 Ga0081539_10015334 3300005985 Bacteria 5578
142 Ga0070717_10080638 3300006028 Bacteria 2731
143 Ga0075365_10045602 3300006038 Bacteria 2876
144 Ga0075368_10011434 3300006042 Bacteria 3229
145 Ga0075364_10009614 3300006051 Bacteria 5808
146 Ga0075362_10000720 3300006177 Bacteria 9771
147 Ga0075367_10006268 3300006178 Bacteria 5997
148 Ga0075367_10012340 3300006178 Bacteria 4553
149 Ga0075367_10061871 3300006178 Bacteria 2234
150 Ga0075366_10000975 3300006195 Bacteria 13989
151 Ga0097621_100000816 3300006237 Bacteria 21991
152 Ga0097621_100004056 3300006237 Bacteria 10159
153 Ga0097621_100028019 3300006237 Bacteria 4435
154 Ga0097621_100028697 3300006237 Bacteria 4388
155 Ga0097621_100039663 3300006237 Bacteria 3784
156 Ga0097621_100043876 3300006237 Bacteria 3606
157 Ga0097621_100049290 3300006237 Bacteria 3421
158 Ga0075370_10001377 3300006353 Bacteria 10487
159 Ga0068871_100001688 3300006358 Bacteria 14806
160 Ga0068871_100007344 3300006358 Bacteria 7863
161 Ga0068871_100021888 3300006358 Bacteria 4922
162 Ga0075428_100014879 3300006844 Bacteria 8644
163 Ga0075428_100029241 3300006844 Bacteria 6097
164 Ga0075428_100041021 3300006844 Bacteria 5091
165 Ga0075428_100045121 3300006844 Bacteria 4843
166 Ga0075428_100051990 3300006844 Bacteria 4493
167 Ga0075428_100220728 3300006844 Bacteria 2047
168 Ga0075428_100226598 3300006844 Bacteria 2017
169 Ga0075430_100002288 3300006846 Bacteria 15872
170 Ga0075430_100005120 3300006846 Bacteria 11034
171 Ga0075431_100002134 3300006847 Bacteria 18908
172 Ga0075431_100005695 3300006847 Bacteria 12313
173 Ga0075431_100011009 3300006847 Bacteria 9106
174 Ga0075433_10000724 3300006852 Bacteria 22572
175 Ga0075433_10010355 3300006852 Bacteria 7479
176 Ga0075433_10112286 3300006852 Bacteria 2417
177 Ga0075433_10125876 3300006852 Bacteria 2276
178 Ga0075434_100001728 3300006871 Bacteria 18751
179 Ga0075434_100002391 3300006871 Bacteria 16475
180 Ga0075434_100002460 3300006871 Bacteria 16304
181 Ga0075434_100115772 3300006871 Bacteria 2693
182 Ga0075434_100252485 3300006871 Bacteria 1783
183 Ga0075434_100294182 3300006871 Bacteria 1644
184 Ga0075429_100024661 3300006880 Bacteria 5220
185 Ga0075429_100043019 3300006880 Bacteria 3930
186 Ga0075429_100053486 3300006880 Bacteria 3513
187 Ga0075429_100083018 3300006880 Bacteria 2793
188 Ga0075429_100114601 3300006880 Bacteria 2356
189 Ga0068865_100041307 3300006881 Bacteria 3137
190 Ga0068865_100140611 3300006881 Bacteria 1819
191 Ga0075436_100043467 3300006914 Bacteria 3098
192 Ga0097620_100007632 3300006931 Bacteria 10990
193 Ga0097620_100015687 3300006931 Bacteria 7614
194 Ga0097620_100018612 3300006931 Bacteria 6982
195 Ga0097620_100018793 3300006931 Bacteria 6945
196 Ga0097620_100083101 3300006931 Bacteria 3245
197 Ga0097620_100295847 3300006931 Bacteria 1712
198 Ga0075435_100002378 3300007076 Bacteria 12474
199 Ga0075435_100003123 3300007076 Bacteria 11188
200 Ga0075435_100003382 3300007076 Bacteria 10820
201 Ga0075435_100009063 3300007076 Bacteria 7179
202 Ga0075435_100010749 3300007076 Bacteria 6704
203 Ga0111539_10000189 3300009094 Bacteria 72069
204 Ga0111539_10000566 3300009094 Bacteria 47366
205 Ga0111539_10004494 3300009094 Bacteria 18240
206 Ga0111539_10007533 3300009094 Bacteria 13925
207 Ga0111539_10009198 3300009094 Bacteria 12489
208 Ga0111539_10039935 3300009094 Bacteria 5651
209 Ga0111539_10071800 3300009094 Bacteria 4084
210 Ga0111539_10186939 3300009094 Bacteria 2419
211 Ga0111539_10203369 3300009094 Bacteria 2309
212 Ga0111539_10213914 3300009094 Bacteria 2246
213 Ga0105245_10070933 3300009098 Bacteria 3163
214 Ga0105247_10166532 3300009101 Bacteria 1463
215 Ga0114129_10003944 3300009147 Bacteria 20965
216 Ga0114129_10004580 3300009147 Bacteria 19501
217 Ga0114129_10005044 3300009147 Bacteria 18585
218 Ga0114129_10006925 3300009147 Bacteria 16126
219 Ga0114129_10011205 3300009147 Bacteria 12783
220 Ga0114129_10014887 3300009147 Bacteria 11081
221 Ga0114129_10020111 3300009147 Bacteria 9501
222 Ga0114129_10020344 3300009147 Bacteria 9441
223 Ga0114129_10031793 3300009147 Bacteria 7461
224 Ga0114129_10039238 3300009147 Bacteria 6676
225 Ga0114129_10042113 3300009147 Bacteria 6431
226 Ga0114129_10044481 3300009147 Bacteria 6246
227 Ga0114129_10062815 3300009147 Bacteria 5187
228 Ga0114129_10181234 3300009147 Bacteria 2865
229 Ga0114129_10428965 3300009147 Bacteria 1737
230 Ga0114129_10478131 3300009147 Bacteria 1630
231 Ga0105243_10067578 3300009148 Bacteria 2878
232 Ga0105242_10017485 3300009176 Bacteria 5590
233 Ga0105242_10037986 3300009176 Bacteria 3870
234 Ga0105242_10044472 3300009176 Bacteria 3597
235 Ga0105248_10029034 3300009177 Bacteria 6167
236 Ga0105248_10030373 3300009177 Bacteria 6033
237 Ga0105248_10057272 3300009177 Bacteria 4374
238 Ga0105248_10095693 3300009177 Bacteria 3343
239 Ga0105248_10214669 3300009177 Bacteria 2167
240 Ga0105248_10760216 3300009177 Bacteria 1094
241 Ga0105238_10005196 3300009551 Bacteria 12866
242 Ga0105249_10000685 3300009553 Bacteria 30822
243 Ga0105249_10058683 3300009553 Bacteria 3527
244 Ga0105249_10146714 3300009553 Bacteria 2268
245 Ga0105246_10017011 3300011119 Bacteria 4618
246 Ga0105246_10029767 3300011119 Bacteria 3599
247 Ga0105246_10072320 3300011119 Bacteria 2431
248 Ga0157374_10015128 3300013296 Bacteria 6765
249 Ga0157374_10029009 3300013296 Bacteria 5003
250 Ga0157378_10005256 3300013297 Bacteria 11374
251 Ga0157378_10137753 3300013297 Bacteria 2264
252 Ga0163162_10009473 3300013306 Bacteria 9469
253 Ga0163162_10041539 3300013306 Bacteria 4602
254 Ga0163162_10048775 3300013306 Bacteria 4243
255 Ga0163162_10060594 3300013306 Bacteria 3820
256 Ga0157375_10016273 3300013308 Bacteria 6674
257 Ga0163163_10020943 3300014325 Bacteria 6165
258 Ga0163163_10041994 3300014325 Bacteria 4476
259 Ga0163163_10173149 3300014325 Bacteria 2205
260 Ga0157380_10002936 3300014326 Bacteria 11594
261 Ga0157380_10011433 3300014326 Bacteria 6414
262 Ga0157380_10041108 3300014326 Bacteria 3606
263 Ga0157380_10053073 3300014326 Bacteria 3212
264 Ga0157377_10001705 3300014745 Bacteria 9590
265 Ga0157379_10004155 3300014968 Bacteria 12358
266 Ga0157379_10005484 3300014968 Bacteria 10887
267 Ga0157376_10041756 3300014969 Bacteria 3758
268 Ga0157376_10066832 3300014969 Bacteria 3040
269 Ga0163161_10016703 3300017792 Bacteria 5128
270 Ga0163161_10018589 3300017792 Bacteria 4869
271 Ga0207697_10004357 3300025315 Bacteria 6772
272 Ga0207656_10100617 3300025321 Bacteria 1325
273 Ga0207682_10001842 3300025893 Bacteria 9661
274 Ga0207692_10140774 3300025898 Bacteria 1372
275 Ga0207642_10071979 3300025899 Bacteria 1648
276 Ga0207688_10005119 3300025901 Bacteria 7120
277 Ga0207680_10015364 3300025903 Bacteria 3995
278 Ga0207680_10203958 3300025903 Bacteria 1349
279 Ga0207699_10009536 3300025906 Bacteria 4838
280 Ga0207645_10012805 3300025907 Bacteria 5680
281 Ga0207645_10027857 3300025907 Bacteria 3648
282 Ga0207645_10049187 3300025907 Bacteria 2692
283 Ga0207645_10049814 3300025907 Bacteria 2675
284 Ga0207645_10182032 3300025907 Bacteria 1379
285 Ga0207643_10008323 3300025908 Bacteria 5565
286 Ga0207643_10015578 3300025908 Bacteria 4139
287 Ga0207643_10105666 3300025908 Bacteria 1654
288 Ga0207705_10102084 3300025909 Bacteria 2111
289 Ga0207695_10107028 3300025913 Bacteria 2782
290 Ga0207663_10109641 3300025916 Bacteria 1871
291 Ga0207660_10147589 3300025917 Bacteria 1804
292 Ga0207662_10000721 3300025918 Bacteria 15090
293 Ga0207662_10005735 3300025918 Bacteria 6643
294 Ga0207662_10013873 3300025918 Bacteria 4510
295 Ga0207662_10028570 3300025918 Bacteria 3226
296 Ga0207657_10029732 3300025919 Bacteria 4968
297 Ga0207652_10033961 3300025921 Bacteria 4297
298 Ga0207646_10056377 3300025922 Bacteria 3512
299 Ga0207681_10002900 3300025923 Bacteria 10839
300 Ga0207681_10010765 3300025923 Bacteria 5615
301 Ga0207681_10038547 3300025923 Bacteria 3167
302 Ga0207694_10012766 3300025924 Bacteria 6329
303 Ga0207650_10009508 3300025925 Bacteria 6643
304 Ga0207659_10001496 3300025926 Bacteria 13924
305 Ga0207659_10001730 3300025926 Bacteria 12940
306 Ga0207659_10014751 3300025926 Bacteria 5049
307 Ga0207659_10017737 3300025926 Bacteria 4654
308 Ga0207659_10149754 3300025926 Bacteria 1821
309 Ga0207659_10284334 3300025926 Bacteria 1353
310 Ga0207687_10055957 3300025927 Bacteria 2765
311 Ga0207700_10045211 3300025928 Bacteria 3247
312 Ga0207664_10119806 3300025929 Bacteria 2201
313 Ga0207644_10033272 3300025931 Bacteria 3601
314 Ga0207690_10196694 3300025932 Bacteria 1528
315 Ga0207690_10267467 3300025932 Bacteria 1327
316 Ga0207706_10014543 3300025933 Bacteria 7131
317 Ga0207706_10021307 3300025933 Bacteria 5823
318 Ga0207706_10100942 3300025933 Bacteria 2538
319 Ga0207706_10133501 3300025933 Bacteria 2183
320 Ga0207686_10009918 3300025934 Bacteria 5176
321 Ga0207686_10071624 3300025934 Bacteria 2231
322 Ga0207686_10137935 3300025934 Bacteria 1682
323 Ga0207709_10055897 3300025935 Bacteria 2440
324 Ga0207670_10007081 3300025936 Bacteria 6244
325 Ga0207670_10007666 3300025936 Bacteria 6044
326 Ga0207670_10008108 3300025936 Bacteria 5911
327 Ga0207669_10023732 3300025937 Bacteria 3282
328 Ga0207704_10007221 3300025938 Bacteria 5231
329 Ga0207704_10028651 3300025938 Bacteria 3093
330 Ga0207691_10005912 3300025940 Bacteria 11816
331 Ga0207691_10037251 3300025940 Bacteria 4505
332 Ga0207691_10062509 3300025940 Bacteria 3378
333 Ga0207691_10116162 3300025940 Bacteria 2375
334 Ga0207691_10233822 3300025940 Bacteria 1591
335 Ga0207711_10017898 3300025941 Bacteria 5888
336 Ga0207711_10037795 3300025941 Bacteria 4103
337 Ga0207711_10209789 3300025941 Bacteria 1779
338 Ga0207711_10213609 3300025941 Bacteria 1762
339 Ga0207689_10001000 3300025942 Bacteria 27148
340 Ga0207689_10008370 3300025942 Bacteria 9006
341 Ga0207679_10013065 3300025945 Bacteria 5435
342 Ga0207679_10143990 3300025945 Bacteria 1930
343 Ga0207651_10002691 3300025960 Bacteria 8507
344 Ga0207651_10007647 3300025960 Bacteria 5770
345 Ga0207651_10034225 3300025960 Bacteria 3288
346 Ga0207651_10173649 3300025960 Bacteria 1702
347 Ga0207712_10007488 3300025961 Bacteria 6893
348 Ga0207712_10026337 3300025961 Bacteria 3872
349 Ga0207712_10034694 3300025961 Bacteria 3420
350 Ga0207712_10185357 3300025961 Bacteria 1638
351 Ga0207668_10023844 3300025972 Bacteria 3941
352 Ga0207668_10035666 3300025972 Bacteria 3314
353 Ga0207668_10100496 3300025972 Bacteria 2148
354 Ga0207640_10006546 3300025981 Bacteria 6395
355 Ga0207640_10050750 3300025981 Bacteria 2694
356 Ga0207658_10027777 3300025986 Bacteria 3979
357 Ga0207658_10057487 3300025986 Bacteria 2891
358 Ga0207658_10205109 3300025986 Bacteria 1648
359 Ga0207658_10292683 3300025986 Bacteria 1400
360 Ga0207703_10005589 3300026035 Bacteria 10093
361 Ga0207703_10010113 3300026035 Bacteria 7394
362 Ga0207703_10017308 3300026035 Bacteria 5626
363 Ga0207703_10043147 3300026035 Bacteria 3618
364 Ga0207678_10053192 3300026067 Bacteria 3490
365 Ga0207708_10002321 3300026075 Bacteria 13984
366 Ga0207708_10019721 3300026075 Bacteria 5085
367 Ga0207708_10143520 3300026075 Bacteria 1875
368 Ga0207708_10202781 3300026075 Bacteria 1583
369 Ga0207702_10023995 3300026078 Bacteria 5061
370 Ga0207641_10006077 3300026088 Bacteria 10223
371 Ga0207641_10012360 3300026088 Bacteria 7003
372 Ga0207648_10006899 3300026089 Bacteria 11251
373 Ga0207648_10014280 3300026089 Bacteria 7340
374 Ga0207648_10015683 3300026089 Bacteria 6954
375 Ga0207648_10051907 3300026089 Bacteria 3585
376 Ga0207648_10096863 3300026089 Bacteria 2582
377 Ga0207676_10037031 3300026095 Bacteria 3715
378 Ga0207676_10091751 3300026095 Bacteria 2496
379 Ga0207676_10097024 3300026095 Bacteria 2434
380 Ga0207676_10224755 3300026095 Bacteria 1674
381 Ga0207674_10040327 3300026116 Bacteria 4837
382 Ga0207674_10049855 3300026116 Bacteria 4279
383 Ga0207674_10094842 3300026116 Bacteria 2970
384 Ga0207674_10116766 3300026116 Bacteria 2639
385 Ga0207675_100016286 3300026118 Bacteria 6940
386 Ga0207675_100018418 3300026118 Bacteria 6511
387 Ga0207675_100025569 3300026118 Bacteria 5494
388 Ga0207675_100125603 3300026118 Bacteria 2430
389 Ga0207683_10024628 3300026121 Bacteria 5185
390 Ga0207683_10055977 3300026121 Bacteria 3458
391 Ga0207698_10103981 3300026142 Bacteria 2362
392 Ga0209813_10024294 3300027866 Bacteria 1732
393 Ga0207428_10000264 3300027907 Bacteria 71248
394 Ga0207428_10008900 3300027907 Bacteria 9043
395 Ga0207428_10010625 3300027907 Bacteria 8212
396 Ga0207428_10010903 3300027907 Bacteria 8089
397 Ga0207428_10065551 3300027907 Bacteria 2865
398 Ga0207428_10080365 3300027907 Bacteria 2547
399 Ga0207428_10098887 3300027907 Bacteria 2257
400 Ga0268266_10015571 3300028379 Bacteria 6519
401 Ga0268266_10036903 3300028379 Bacteria 4164
402 Ga0268266_10081866 3300028379 Bacteria 2815
403 Ga0268266_10115434 3300028379 Bacteria 2384
404 Ga0268265_10000772 3300028380 Bacteria 30842
405 Ga0268265_10005371 3300028380 Bacteria 8773
406 Ga0268264_10017891 3300028381 Bacteria 5799
407 Ga0268264_10023428 3300028381 Bacteria 5037
408 Ga0268264_10029635 3300028381 Bacteria 4484
409 Ga0268264_10196976 3300028381 Bacteria 1840
410 Ga0265338_10113580 3300028800 Bacteria 2176
411 Ga0265314_10123670 3300031711 Bacteria 1624
412 Ga0316576_10000582 3300031727 Bacteria 17387
413 Ga0316578_10001538 3300031728 Bacteria 9483
414 Ga0307405_10008775 3300031731 Bacteria 5145
415 Ga0307413_10012536 3300031824 Bacteria 4223
416 Ga0307413_10024852 3300031824 Bacteria 3273
417 Ga0307413_10050582 3300031824 Bacteria 2498
418 Ga0307410_10020027 3300031852 Bacteria 4084
419 Ga0307410_10020404 3300031852 Bacteria 4052
420 Ga0307410_10118935 3300031852 Bacteria 1924
421 Ga0307407_10001179 3300031903 Bacteria 9213
422 Ga0307407_10008240 3300031903 Bacteria 4773
423 Ga0307412_10006306 3300031911 Bacteria 6700
424 Ga0307409_100006639 3300031995 Bacteria 6826
425 Ga0307409_100013263 3300031995 Bacteria 5293
426 Ga0307416_100003040 3300032002 Bacteria 9808
427 Ga0307411_10020274 3300032005 Bacteria 3862
428 Ga0307411_10046704 3300032005 Bacteria 2794
429 Ga0307411_10057485 3300032005 Bacteria 2570
430 Ga0373948_0001331 3300034817 Bacteria 3389
431 Ga0373950_0000900 3300034818 Bacteria 3748
432 Ga0373958_0001067 3300034819 Bacteria 3596
433 Ga0373959_0000782 3300034820 Bacteria 5443
434 Ga0373938_0000435 3300034957 Bacteria 6766
435 Ga0373929_0000091 3300035085 Bacteria 15028
436 Ga0373940_0000980 3300035088 Bacteria 4871
437 Ga0373949_0001145 3300035090 Bacteria 7971
438 Ga0373951_0000106 3300035091 Bacteria 32539
439 Ga0373932_0000207 3300035112 Bacteria 17273
440 Ga0373939_0000485 3300035114 Bacteria 10034
441 Ga0373941_0000747 3300035115 Bacteria 6658
442 Ga0373945_0050631 3300035116 Bacteria 1527
443 Ga0373960_0001665 3300035121 Bacteria 4965
444 Ga0373960_0020787 3300035121 Bacteria 1739
445 Ga0373943_0009877 3300035170 Bacteria 4274
446 Ga0373942_0000820 3300035207 Bacteria 8581
447 Ga0373962_0000569 3300035242 Bacteria 8340
448 Ga0316574_0100933 3300035398 Bacteria 1847
449 Ga0373931_0002931 3300035691 Bacteria 7615
450 Ga0373931_0011842 3300035691 Bacteria 4218
451 Ga0373931_0243483 3300035691 Bacteria 1091
452 Ga0373935_0023027 3300035692 Bacteria 3825
453 Ga0373947_0006657 3300035725 Bacteria 6708
454 Ga0373937_0010250 3300036401 Bacteria 8179
455 Ga0373937_0092883 3300036401 Bacteria 2797
456 Ga0373937_0333323 3300036401 Bacteria 1436
457 Ga0316582_0118841 3300036647 Bacteria 1767
458 Ga0316584_0001675 3300036712 Bacteria 13540
459 Ga0373925_0010008 3300037068 Bacteria 6885
460 Ga0373925_0023196 3300037068 Bacteria 4528
461 Ga0373925_0307909 3300037068 Bacteria 1280
462 Ga0436363_1275687 3300039450 Bacteria 11699
463 Ga0439435_0005261 3300042436 Bacteria 2838
464 Ga0451577_0032543 3300042876 Bacteria 4698
465 Ga0451577_0036997 3300042876 Bacteria 4394
466 Ga0466963_0085727 3300044694 Bacteria 2139
467 Ga0453684_0024388 3300044712 Bacteria 8842
468 Ga0466968_0100007 3300044735 Bacteria 1294
469 Ga0451576_0029180 3300045051 Bacteria 5903
470 Ga0451576_0067814 3300045051 Bacteria 3713
471 Ga0495603_0045289 3300046455 Bacteria 2624
472 Ga0495629_0004708 3300046459 Bacteria 10229
473 Ga0495629_0114904 3300046459 Bacteria 1876
474 Ga0495638_0019716 3300046460 Bacteria 4459
475 Ga0495651_0213524 3300046462 Bacteria 1341
476 Ga0495584_0004662 3300046491 Bacteria 7347
477 Ga0495594_0020217 3300046499 Bacteria 3546
478 Ga0495608_0003598 3300046511 Bacteria 11120
479 Ga0495618_0088712 3300046514 Bacteria 1978
480 Ga0495628_0035300 3300046516 Bacteria 4019
481 Ga0495628_0127821 3300046516 Bacteria 1946
482 Ga0495630_0026218 3300046517 Bacteria 4314
483 Ga0495663_0009938 3300046525 Bacteria 2641
484 Ga0495642_0002696 3300046528 Bacteria 7136
485 Ga0495642_0117475 3300046528 Bacteria 1140
486 Ga0495598_0014355 3300046537 Bacteria 1980
487 Ga0495621_0000914 3300046539 Bacteria 7497
488 Ga0495645_0000912 3300046543 Bacteria 20131
489 Ga0495667_0024416 3300046559 Bacteria 4070
490 Ga0495634_0021987 3300046642 Bacteria 4499
491 Ga0495634_0034380 3300046642 Bacteria 3479
492 Ga0495634_0056812 3300046642 Bacteria 2614
493 Ga0495659_0006492 3300046664 Bacteria 3693
494 Ga0495659_0032599 3300046664 Bacteria 1824
495 Ga0495647_0079058 3300046681 Bacteria 1331
496 Ga0495658_0008634 3300046683 Bacteria 5056
497 Ga0495658_0025582 3300046683 Bacteria 3156
498 Ga0495658_0053423 3300046683 Bacteria 2295
499 Ga0495658_0088106 3300046683 Bacteria 1834
500 Ga0495669_0004613 3300046684 Bacteria 5707
501 Ga0495669_0005375 3300046684 Bacteria 5341
502 Ga0495613_0003167 3300046689 Bacteria 12321
503 Ga0495600_0119721 3300046809 Bacteria 1713
504 Ga0495672_0023608 3300047320 Bacteria 3978
505 Ga0495676_0037889 3300047321 Bacteria 4009
506 Ga0495680_0062816 3300047322 Bacteria 2854
507 Ga0495684_0000078 3300047471 Bacteria 66716
508 Ga0495684_0241852 3300047471 Bacteria 1316
509 Ga0496114_0002307 3300048917 Bacteria 14529
510 Ga0496114_0106938 3300048917 Bacteria 2394
511 Ga0496114_0365855 3300048917 Bacteria 1276
512 Ga0496115_0014486 3300048918 Bacteria 5970
513 Ga0501034_0005823 3300049571 Bacteria 13405
514 Ga0501036_0019312 3300049572 Bacteria 5720
515 Ga0501036_0038781 3300049572 Bacteria 4033
516 Ga0501036_0291747 3300049572 Bacteria 1364
517 Ga0501039_0009942 3300049575 Bacteria 7255
518 Ga0501039_0167559 3300049575 Bacteria 1727
519 Ga0501040_0007271 3300049576 Bacteria 7175
520 Ga0501040_0007336 3300049576 Bacteria 7141
521 Ga0501040_0186216 3300049576 Bacteria 1472
522 Ga0501041_0112220 3300049577 Bacteria 1691
523 Ga0501042_0023992 3300049578 Bacteria 4274
524 Ga0501042_0081270 3300049578 Bacteria 2322
525 Ga0501042_0093249 3300049578 Bacteria 2162
526 Ga0501043_0079524 3300049579 Bacteria 2576
527 Ga0501046_0006402 3300049580 Bacteria 10439
528 Ga0501046_0062535 3300049580 Bacteria 2908
529 Ga0501046_0073358 3300049580 Bacteria 2656
530 Ga0501068_0015662 3300049584 Bacteria 4359
531 Ga0501070_0172258 3300049586 Bacteria 1783
532 Ga0501071_0007895 3300049587 Bacteria 7017
533 Ga0501071_0015454 3300049587 Bacteria 5239
534 Ga0501072_0058460 3300049588 Bacteria 3039
535 Ga0501072_0090116 3300049588 Bacteria 2434
536 Ga0501072_0114602 3300049588 Bacteria 2146
537 Ga0501074_0071014 3300049590 Bacteria 2503
538 Ga0501075_0001434 3300049591 Bacteria 15504
539 Ga0501075_0078942 3300049591 Bacteria 2491
540 Ga0501075_0113584 3300049591 Bacteria 2059
541 Ga0501075_0236636 3300049591 Bacteria 1392
542 Ga0501076_0007165 3300049592 Bacteria 8107
543 Ga0501076_0031376 3300049592 Bacteria 4143
544 Ga0501077_0112994 3300049593 Bacteria 1722
545 Ga0501079_0006379 3300049741 Bacteria 8856
546 Ga0501081_0000734 3300049743 Bacteria 19101
547 Ga0501081_0019738 3300049743 Bacteria 4492
548 Ga0501035_0059289 3300049822 Bacteria 3409
549 Ga0501035_0186528 3300049822 Bacteria 1785
550 Ga0501035_0342328 3300049822 Bacteria 1253
551 Ga0501044_0001681 3300049823 Bacteria 25990
552 Ga0501045_0013807 3300049824 Bacteria 5712
553 Ga0501045_0067296 3300049824 Bacteria 2630
554 Ga0501045_0120751 3300049824 Bacteria 1946
555 Ga0501045_0126248 3300049824 Bacteria 1901
556 nmdc:mga03683_11986_c1 3300050489 Bacteria 3154
557 nmdc:mga00v17_12446_c1 3300050491 Bacteria 4696
558 nmdc:mga0k408_2851_c1 3300050493 Bacteria 7632
559 nmdc:mga0k408_6804_c1 3300050493 Bacteria 6096
560 nmdc:mga06z11_7841_c1 3300050494 Bacteria 4417
561 nmdc:mga06z11_84806_c1 3300050494 Bacteria 1708
562 nmdc:mga04h51_19455_c1 3300050495 Bacteria 2014
563 nmdc:mga07m45_5936_c1 3300050496 Bacteria 6129
564 nmdc:mga05p37_22763_c1 3300050507 Bacteria 7601
565 nmdc:mga05p37_265354_c1 3300050507 Bacteria 2053
566 nmdc:mga05p37_289291_c1 3300050507 Bacteria 1951
567 nmdc:mga05p37_290057_c1 3300050507 Bacteria 1948
568 nmdc:mga05p37_3006_c1 3300050507 Bacteria 19572
569 nmdc:mga05p37_3048_c1 3300050507 Bacteria 19460
570 nmdc:mga05p37_34326_c1 3300050507 Bacteria 6213
571 nmdc:mga05p37_4344_c1 3300050507 Bacteria 16546
572 nmdc:mga05p37_54125_c1 3300050507 Bacteria 4937
573 nmdc:mga05p37_54441_c1 3300050507 Bacteria 4923
574 nmdc:mga05p37_595_c2 3300050507 Bacteria 14519
575 nmdc:mga05p37_65_c1 3300050507 Bacteria 48888
576 nmdc:mga05p37_7088_c1 3300050507 Bacteria 13218
577 nmdc:mga05p37_71510_c1 3300050507 Bacteria 4268
578 nmdc:mga05p37_82172_c1 3300050507 Bacteria 3969
579 nmdc:mga05p37_93449_c1 3300050507 Bacteria 3706
580 nmdc:mga05p37_9821_c1 3300050507 Bacteria 11360
581 nmdc:mga05p37_9989_c1 3300050507 Bacteria 11270
582 nmdc:mga09592_103883_c1 3300050508 Bacteria 2435
583 nmdc:mga09592_1705_c1 3300050508 Bacteria 17709
584 nmdc:mga09592_176647_c1 3300050508 Bacteria 1847
585 nmdc:mga09592_187916_c1 3300050508 Bacteria 1788
586 nmdc:mga09592_197636_c1 3300050508 Bacteria 1741
587 nmdc:mga09592_29855_c1 3300050508 Bacteria 4534
588 nmdc:mga0qj67_13406_c1 3300050509 Bacteria 6184
589 nmdc:mga0qj67_164047_c1 3300050509 Bacteria 1804
590 nmdc:mga0qj67_1707_c1 3300050509 Bacteria 15485
591 nmdc:mga0qj67_28069_c1 3300050509 Bacteria 4366
592 nmdc:mga0qj67_3962_c1 3300050509 Bacteria 10716
593 nmdc:mga0qj67_60987_c1 3300050509 Bacteria 2994
594 nmdc:mga06r32_247393_c1 3300050510 Bacteria 1771
595 nmdc:mga06r32_28512_c1 3300050510 Bacteria 5226
596 nmdc:mga06r32_3088_c1 3300050510 Bacteria 14903
597 nmdc:mga06r32_3488_c1 3300050510 Bacteria 14036
598 nmdc:mga06r32_357623_c1 3300050510 Bacteria 1444
599 nmdc:mga06r32_94842_c1 3300050510 Bacteria 2920
600 nmdc:mga08y16_1131_c1 3300050511 Bacteria 26255
601 nmdc:mga08y16_15585_c1 3300050511 Bacteria 7993
602 nmdc:mga08y16_23477_c1 3300050511 Bacteria 6515
603 nmdc:mga08y16_261_c1 3300050511 Bacteria 47548
604 nmdc:mga08y16_312276_c1 3300050511 Bacteria 1619
605 nmdc:mga08y16_332641_c1 3300050511 Bacteria 1562
606 nmdc:mga08y16_41832_c1 3300050511 Bacteria 4800
607 nmdc:mga08y16_4611_c1 3300050511 Bacteria 14367
608 nmdc:mga08y16_55795_c1 3300050511 Bacteria 4129
609 nmdc:mga08y16_8023_c1 3300050511 Bacteria 11044
610 nmdc:mga08y16_97247_c1 3300050511 Bacteria 3066
611 nmdc:mga0n895_110689_c1 3300050512 Bacteria 2762
612 nmdc:mga0n895_15823_c1 3300050512 Bacteria 6897
613 nmdc:mga0n895_3447_c1 3300050512 Bacteria 12768
614 nmdc:mga0n895_349558_c1 3300050512 Bacteria 1497
615 nmdc:mga0n895_3640_c1 3300050512 Bacteria 12460
616 nmdc:mga0n895_6161_c1 3300050512 Bacteria 10138
617 nmdc:mga0n895_66628_c1 3300050512 Bacteria 3565
618 nmdc:mga0n895_87844_c1 3300050512 Bacteria 3107
619 nmdc:mga0n895_978_c1 3300050512 Bacteria 20699
620 nmdc:mga0rr50_10570_c1 3300050513 Bacteria 5864
621 nmdc:mga0rr50_120044_c1 3300050513 Bacteria 2091
622 nmdc:mga0rr50_152270_c1 3300050513 Bacteria 1870
623 nmdc:mga0rr50_25532_c1 3300050513 Bacteria 4109
624 nmdc:mga0rr50_273470_c1 3300050513 Unclassified 1408
625 nmdc:mga0rr50_3744_c1 3300050513 Bacteria 8814
626 nmdc:mga0rr50_45_c1 3300050513 Bacteria 74544
627 nmdc:mga0rr50_60486_c1 3300050513 Bacteria 2850
628 nmdc:mga08x19_74446_c1 3300050514 Bacteria 2219
629 nmdc:mga0a205_1288_c1 3300050515 Bacteria 21111
630 nmdc:mga0a205_169175_c1 3300050515 Bacteria 2081
631 nmdc:mga0a205_19779_c1 3300050515 Bacteria 6352
632 nmdc:mga0a205_26729_c1 3300050515 Bacteria 5506
633 nmdc:mga0a205_49852_c2 3300050515 Bacteria 3439
634 nmdc:mga0a205_73267_c1 3300050515 Bacteria 3309
635 Ga0495601_0013677 3300053077 Bacteria 4881
636 Ga0495595_0005579 3300053084 Bacteria 5094
637 Ga0495619_0012053 3300053085 Bacteria 5447
638 Ga0495619_0082096 3300053085 Bacteria 2172
639 Ga0501084_0004208 3300054114 Bacteria 11731
640 Ga0501084_0019919 3300054114 Bacteria 5592
641 Ga0501084_0021943 3300054114 Bacteria 5325
642 Ga0590071_000004 3300059421 Bacteria 63957
643 Ga0590074_000221 3300059423 Bacteria 7497
644 Ga0590075_000012 3300059424 Bacteria 55011
645 Ga0590075_000165 3300059424 Bacteria 18154
646 Ga0590077_000070 3300059426 Bacteria 25592
647 Ga0590077_000277 3300059426 Bacteria 14580
648 Ga0501082_0000274 3300060353 Bacteria 45495
649 Ga0501082_0094532 3300060353 Bacteria 2583
650 Ga0501082_0280235 3300060353 Bacteria 1451
651 Ga0530510_0001255 3300061734 Bacteria 16945
652 Ga0530510_0038821 3300061734 Bacteria 3439
653 Ga0530510_0187768 3300061734 Bacteria 1534
654 Ga0307416_100149861
655 JGI24746J21847_1004554
656 Ga0065715_10002901
657 Ga0065715_10016067
658 Ga0065715_10096704
659 Ga0065715_10180756
660 Ga0070658_10097344
661 Ga0070676_10006026
662 Ga0070690_100004292
663 Ga0070690_100006300
664 Ga0070690_100020049
665 Ga0070670_100041008
666 Ga0070670_100282038
667 Ga0070677_10001620
668 Ga0070677_10036084
669 Ga0068869_100009550
670 Ga0070666_10009137
671 Ga0070666_10014769
672 Ga0070666_10115131
673 Ga0068868_100133778
674 Ga0070660_100019776
675 Ga0070689_100001814
676 Ga0070689_100035334
677 Ga0070691_10023885
678 Ga0070691_10041995
679 Ga0070687_100005406
680 Ga0070687_100007780
681 Ga0070661_100014667
682 Ga0070661_100071634
683 Ga0070692_10061993
684 Ga0070692_10064112
685 Ga0070668_100017400
686 Ga0070668_100052668
687 Ga0070669_100009397
688 Ga0070669_100012205
689 Ga0070675_100004405
690 Ga0070675_100019527
691 Ga0070671_100053639
692 Ga0070674_100008302
693 Ga0070673_100040033
694 Ga0070673_100108570
695 Ga0070673_100157978
696 Ga0070688_100016475
697 Ga0070688_100035747
698 Ga0070688_100083291
699 Ga0070659_100021622
700 Ga0070667_100015485
701 Ga0070667_100023860
702 Ga0070667_100025882
703 Ga0070667_100069830
704 Ga0070709_10024813
705 Ga0070714_100068631
706 Ga0070713_100222567
707 Ga0070701_10004437
708 Ga0070701_10010140
709 Ga0070701_10079899
710 Ga0070701_10101280
711 Ga0070705_100003878
712 Ga0070705_100006069
713 Ga0070700_100044153
714 Ga0070694_100031441
715 Ga0070694_100055432
716 Ga0070663_100022300
717 Ga0070678_100018881
718 Ga0070678_100035093
719 Ga0070662_100005323
720 Ga0070662_100093457
721 Ga0068867_100002364
722 Ga0068867_100006184
723 Ga0068867_100008712
724 Ga0068867_100028307
725 Ga0068867_100101557
726 Ga0070685_10000947
727 Ga0070706_100170575
728 Ga0070707_100138300
729 Ga0070707_100204127
730 Ga0070698_100014683
731 Ga0070698_100041238
732 Ga0070699_100110920
733 Ga0070699_100325146
734 Ga0070679_100158474
735 Ga0070684_100057701
736 Ga0070697_100103349
737 Ga0070672_100008411
738 Ga0070672_100020774
739 Ga0070672_100056469
740 Ga0070672_100078160
741 Ga0070672_100185127
742 Ga0070672_100194243
743 Ga0070686_100002001
744 Ga0070686_100002261
745 Ga0070695_100000939
746 Ga0070695_100001569
747 Ga0070695_100004855
748 Ga0070695_100039325
749 Ga0070696_100003733
750 Ga0070696_100008018
751 Ga0070665_100142524
752 Ga0070665_100280897
753 Ga0070704_100001081
754 Ga0070704_100001249
755 Ga0070704_100002895
756 Ga0070704_100027688
757 Ga0070704_100204301
758 Ga0070664_100002505
759 Ga0070664_100020286
760 Ga0068857_100021444
761 Ga0068857_100071500
762 Ga0068854_100009320
763 Ga0068854_100086191
764 Ga0070702_100003206
765 Ga0070702_100057576
766 Ga0070702_100109392
767 Ga0068859_100007632
768 Ga0068859_100015687
769 Ga0068859_100018612
770 Ga0068859_100018795
771 Ga0068859_100083102
772 Ga0068859_100295827
773 Ga0068864_100015511
774 Ga0068864_100025542
775 Ga0068864_100082145
776 Ga0068864_100169460
777 Ga0068866_10007473
778 Ga0068861_100009262
779 Ga0068870_10007540
780 Ga0068870_10007601
781 Ga0068863_100001998
782 Ga0068863_100010305
783 Ga0068863_100219506
784 Ga0068858_100001639
785 Ga0068858_100015731
786 Ga0068860_100008368
787 Ga0068860_100020384
788 Ga0068860_100033923
789 Ga0068862_100006212
790 Ga0068862_100006424
791 Ga0068862_100027540
792 Ga0068862_100230061
793 Ga0081455_10019601
794 Ga0081539_10015334
795 Ga0070717_10080638
796 Ga0075365_10045602
797 Ga0075368_10011434
798 Ga0075364_10009614
799 Ga0075362_10000720
800 Ga0075367_10006268
801 Ga0075367_10012340
802 Ga0075367_10061871
803 Ga0075366_10000975
804 Ga0097621_100000816
805 Ga0097621_100004056
806 Ga0097621_100028019
807 Ga0097621_100028697
808 Ga0097621_100039663
809 Ga0097621_100043876
810 Ga0097621_100049290
811 Ga0075370_10001377
812 Ga0068871_100001688
813 Ga0068871_100007344
814 Ga0068871_100021888
815 Ga0075428_100014879
816 Ga0075428_100029241
817 Ga0075428_100041021
818 Ga0075428_100045121
819 Ga0075428_100051990
820 Ga0075428_100220728
821 Ga0075428_100226598
822 Ga0075430_100002288
823 Ga0075430_100005120
824 Ga0075431_100002134
825 Ga0075431_100005695
826 Ga0075431_100011009
827 Ga0075433_10000724
828 Ga0075433_10010355
829 Ga0075433_10112286
830 Ga0075433_10125876
831 Ga0075434_100001728
832 Ga0075434_100002391
833 Ga0075434_100002460
834 Ga0075434_100115772
835 Ga0075434_100252485
836 Ga0075434_100294182
837 Ga0075429_100024661
838 Ga0075429_100043019
839 Ga0075429_100053486
840 Ga0075429_100083018
841 Ga0075429_100114601
842 Ga0068865_100041307
843 Ga0068865_100140611
844 Ga0075436_100043467
845 Ga0097620_100007632
846 Ga0097620_100015687
847 Ga0097620_100018612
848 Ga0097620_100018793
849 Ga0097620_100083101
850 Ga0097620_100295847
851 Ga0075435_100002378
852 Ga0075435_100003123
853 Ga0075435_100003382
854 Ga0075435_100009063
855 Ga0075435_100010749
856 Ga0111539_10000189
857 Ga0111539_10000566
858 Ga0111539_10004494
859 Ga0111539_10007533
860 Ga0111539_10009198
861 Ga0111539_10039935
862 Ga0111539_10071800
863 Ga0111539_10186939
864 Ga0111539_10203369
865 Ga0111539_10213914
866 Ga0105245_10070933
867 Ga0105247_10166532
868 Ga0114129_10003944
869 Ga0114129_10004580
870 Ga0114129_10005044
871 Ga0114129_10006925
872 Ga0114129_10011205
873 Ga0114129_10014887
874 Ga0114129_10020111
875 Ga0114129_10020344
876 Ga0114129_10031793
877 Ga0114129_10039238
878 Ga0114129_10042113
879 Ga0114129_10044481
880 Ga0114129_10062815
881 Ga0114129_10181234
882 Ga0114129_10428965
883 Ga0114129_10478131
884 Ga0105243_10067578
885 Ga0105242_10017485
886 Ga0105242_10037986
887 Ga0105242_10044472
888 Ga0105248_10029034
889 Ga0105248_10030373
890 Ga0105248_10057272
891 Ga0105248_10095693
892 Ga0105248_10214669
893 Ga0105248_10760216
894 Ga0105238_10005196
895 Ga0105249_10000685
896 Ga0105249_10058683
897 Ga0105249_10146714
898 Ga0105246_10017011
899 Ga0105246_10029767
900 Ga0105246_10072320
901 Ga0157374_10015128
902 Ga0157374_10029009
903 Ga0157378_10005256
904 Ga0157378_10137753
905 Ga0163162_10009473
906 Ga0163162_10041539
907 Ga0163162_10048775
908 Ga0163162_10060594
909 Ga0157375_10016273
910 Ga0163163_10020943
911 Ga0163163_10041994
912 Ga0163163_10173149
913 Ga0157380_10002936
914 Ga0157380_10011433
915 Ga0157380_10041108
916 Ga0157380_10053073
917 Ga0157377_10001705
918 Ga0157379_10004155
919 Ga0157379_10005484
920 Ga0157376_10041756
921 Ga0157376_10066832
922 Ga0163161_10016703
923 Ga0163161_10018589
924 Ga0207697_10004357
925 Ga0207656_10100617
926 Ga0207682_10001842
927 Ga0207692_10140774
928 Ga0207642_10071979
929 Ga0207688_10005119
930 Ga0207680_10015364
931 Ga0207680_10203958
932 Ga0207699_10009536
933 Ga0207645_10012805
934 Ga0207645_10027857
935 Ga0207645_10049187
936 Ga0207645_10049814
937 Ga0207645_10182032
938 Ga0207643_10008323
939 Ga0207643_10015578
940 Ga0207643_10105666
941 Ga0207705_10102084
942 Ga0207695_10107028
943 Ga0207663_10109641
944 Ga0207660_10147589
945 Ga0207662_10000721
946 Ga0207662_10005735
947 Ga0207662_10013873
948 Ga0207662_10028570
949 Ga0207657_10029732
950 Ga0207652_10033961
951 Ga0207646_10056377
952 Ga0207681_10002900
953 Ga0207681_10010765
954 Ga0207681_10038547
955 Ga0207694_10012766
956 Ga0207650_10009508
957 Ga0207659_10001496
958 Ga0207659_10001730
959 Ga0207659_10014751
960 Ga0207659_10017737
961 Ga0207659_10149754
962 Ga0207659_10284334
963 Ga0207687_10055957
964 Ga0207700_10045211
965 Ga0207664_10119806
966 Ga0207644_10033272
967 Ga0207690_10196694
968 Ga0207690_10267467
969 Ga0207706_10014543
970 Ga0207706_10021307
971 Ga0207706_10100942
972 Ga0207706_10133501
973 Ga0207686_10009918
974 Ga0207686_10071624
975 Ga0207686_10137935
976 Ga0207709_10055897
977 Ga0207670_10007081
978 Ga0207670_10007666
979 Ga0207670_10008108
980 Ga0207669_10023732
981 Ga0207704_10007221
982 Ga0207704_10028651
983 Ga0207691_10005912
984 Ga0207691_10037251
985 Ga0207691_10062509
986 Ga0207691_10116162
987 Ga0207691_10233822
988 Ga0207711_10017898
989 Ga0207711_10037795
990 Ga0207711_10209789
991 Ga0207711_10213609
992 Ga0207689_10001000
993 Ga0207689_10008370
994 Ga0207679_10013065
995 Ga0207679_10143990
996 Ga0207651_10002691
997 Ga0207651_10007647
998 Ga0207651_10034225
999 Ga0207651_10173649
1000 Ga0207712_10007488
1001 Ga0207712_10026337
1002 Ga0207712_10034694
1003 Ga0207712_10185357
1004 Ga0207668_10023844
1005 Ga0207668_10035666
1006 Ga0207668_10100496
1007 Ga0207640_10006546
1008 Ga0207640_10050750
1009 Ga0207658_10027777
1010 Ga0207658_10057487
1011 Ga0207658_10205109
1012 Ga0207658_10292683
1013 Ga0207703_10005589
1014 Ga0207703_10010113
1015 Ga0207703_10017308
1016 Ga0207703_10043147
1017 Ga0207678_10053192
1018 Ga0207708_10002321
1019 Ga0207708_10019721
1020 Ga0207708_10143520
1021 Ga0207708_10202781
1022 Ga0207702_10023995
1023 Ga0207641_10006077
1024 Ga0207641_10012360
1025 Ga0207648_10006899
1026 Ga0207648_10014280
1027 Ga0207648_10015683
1028 Ga0207648_10051907
1029 Ga0207648_10096863
1030 Ga0207676_10037031
1031 Ga0207676_10091751
1032 Ga0207676_10097024
1033 Ga0207676_10224755
1034 Ga0207674_10040327
1035 Ga0207674_10049855
1036 Ga0207674_10094842
1037 Ga0207674_10116766
1038 Ga0207675_100016286
1039 Ga0207675_100018418
1040 Ga0207675_100025569
1041 Ga0207675_100125603
1042 Ga0207683_10024628
1043 Ga0207683_10055977
1044 Ga0207698_10103981
1045 Ga0209813_10024294
1046 Ga0207428_10000264
1047 Ga0207428_10008900
1048 Ga0207428_10010625
1049 Ga0207428_10010903
1050 Ga0207428_10065551
1051 Ga0207428_10080365
1052 Ga0207428_10098887
1053 Ga0268266_10015571
1054 Ga0268266_10036903
1055 Ga0268266_10081866
1056 Ga0268266_10115434
1057 Ga0268265_10000772
1058 Ga0268265_10005371
1059 Ga0268264_10017891
1060 Ga0268264_10023428
1061 Ga0268264_10029635
1062 Ga0268264_10196976
1063 Ga0265338_10113580
1064 Ga0265314_10123670
1065 Ga0316576_10000582
1066 Ga0316578_10001538
1067 Ga0307405_10008775
1068 Ga0307413_10012536
1069 Ga0307413_10024852
1070 Ga0307413_10050582
1071 Ga0307410_10020027
1072 Ga0307410_10020404
1073 Ga0307410_10118935
1074 Ga0307407_10001179
1075 Ga0307407_10008240
1076 Ga0307412_10006306
1077 Ga0307409_100006639
1078 Ga0307409_100013263
1079 Ga0307416_100003040
1080 Ga0307411_10020274
1081 Ga0307411_10046704
1082 Ga0307411_10057485
1083 Ga0373948_0001331
1084 Ga0373950_0000900
1085 Ga0373958_0001067
1086 Ga0373959_0000782
1087 Ga0373938_0000435
1088 Ga0373929_0000091
1089 Ga0373940_0000980
1090 Ga0373949_0001145
1091 Ga0373951_0000106
1092 Ga0373932_0000207
1093 Ga0373939_0000485
1094 Ga0373941_0000747
1095 Ga0373945_0050631
1096 Ga0373960_0001665
1097 Ga0373960_0020787
1098 Ga0373943_0009877
1099 Ga0373942_0000820
1100 Ga0373962_0000569
1101 Ga0316574_0100933
1102 Ga0373931_0002931
1103 Ga0373931_0011842
1104 Ga0373931_0243483
1105 Ga0373935_0023027
1106 Ga0373947_0006657
1107 Ga0373937_0010250
1108 Ga0373937_0092883
1109 Ga0373937_0333323
1110 Ga0316582_0118841
1111 Ga0316584_0001675
1112 Ga0373925_0010008
1113 Ga0373925_0023196
1114 Ga0373925_0307909
1115 Ga0436363_1275687
1116 Ga0439435_0005261
1117 Ga0451577_0032543
1118 Ga0451577_0036997
1119 Ga0466963_0085727
1120 Ga0453684_0024388
1121 Ga0466968_0100007
1122 Ga0451576_0029180
1123 Ga0451576_0067814
1124 Ga0495603_0045289
1125 Ga0495629_0004708
1126 Ga0495629_0114904
1127 Ga0495638_0019716
1128 Ga0495651_0213524
1129 Ga0495584_0004662
1130 Ga0495594_0020217
1131 Ga0495608_0003598
1132 Ga0495618_0088712
1133 Ga0495628_0035300
1134 Ga0495628_0127821
1135 Ga0495630_0026218
1136 Ga0495663_0009938
1137 Ga0495642_0002696
1138 Ga0495642_0117475
1139 Ga0495598_0014355
1140 Ga0495621_0000914
1141 Ga0495645_0000912
1142 Ga0495667_0024416
1143 Ga0495634_0021987
1144 Ga0495634_0034380
1145 Ga0495634_0056812
1146 Ga0495659_0006492
1147 Ga0495659_0032599
1148 Ga0495647_0079058
1149 Ga0495658_0008634
1150 Ga0495658_0025582
1151 Ga0495658_0053423
1152 Ga0495658_0088106
1153 Ga0495669_0004613
1154 Ga0495669_0005375
1155 Ga0495613_0003167
1156 Ga0495600_0119721
1157 Ga0495672_0023608
1158 Ga0495676_0037889
1159 Ga0495680_0062816
1160 Ga0495684_0000078
1161 Ga0495684_0241852
1162 Ga0496114_0002307
1163 Ga0496114_0106938
1164 Ga0496114_0365855
1165 Ga0496115_0014486
1166 Ga0501034_0005823
1167 Ga0501036_0019312
1168 Ga0501036_0038781
1169 Ga0501036_0291747
1170 Ga0501039_0009942
1171 Ga0501039_0167559
1172 Ga0501040_0007271
1173 Ga0501040_0007336
1174 Ga0501040_0186216
1175 Ga0501041_0112220
1176 Ga0501042_0023992
1177 Ga0501042_0081270
1178 Ga0501042_0093249
1179 Ga0501043_0079524
1180 Ga0501046_0006402
1181 Ga0501046_0062535
1182 Ga0501046_0073358
1183 Ga0501068_0015662
1184 Ga0501070_0172258
1185 Ga0501071_0007895
1186 Ga0501071_0015454
1187 Ga0501072_0058460
1188 Ga0501072_0090116
1189 Ga0501072_0114602
1190 Ga0501074_0071014
1191 Ga0501075_0001434
1192 Ga0501075_0078942
1193 Ga0501075_0113584
1194 Ga0501075_0236636
1195 Ga0501076_0007165
1196 Ga0501076_0031376
1197 Ga0501077_0112994
1198 Ga0501079_0006379
1199 Ga0501081_0000734
1200 Ga0501081_0019738
1201 Ga0501035_0059289
1202 Ga0501035_0186528
1203 Ga0501035_0342328
1204 Ga0501044_0001681
1205 Ga0501045_0013807
1206 Ga0501045_0067296
1207 Ga0501045_0120751
1208 Ga0501045_0126248
1209 nmdc:mga03683_11986_c1
1210 nmdc:mga00v17_12446_c1
1211 nmdc:mga0k408_2851_c1
1212 nmdc:mga0k408_6804_c1
1213 nmdc:mga06z11_7841_c1
1214 nmdc:mga06z11_84806_c1
1215 nmdc:mga04h51_19455_c1
1216 nmdc:mga07m45_5936_c1
1217 nmdc:mga05p37_22763_c1
1218 nmdc:mga05p37_265354_c1
1219 nmdc:mga05p37_289291_c1
1220 nmdc:mga05p37_290057_c1
1221 nmdc:mga05p37_3006_c1
1222 nmdc:mga05p37_3048_c1
1223 nmdc:mga05p37_34326_c1
1224 nmdc:mga05p37_4344_c1
1225 nmdc:mga05p37_54125_c1
1226 nmdc:mga05p37_54441_c1
1227 nmdc:mga05p37_595_c2
1228 nmdc:mga05p37_65_c1
1229 nmdc:mga05p37_7088_c1
1230 nmdc:mga05p37_71510_c1
1231 nmdc:mga05p37_82172_c1
1232 nmdc:mga05p37_93449_c1
1233 nmdc:mga05p37_9821_c1
1234 nmdc:mga05p37_9989_c1
1235 nmdc:mga09592_103883_c1
1236 nmdc:mga09592_1705_c1
1237 nmdc:mga09592_176647_c1
1238 nmdc:mga09592_187916_c1
1239 nmdc:mga09592_197636_c1
1240 nmdc:mga09592_29855_c1
1241 nmdc:mga0qj67_13406_c1
1242 nmdc:mga0qj67_164047_c1
1243 nmdc:mga0qj67_1707_c1
1244 nmdc:mga0qj67_28069_c1
1245 nmdc:mga0qj67_3962_c1
1246 nmdc:mga0qj67_60987_c1
1247 nmdc:mga06r32_247393_c1
1248 nmdc:mga06r32_28512_c1
1249 nmdc:mga06r32_3088_c1
1250 nmdc:mga06r32_3488_c1
1251 nmdc:mga06r32_357623_c1
1252 nmdc:mga06r32_94842_c1
1253 nmdc:mga08y16_1131_c1
1254 nmdc:mga08y16_15585_c1
1255 nmdc:mga08y16_23477_c1
1256 nmdc:mga08y16_261_c1
1257 nmdc:mga08y16_312276_c1
1258 nmdc:mga08y16_332641_c1
1259 nmdc:mga08y16_41832_c1
1260 nmdc:mga08y16_4611_c1
1261 nmdc:mga08y16_55795_c1
1262 nmdc:mga08y16_8023_c1
1263 nmdc:mga08y16_97247_c1
1264 nmdc:mga0n895_110689_c1
1265 nmdc:mga0n895_15823_c1
1266 nmdc:mga0n895_3447_c1
1267 nmdc:mga0n895_349558_c1
1268 nmdc:mga0n895_3640_c1
1269 nmdc:mga0n895_6161_c1
1270 nmdc:mga0n895_66628_c1
1271 nmdc:mga0n895_87844_c1
1272 nmdc:mga0n895_978_c1
1273 nmdc:mga0rr50_10570_c1
1274 nmdc:mga0rr50_120044_c1
1275 nmdc:mga0rr50_152270_c1
1276 nmdc:mga0rr50_25532_c1
1277 nmdc:mga0rr50_273470_c1
1278 nmdc:mga0rr50_3744_c1
1279 nmdc:mga0rr50_45_c1
1280 nmdc:mga0rr50_60486_c1
1281 nmdc:mga08x19_74446_c1
1282 nmdc:mga0a205_1288_c1
1283 nmdc:mga0a205_169175_c1
1284 nmdc:mga0a205_19779_c1
1285 nmdc:mga0a205_26729_c1
1286 nmdc:mga0a205_49852_c2
1287 nmdc:mga0a205_73267_c1
1288 Ga0495601_0013677
1289 Ga0495595_0005579
1290 Ga0495619_0012053
1291 Ga0495619_0082096
1292 Ga0501084_0004208
1293 Ga0501084_0019919
1294 Ga0501084_0021943
1295 Ga0590071_000004
1296 Ga0590074_000221
1297 Ga0590075_000012
1298 Ga0590075_000165
1299 Ga0590077_000070
1300 Ga0590077_000277
1301 Ga0501082_0000274
1302 Ga0501082_0094532
1303 Ga0501082_0280235
1304 Ga0530510_0001255
1305 Ga0530510_0038821
1306 Ga0530510_0187768

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

274

396

0.99

PF00482

T2SSF

Type II secretion system (T2SS), protein F

71

194

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.962 61 168
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.9595 59 166
2whn-assembly2.cif.gz_B n-terminal domain from the pilc type iv pilus biogenesis protein 0.9587 59 161
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.9582 61 166
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.9539 59 172
ID Description Score Start End Superfamily
af_P36646_1_51_3.10.20.10 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.9783 2 44 3.10.20.10
af_P41441_261_365_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9588 267 369 1.20.81.30
2whnB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9587 59 161 1.20.81.30
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9479 256 364 1.20.81.30
2whnB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9408 59 161 1.20.81.30
ID Description Score Start End GO Terms
AF-A0A7K0U3H3-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9754 58 156 GO:0005886
GO:0015628
AF-X1H9D7-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9436 85 307 GO:0005886
GO:0015628
AF-A0A3D0TQ32-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9429 117 399 GO:0005886
GO:0015628
AF-A0A0G1Q785-F1-model_v4 Type IV pilin 0.9412 81 402 GO:0005886
AF-A0A3M2EZZ2-F1-model_v4 Type II secretion system F family protein 0.9395 61 400 GO:0005886
GO:0015628

Map