F472741

General Info

Members Datasets Scaffolds Average Seq Length
653 295 1306 288

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100038101|Ga0070668_1000381012
Length 315
Sequence MMLPLPIAALAVVHPVAQVGWTSWTIHWSTVIGLAALGGLYLWGARRVQARAAAAGVDVPALRIGQRVAFFSGLLVTFASLNGPLHDLSDYYLFSAHMVQHLLLSLAVPPLLLVGTPGWLLRPLLEHRVIGSIARAITRPIRCFIIFNVVIAAWHLPPLYNTAMAHHSVHIVQHLTFMVASVLMWWPFLSPLPELPRLAYPGQMLYCFLMVIPMSIVAIYIAMADHVLYPAYSVAPRVWDITPMSDQQIGGLIMWVPGGLLFYVVMTFVFFKWAGRDTDTTAGAQVDWRPARPTRAPAPSARPPVTVRHDRSSSY

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
177 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
192 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
193 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
196 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
197 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
228 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
229 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
230 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
231 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
232 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
246 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
254 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
255 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
256 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
257 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
258 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
259 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
260 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
261 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
262 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
263 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
264 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
265 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
266 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
267 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
268 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
269 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
270 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
271 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
272 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
273 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
274 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
275 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
276 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
277 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
278 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
279 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
280 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
281 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
282 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
283 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
284 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
285 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
292 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.38
Rhizosphere 98.16
Stem 0
Stem Tuber 0
Unclassified 10.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100038101 3300005347 Bacteria 3673
2 Ga0058863_11945992 3300004799 Bacteria 4654
3 Ga0065712_10080903 3300005290 Bacteria 3058
4 Ga0065712_10090354 3300005290 Bacteria 2425
5 Ga0065712_10153364 3300005290 Unclassified 1347
6 Ga0070658_10013629 3300005327 Bacteria 6522
7 Ga0070658_10043655 3300005327 Bacteria 3621
8 Ga0070658_10080382 3300005327 Bacteria 2677
9 Ga0070676_10022903 3300005328 Bacteria 3506
10 Ga0070683_100002337 3300005329 Bacteria 15043
11 Ga0070683_100002363 3300005329 Bacteria 14985
12 Ga0070683_100017761 3300005329 Bacteria 6285
13 Ga0070683_100056977 3300005329 Bacteria 3630
14 Ga0070683_100071622 3300005329 Bacteria 3234
15 Ga0070683_100107207 3300005329 Bacteria 2634
16 Ga0070683_100125360 3300005329 Bacteria 2428
17 Ga0070683_100673925 3300005329 Bacteria 990
18 Ga0070690_100024257 3300005330 Bacteria 3728
19 Ga0070690_100263721 3300005330 Bacteria 1223
20 Ga0070670_100002906 3300005331 Bacteria 14177
21 Ga0070670_100041179 3300005331 Bacteria 3970
22 Ga0070670_100289259 3300005331 Unclassified 1432
23 Ga0070670_100291761 3300005331 Bacteria 1425
24 Ga0070677_10011082 3300005333 Bacteria 3099
25 Ga0070677_10205140 3300005333 Bacteria 954
26 Ga0068869_100002687 3300005334 Bacteria 10760
27 Ga0070680_100000549 3300005336 Bacteria 25684
28 Ga0070680_100005387 3300005336 Bacteria 9685
29 Ga0070680_100069443 3300005336 Bacteria 2893
30 Ga0070680_100092556 3300005336 Bacteria 2503
31 Ga0070680_100200029 3300005336 Bacteria 1685
32 Ga0070682_100042028 3300005337 Bacteria 2820
33 Ga0068868_100035257 3300005338 Bacteria 3867
34 Ga0068868_100041434 3300005338 Bacteria 3587
35 Ga0068868_100060284 3300005338 Bacteria 3004
36 Ga0068868_100210213 3300005338 Bacteria 1626
37 Ga0070660_100008612 3300005339 Bacteria 7140
38 Ga0070660_100027702 3300005339 Bacteria 4231
39 Ga0070660_100090956 3300005339 Bacteria 2407
40 Ga0070660_100311124 3300005339 Unclassified 1292
41 Ga0070689_100003049 3300005340 Bacteria 11034
42 Ga0070689_100138818 3300005340 Unclassified 1953
43 Ga0070689_100364673 3300005340 Unclassified 1214
44 Ga0070691_10000508 3300005341 Bacteria 14633
45 Ga0070687_100004161 3300005343 Bacteria 5729
46 Ga0070687_100022578 3300005343 Bacteria 2978
47 Ga0070687_100032882 3300005343 Bacteria 2556
48 Ga0070687_100117518 3300005343 Unclassified 1515
49 Ga0070661_100001095 3300005344 Bacteria 19154
50 Ga0070661_100004491 3300005344 Bacteria 9616
51 Ga0070661_100069284 3300005344 Bacteria 2593
52 Ga0070661_100098345 3300005344 Bacteria 2174
53 Ga0070661_100135571 3300005344 Unclassified 1852
54 Ga0070661_100204296 3300005344 Unclassified 1510
55 Ga0070692_10095444 3300005345 Bacteria 1623
56 Ga0070668_100001458 3300005347 Bacteria 17089
57 Ga0070668_100100688 3300005347 Bacteria 2289
58 Ga0070668_100480362 3300005347 Bacteria 1073
59 Ga0070669_100003656 3300005353 Bacteria 11091
60 Ga0070669_100007548 3300005353 Bacteria 7786
61 Ga0070669_100019239 3300005353 Bacteria 4877
62 Ga0070669_100050059 3300005353 Bacteria 3051
63 Ga0070669_100157831 3300005353 Bacteria 1760
64 Ga0070669_100203747 3300005353 Unclassified 1558
65 Ga0070675_100044715 3300005354 Bacteria 3621
66 Ga0070675_100069949 3300005354 Bacteria 2908
67 Ga0070675_100078993 3300005354 Bacteria 2741
68 Ga0070675_100271642 3300005354 Bacteria 1488
69 Ga0070671_100117177 3300005355 Bacteria 2239
70 Ga0070671_100141308 3300005355 Bacteria 2032
71 Ga0070671_100337028 3300005355 Bacteria 1286
72 Ga0070674_100132456 3300005356 Bacteria 1860
73 Ga0070674_100175733 3300005356 Bacteria 1636
74 Ga0070674_100185182 3300005356 Bacteria 1598
75 Ga0070673_100031093 3300005364 Bacteria 4003
76 Ga0070673_100047116 3300005364 Bacteria 3352
77 Ga0070673_100204873 3300005364 Bacteria 1700
78 Ga0070673_100329766 3300005364 Bacteria 1350
79 Ga0070673_100510274 3300005364 Unclassified 1088
80 Ga0070688_100000737 3300005365 Bacteria 16121
81 Ga0070688_100011070 3300005365 Bacteria 5004
82 Ga0070688_100116764 3300005365 Bacteria 1782
83 Ga0070659_100010466 3300005366 Bacteria 6823
84 Ga0070659_100015836 3300005366 Bacteria 5654
85 Ga0070659_100224704 3300005366 Bacteria 1551
86 Ga0070659_100265824 3300005366 Bacteria 1424
87 Ga0070659_100384301 3300005366 Bacteria 1183
88 Ga0070667_100015449 3300005367 Bacteria 6313
89 Ga0070667_100016113 3300005367 Bacteria 6183
90 Ga0070709_10095385 3300005434 Unclassified 1970
91 Ga0070714_100003646 3300005435 Bacteria 11531
92 Ga0070714_100046269 3300005435 Bacteria 3690
93 Ga0070714_100102056 3300005435 Bacteria 2528
94 Ga0070714_100314381 3300005435 Bacteria 1463
95 Ga0070713_100007659 3300005436 Bacteria 7599
96 Ga0070711_100049053 3300005439 Bacteria 2890
97 Ga0070705_100075812 3300005440 Bacteria 2049
98 Ga0070700_100128169 3300005441 Unclassified 1709
99 Ga0070694_100209157 3300005444 Unclassified 1458
100 Ga0070708_100000113 3300005445 Bacteria 53689
101 Ga0070663_100027765 3300005455 Bacteria 3846
102 Ga0070662_100018732 3300005457 Bacteria 4688
103 Ga0070662_100043851 3300005457 Bacteria 3202
104 Ga0070662_100098445 3300005457 Bacteria 2209
105 Ga0070681_10000861 3300005458 Bacteria 25522
106 Ga0070681_10002680 3300005458 Bacteria 16358
107 Ga0070681_10084382 3300005458 Bacteria 3129
108 Ga0070681_10111194 3300005458 Bacteria 2679
109 Ga0070681_10239977 3300005458 Bacteria 1726
110 Ga0068867_100052911 3300005459 Bacteria 2997
111 Ga0068867_100176101 3300005459 Bacteria 1697
112 Ga0070685_10011674 3300005466 Bacteria 4602
113 Ga0070685_10110840 3300005466 Bacteria 1690
114 Ga0070707_100246505 3300005468 Bacteria 1738
115 Ga0070698_100023703 3300005471 Bacteria 6412
116 Ga0070698_100172846 3300005471 Unclassified 2101
117 Ga0070699_100012954 3300005518 Bacteria 7188
118 Ga0070699_100055866 3300005518 Bacteria 3418
119 Ga0070699_100080203 3300005518 Unclassified 2844
120 Ga0070679_100001591 3300005530 Bacteria 20383
121 Ga0070679_100001943 3300005530 Bacteria 18571
122 Ga0070679_100003776 3300005530 Bacteria 13901
123 Ga0070679_100018653 3300005530 Bacteria 6735
124 Ga0070679_100136644 3300005530 Bacteria 2432
125 Ga0070679_100184700 3300005530 Bacteria 2057
126 Ga0070679_100214502 3300005530 Bacteria 1887
127 Ga0070679_100232187 3300005530 Unclassified 1804
128 Ga0070679_100408522 3300005530 Bacteria 1303
129 Ga0070679_100518031 3300005530 Bacteria 1136
130 Ga0070684_100001622 3300005535 Bacteria 16280
131 Ga0070684_100011747 3300005535 Bacteria 6985
132 Ga0070684_100018823 3300005535 Bacteria 5698
133 Ga0070684_100028041 3300005535 Bacteria 4760
134 Ga0070684_100032199 3300005535 Bacteria 4467
135 Ga0070684_100034279 3300005535 Bacteria 4340
136 Ga0070684_100039542 3300005535 Bacteria 4058
137 Ga0070684_100039578 3300005535 Bacteria 4056
138 Ga0070684_100052197 3300005535 Bacteria 3555
139 Ga0070684_100079454 3300005535 Bacteria 2900
140 Ga0070684_100081461 3300005535 Bacteria 2864
141 Ga0070684_100142213 3300005535 Bacteria 2170
142 Ga0070684_100302522 3300005535 Bacteria 1468
143 Ga0070684_100487840 3300005535 Bacteria 1141
144 Ga0068853_100251587 3300005539 Bacteria 1621
145 Ga0070672_100040929 3300005543 Bacteria 3559
146 Ga0070672_100095099 3300005543 Bacteria 2409
147 Ga0070672_100308895 3300005543 Bacteria 1342
148 Ga0070672_100534483 3300005543 Bacteria 1017
149 Ga0070696_100154584 3300005546 Bacteria 1686
150 Ga0070665_100053419 3300005548 Bacteria 4052
151 Ga0070665_100099342 3300005548 Bacteria 2914
152 Ga0070665_100491364 3300005548 Unclassified 1238
153 Ga0068855_100003991 3300005563 Bacteria 18026
154 Ga0068855_100041600 3300005563 Bacteria 5446
155 Ga0068855_100058648 3300005563 Bacteria 4507
156 Ga0068855_100081414 3300005563 Unclassified 3753
157 Ga0068855_100351062 3300005563 Unclassified 1625
158 Ga0070664_100002366 3300005564 Bacteria 15153
159 Ga0070664_100004858 3300005564 Bacteria 10764
160 Ga0070664_100051373 3300005564 Bacteria 3491
161 Ga0070664_100075921 3300005564 Bacteria 2887
162 Ga0070664_100135342 3300005564 Bacteria 2166
163 Ga0070664_100197819 3300005564 Bacteria 1792
164 Ga0070664_100234293 3300005564 Bacteria 1646
165 Ga0070664_100286116 3300005564 Unclassified 1487
166 Ga0070664_100311577 3300005564 Bacteria 1424
167 Ga0070664_100343728 3300005564 Bacteria 1356
168 Ga0070664_100365526 3300005564 Bacteria 1315
169 Ga0070664_100403232 3300005564 Bacteria 1251
170 Ga0068857_100000717 3300005577 Bacteria 24710
171 Ga0068857_100029379 3300005577 Bacteria 4851
172 Ga0068857_100031913 3300005577 Bacteria 4655
173 Ga0068857_100096716 3300005577 Bacteria 2646
174 Ga0068856_100100738 3300005614 Bacteria 2881
175 Ga0068856_100354430 3300005614 Bacteria 1486
176 Ga0070702_100064495 3300005615 Bacteria 2143
177 Ga0068852_100003092 3300005616 Bacteria 11588
178 Ga0068852_100015846 3300005616 Bacteria 5862
179 Ga0068852_100026439 3300005616 Bacteria 4717
180 Ga0068852_100073516 3300005616 Bacteria 3008
181 Ga0068852_100624980 3300005616 Bacteria 1083
182 Ga0068852_100662813 3300005616 Bacteria 1052
183 Ga0068859_100045574 3300005617 Bacteria 4405
184 Ga0068859_100060837 3300005617 Bacteria 3805
185 Ga0068859_100117474 3300005617 Bacteria 2725
186 Ga0068864_100016431 3300005618 Bacteria 6161
187 Ga0068864_100056554 3300005618 Bacteria 3390
188 Ga0068864_100077834 3300005618 Bacteria 2901
189 Ga0068861_100012860 3300005719 Bacteria 5845
190 Ga0068861_100519231 3300005719 Bacteria 1080
191 Ga0068851_10008894 3300005834 Bacteria 4658
192 Ga0068851_10149275 3300005834 Bacteria 1277
193 Ga0068870_10001495 3300005840 Bacteria 9465
194 Ga0068870_10002245 3300005840 Bacteria 8023
195 Ga0068870_10215334 3300005840 Bacteria 1172
196 Ga0068870_10217753 3300005840 Bacteria 1167
197 Ga0068863_100003586 3300005841 Bacteria 15317
198 Ga0068863_100039336 3300005841 Bacteria 4500
199 Ga0068863_100381018 3300005841 Bacteria 1377
200 Ga0068858_100070310 3300005842 Bacteria 3244
201 Ga0068860_100112567 3300005843 Bacteria 2602
202 Ga0068862_100006543 3300005844 Bacteria 9670
203 Ga0068862_100020178 3300005844 Bacteria 5565
204 Ga0070717_10005385 3300006028 Bacteria 9339
205 Ga0070717_10550161 3300006028 Bacteria 1045
206 Ga0070712_100458872 3300006175 Bacteria 1062
207 Ga0097621_100085934 3300006237 Bacteria 2624
208 Ga0068871_100111363 3300006358 Bacteria 2302
209 Ga0075430_100002235 3300006846 Bacteria 16039
210 Ga0075430_100069206 3300006846 Bacteria 2961
211 Ga0075430_100078345 3300006846 Bacteria 2770
212 Ga0075431_100006586 3300006847 Bacteria 11540
213 Ga0075431_100012144 3300006847 Bacteria 8688
214 Ga0075431_100385442 3300006847 Bacteria 1405
215 Ga0075433_10113460 3300006852 Bacteria 2404
216 Ga0075434_100007836 3300006871 Bacteria 9894
217 Ga0075434_100046587 3300006871 Bacteria 4302
218 Ga0075434_100195484 3300006871 Bacteria 2042
219 Ga0075429_100133711 3300006880 Bacteria 2170
220 Ga0075429_100420961 3300006880 Unclassified 1170
221 Ga0068865_100000586 3300006881 Bacteria 20440
222 Ga0097620_100045569 3300006931 Bacteria 4405
223 Ga0097620_100060837 3300006931 Bacteria 3805
224 Ga0097620_100117470 3300006931 Bacteria 2725
225 Ga0075435_100058786 3300007076 Bacteria 3115
226 Ga0075435_100396416 3300007076 Bacteria 1187
227 Ga0075435_100527429 3300007076 Unclassified 1022
228 Ga0105250_10115745 3300009092 Bacteria 1100
229 Ga0105240_10064868 3300009093 Bacteria 4536
230 Ga0105240_10215524 3300009093 Bacteria 2240
231 Ga0105240_10457726 3300009093 Unclassified 1426
232 Ga0105245_10002700 3300009098 Bacteria 15971
233 Ga0105245_10070696 3300009098 Bacteria 3168
234 Ga0114129_10041167 3300009147 Bacteria 6512
235 Ga0114129_10737588 3300009147 Unclassified 1262
236 Ga0105241_10043681 3300009174 Bacteria 3395
237 Ga0105241_10044577 3300009174 Bacteria 3361
238 Ga0105242_10040740 3300009176 Bacteria 3743
239 Ga0105242_10109658 3300009176 Bacteria 2350
240 Ga0105248_10009852 3300009177 Bacteria 10527
241 Ga0105248_10080934 3300009177 Bacteria 3651
242 Ga0105248_10096992 3300009177 Unclassified 3321
243 Ga0105248_10122873 3300009177 Bacteria 2929
244 Ga0105248_10140893 3300009177 Bacteria 2720
245 Ga0105248_10176606 3300009177 Bacteria 2407
246 Ga0105248_10253749 3300009177 Bacteria 1980
247 Ga0105248_10619668 3300009177 Bacteria 1221
248 Ga0105248_10757648 3300009177 Bacteria 1096
249 Ga0105237_10109512 3300009545 Unclassified 2754
250 Ga0105238_10047536 3300009551 Bacteria 4325
251 Ga0105238_10126298 3300009551 Bacteria 2536
252 Ga0105249_10004615 3300009553 Bacteria 11898
253 Ga0105249_10004803 3300009553 Bacteria 11664
254 Ga0105239_10036698 3300010375 Bacteria 5378
255 Ga0105246_10204498 3300011119 Bacteria 1537
256 Ga0157373_10016647 3300013100 Bacteria 5359
257 Ga0157373_10020185 3300013100 Bacteria 4846
258 Ga0157373_10069954 3300013100 Bacteria 2480
259 Ga0157373_10193580 3300013100 Bacteria 1433
260 Ga0157371_10063973 3300013102 Bacteria 2607
261 Ga0157370_10000502 3300013104 Bacteria 48831
262 Ga0157370_10006161 3300013104 Bacteria 13307
263 Ga0157370_10014071 3300013104 Bacteria 8209
264 Ga0157370_10117260 3300013104 Bacteria 2487
265 Ga0157370_10240171 3300013104 Bacteria 1676
266 Ga0157370_10547351 3300013104 Bacteria 1061
267 Ga0157369_10013659 3300013105 Bacteria 9183
268 Ga0157369_10013726 3300013105 Bacteria 9157
269 Ga0157369_10068017 3300013105 Bacteria 3827
270 Ga0157369_10183304 3300013105 Bacteria 2202
271 Ga0157369_10349558 3300013105 Bacteria 1535
272 Ga0157369_10420750 3300013105 Bacteria 1385
273 Ga0157374_10090313 3300013296 Bacteria 2920
274 Ga0157374_10354685 3300013296 Unclassified 1458
275 Ga0157378_10011577 3300013297 Bacteria 7723
276 Ga0157378_10224518 3300013297 Bacteria 1787
277 Ga0163162_10077810 3300013306 Bacteria 3381
278 Ga0163162_10121996 3300013306 Bacteria 2711
279 Ga0163162_10128887 3300013306 Bacteria 2638
280 Ga0163162_10217857 3300013306 Bacteria 2039
281 Ga0157372_10007058 3300013307 Bacteria 11967
282 Ga0157372_10027926 3300013307 Bacteria 6151
283 Ga0157372_10043465 3300013307 Bacteria 4974
284 Ga0157372_10046539 3300013307 Bacteria 4816
285 Ga0157372_10094382 3300013307 Bacteria 3406
286 Ga0157372_10108759 3300013307 Bacteria 3174
287 Ga0157372_10242839 3300013307 Bacteria 2090
288 Ga0157372_11055119 3300013307 Bacteria 941
289 Ga0157375_10012024 3300013308 Bacteria 7664
290 Ga0157375_10020924 3300013308 Bacteria 5987
291 Ga0157375_10042979 3300013308 Bacteria 4379
292 Ga0157375_10062270 3300013308 Bacteria 3707
293 Ga0157375_10342781 3300013308 Bacteria 1660
294 Ga0157375_10343144 3300013308 Bacteria 1659
295 Ga0163163_10004994 3300014325 Bacteria 11426
296 Ga0163163_10140379 3300014325 Bacteria 2458
297 Ga0163163_10157344 3300014325 Unclassified 2317
298 Ga0157380_10081184 3300014326 Bacteria 2652
299 Ga0157380_10230987 3300014326 Bacteria 1662
300 Ga0182008_10068287 3300014497 Unclassified 1749
301 Ga0157377_10000441 3300014745 Bacteria 17933
302 Ga0157377_10000840 3300014745 Bacteria 12728
303 Ga0157377_10146278 3300014745 Bacteria 1457
304 Ga0157379_10026411 3300014968 Bacteria 5169
305 Ga0157379_10181763 3300014968 Bacteria 1900
306 Ga0157379_10303921 3300014968 Bacteria 1454
307 Ga0163161_10389149 3300017792 Bacteria 1116
308 Ga0206353_10994938 3300020082 Bacteria 1243
309 Ga0213876_10029845 3300021384 Bacteria 2874
310 Ga0207697_10016917 3300025315 Bacteria 3000
311 Ga0207656_10016522 3300025321 Bacteria 2874
312 Ga0207656_10024461 3300025321 Bacteria 2443
313 Ga0207656_10092239 3300025321 Unclassified 1376
314 Ga0207682_10042901 3300025893 Bacteria 1849
315 Ga0207642_10078799 3300025899 Bacteria 1593
316 Ga0207688_10044116 3300025901 Bacteria 2485
317 Ga0207680_10133473 3300025903 Bacteria 1638
318 Ga0207647_10063827 3300025904 Bacteria 2239
319 Ga0207699_10012286 3300025906 Unclassified 4353
320 Ga0207699_10169859 3300025906 Bacteria 1458
321 Ga0207645_10000153 3300025907 Bacteria 54084
322 Ga0207645_10062613 3300025907 Bacteria 2377
323 Ga0207643_10004496 3300025908 Bacteria 7495
324 Ga0207643_10009034 3300025908 Bacteria 5352
325 Ga0207643_10043511 3300025908 Bacteria 2534
326 Ga0207643_10306225 3300025908 Bacteria 989
327 Ga0207643_10307355 3300025908 Bacteria 988
328 Ga0207705_10003175 3300025909 Bacteria 12508
329 Ga0207705_10022932 3300025909 Bacteria 4451
330 Ga0207705_10031900 3300025909 Bacteria 3764
331 Ga0207684_10068274 3300025910 Bacteria 3021
332 Ga0207684_10359327 3300025910 Bacteria 1253
333 Ga0207654_10024506 3300025911 Bacteria 3245
334 Ga0207707_10000782 3300025912 Bacteria 31165
335 Ga0207707_10003206 3300025912 Bacteria 14524
336 Ga0207707_10065539 3300025912 Bacteria 3164
337 Ga0207707_10227827 3300025912 Bacteria 1622
338 Ga0207695_10002156 3300025913 Bacteria 29802
339 Ga0207695_10398433 3300025913 Unclassified 1261
340 Ga0207671_10157713 3300025914 Bacteria 1756
341 Ga0207693_10010936 3300025915 Bacteria 7354
342 Ga0207693_10030132 3300025915 Bacteria 4284
343 Ga0207663_10038940 3300025916 Bacteria 2877
344 Ga0207663_10254677 3300025916 Bacteria 1293
345 Ga0207660_10001287 3300025917 Bacteria 16800
346 Ga0207662_10000185 3300025918 Bacteria 29675
347 Ga0207662_10007770 3300025918 Bacteria 5845
348 Ga0207662_10333070 3300025918 Bacteria 1016
349 Ga0207657_10035840 3300025919 Bacteria 4444
350 Ga0207657_10059544 3300025919 Bacteria 3280
351 Ga0207649_10002644 3300025920 Bacteria 9951
352 Ga0207649_10295062 3300025920 Unclassified 1183
353 Ga0207652_10012839 3300025921 Bacteria 6774
354 Ga0207652_10512635 3300025921 Bacteria 1079
355 Ga0207646_10414827 3300025922 Unclassified 1216
356 Ga0207681_10001909 3300025923 Bacteria 13353
357 Ga0207681_10018645 3300025923 Bacteria 4375
358 Ga0207681_10018654 3300025923 Bacteria 4373
359 Ga0207681_10172111 3300025923 Bacteria 1642
360 Ga0207681_10209131 3300025923 Unclassified 1503
361 Ga0207694_10196440 3300025924 Bacteria 1640
362 Ga0207650_10007393 3300025925 Bacteria 7478
363 Ga0207650_10042150 3300025925 Bacteria 3348
364 Ga0207650_10103988 3300025925 Bacteria 2190
365 Ga0207659_10003451 3300025926 Bacteria 9475
366 Ga0207659_10004609 3300025926 Bacteria 8342
367 Ga0207659_10009969 3300025926 Bacteria 5951
368 Ga0207659_10030008 3300025926 Bacteria 3711
369 Ga0207687_10005594 3300025927 Bacteria 8306
370 Ga0207687_10086042 3300025927 Unclassified 2282
371 Ga0207700_10005722 3300025928 Bacteria 7469
372 Ga0207664_10035812 3300025929 Bacteria 3832
373 Ga0207664_10085974 3300025929 Unclassified 2568
374 Ga0207664_10101657 3300025929 Bacteria 2376
375 Ga0207664_10128364 3300025929 Bacteria 2131
376 Ga0207664_10447421 3300025929 Bacteria 1153
377 Ga0207644_10015384 3300025931 Bacteria 5134
378 Ga0207644_10053546 3300025931 Bacteria 2904
379 Ga0207644_10420059 3300025931 Unclassified 1095
380 Ga0207690_10001509 3300025932 Bacteria 14547
381 Ga0207690_10024179 3300025932 Bacteria 3802
382 Ga0207690_10191229 3300025932 Bacteria 1548
383 Ga0207690_10229260 3300025932 Bacteria 1425
384 Ga0207706_10000879 3300025933 Bacteria 30864
385 Ga0207706_10012832 3300025933 Bacteria 7628
386 Ga0207706_10159492 3300025933 Bacteria 1983
387 Ga0207706_10223700 3300025933 Bacteria 1647
388 Ga0207686_10007860 3300025934 Bacteria 5749
389 Ga0207686_10043576 3300025934 Bacteria 2750
390 Ga0207709_10032354 3300025935 Bacteria 3062
391 Ga0207670_10012375 3300025936 Bacteria 4992
392 Ga0207670_10039005 3300025936 Bacteria 3107
393 Ga0207669_10114150 3300025937 Bacteria 1818
394 Ga0207704_10058697 3300025938 Bacteria 2371
395 Ga0207691_10000397 3300025940 Bacteria 43567
396 Ga0207691_10000749 3300025940 Bacteria 32096
397 Ga0207691_10003860 3300025940 Bacteria 14544
398 Ga0207691_10092906 3300025940 Bacteria 2702
399 Ga0207691_10117684 3300025940 Bacteria 2357
400 Ga0207691_10119476 3300025940 Bacteria 2337
401 Ga0207711_10020616 3300025941 Bacteria 5500
402 Ga0207711_10191165 3300025941 Bacteria 1865
403 Ga0207689_10000090 3300025942 Bacteria 73443
404 Ga0207689_10011150 3300025942 Bacteria 7714
405 Ga0207661_10001604 3300025944 Bacteria 15385
406 Ga0207661_10003043 3300025944 Bacteria 11598
407 Ga0207661_10019313 3300025944 Bacteria 5078
408 Ga0207661_10086805 3300025944 Bacteria 2597
409 Ga0207661_10105886 3300025944 Bacteria 2370
410 Ga0207661_10397208 3300025944 Bacteria 1250
411 Ga0207661_10490185 3300025944 Unclassified 1122
412 Ga0207679_10000718 3300025945 Bacteria 22034
413 Ga0207679_10004658 3300025945 Bacteria 8541
414 Ga0207679_10020980 3300025945 Bacteria 4421
415 Ga0207679_10047671 3300025945 Bacteria 3114
416 Ga0207679_10112314 3300025945 Bacteria 2153
417 Ga0207679_10253139 3300025945 Unclassified 1498
418 Ga0207679_10363811 3300025945 Bacteria 1264
419 Ga0207667_10072850 3300025949 Unclassified 3570
420 Ga0207651_10005028 3300025960 Bacteria 6739
421 Ga0207651_10072943 3300025960 Bacteria 2439
422 Ga0207651_10341162 3300025960 Bacteria 1258
423 Ga0207651_10360736 3300025960 Unclassified 1226
424 Ga0207651_10446374 3300025960 Bacteria 1109
425 Ga0207651_10491311 3300025960 Bacteria 1059
426 Ga0207712_10002151 3300025961 Bacteria 12865
427 Ga0207712_10012632 3300025961 Bacteria 5396
428 Ga0207658_10010012 3300025986 Bacteria 6442
429 Ga0207677_10049667 3300026023 Unclassified 2832
430 Ga0207677_10117323 3300026023 Bacteria 1995
431 Ga0207677_10189590 3300026023 Bacteria 1625
432 Ga0207703_10164704 3300026035 Unclassified 1944
433 Ga0207639_10046571 3300026041 Bacteria 3273
434 Ga0207678_10003898 3300026067 Bacteria 13417
435 Ga0207678_10526570 3300026067 Unclassified 1032
436 Ga0207708_10046466 3300026075 Bacteria 3306
437 Ga0207708_10076178 3300026075 Bacteria 2573
438 Ga0207708_10250463 3300026075 Bacteria 1427
439 Ga0207702_10011270 3300026078 Bacteria 7452
440 Ga0207702_10112935 3300026078 Bacteria 2419
441 Ga0207702_10435453 3300026078 Bacteria 1270
442 Ga0207641_10023605 3300026088 Bacteria 5067
443 Ga0207641_10149158 3300026088 Bacteria 2117
444 Ga0207648_10041968 3300026089 Bacteria 4017
445 Ga0207648_10083732 3300026089 Bacteria 2782
446 Ga0207676_10007907 3300026095 Bacteria 7564
447 Ga0207676_10032135 3300026095 Bacteria 3952
448 Ga0207676_10046958 3300026095 Bacteria 3344
449 Ga0207674_10001731 3300026116 Bacteria 27880
450 Ga0207674_10003535 3300026116 Bacteria 19080
451 Ga0207674_10009777 3300026116 Bacteria 10924
452 Ga0207674_10042611 3300026116 Bacteria 4686
453 Ga0207675_100022748 3300026118 Bacteria 5832
454 Ga0207675_100120737 3300026118 Bacteria 2479
455 Ga0207683_10109580 3300026121 Bacteria 2472
456 Ga0207698_10006745 3300026142 Bacteria 7173
457 Ga0207698_10042363 3300026142 Bacteria 3401
458 Ga0207698_10053307 3300026142 Bacteria 3104
459 Ga0207698_10078544 3300026142 Bacteria 2650
460 Ga0210000_1001789 3300027462 Bacteria 3039
461 Ga0209968_1001873 3300027526 Bacteria 3195
462 Ga0209999_1007747 3300027543 Bacteria 1929
463 Ga0209971_1005161 3300027682 Bacteria 3102
464 Ga0209966_1000441 3300027695 Bacteria 11684
465 Ga0209998_10000136 3300027717 Bacteria 28757
466 Ga0268266_10361896 3300028379 Bacteria 1365
467 Ga0268265_10002372 3300028380 Bacteria 14255
468 Ga0268265_10003111 3300028380 Bacteria 12104
469 Ga0268264_10004414 3300028381 Bacteria 12001
470 Ga0265332_10000963 3300031238 Bacteria 17037
471 Ga0265332_10059017 3300031238 Bacteria 1642
472 Ga0265327_10006134 3300031251 Bacteria 9726
473 Ga0307408_100001960 3300031548 Bacteria 14857
474 Ga0307408_100004895 3300031548 Bacteria 9016
475 Ga0307408_100178361 3300031548 Bacteria 1702
476 Ga0265314_10001811 3300031711 Bacteria 23046
477 Ga0265314_10065657 3300031711 Bacteria 2450
478 Ga0307405_10001183 3300031731 Bacteria 10762
479 Ga0307405_10023308 3300031731 Bacteria 3516
480 Ga0307405_10391323 3300031731 Unclassified 1085
481 Ga0307413_10040454 3300031824 Bacteria 2720
482 Ga0307413_10149902 3300031824 Bacteria 1623
483 Ga0307410_10011425 3300031852 Bacteria 5078
484 Ga0307410_10037020 3300031852 Bacteria 3183
485 Ga0307406_10002806 3300031901 Bacteria 9504
486 Ga0307406_10014649 3300031901 Bacteria 4515
487 Ga0307406_10073344 3300031901 Unclassified 2250
488 Ga0307407_10031986 3300031903 Bacteria 2855
489 Ga0307407_10033586 3300031903 Bacteria 2800
490 Ga0307407_10338360 3300031903 Unclassified 1062
491 Ga0307412_10003419 3300031911 Bacteria 8819
492 Ga0307412_10041120 3300031911 Bacteria 2994
493 Ga0307412_10191490 3300031911 Bacteria 1547
494 Ga0307409_100005738 3300031995 Bacteria 7194
495 Ga0307409_100038117 3300031995 Bacteria 3551
496 Ga0307416_100007768 3300032002 Bacteria 6855
497 Ga0307416_100022165 3300032002 Bacteria 4578
498 Ga0307416_100048728 3300032002 Bacteria 3363
499 Ga0307416_100129440 3300032002 Bacteria 2269
500 Ga0307416_100190826 3300032002 Unclassified 1932
501 Ga0307416_100250468 3300032002 Unclassified 1723
502 Ga0307416_100734504 3300032002 Bacteria 1079
503 Ga0307416_100845658 3300032002 Unclassified 1013
504 Ga0307414_10003234 3300032004 Bacteria 8673
505 Ga0307411_10018850 3300032005 Bacteria 3970
506 Ga0307411_10222493 3300032005 Bacteria 1465
507 Ga0307411_10471500 3300032005 Bacteria 1055
508 Ga0307415_100011199 3300032126 Bacteria 5119
509 Ga0307415_100141836 3300032126 Bacteria 1836
510 Ga0307415_100322038 3300032126 Bacteria 1289
511 Ga0373926_0090370 3300035083 Bacteria 1138
512 Ga0373934_0003368 3300035086 Bacteria 5848
513 Ga0373934_0010466 3300035086 Bacteria 3481
514 Ga0373944_0081122 3300035089 Bacteria 1071
515 Ga0373923_0060401 3300035111 Bacteria 1609
516 Ga0373945_0044478 3300035116 Bacteria 1615
517 Ga0373956_0038498 3300035119 Bacteria 2115
518 Ga0373957_0105014 3300035120 Unclassified 1134
519 Ga0373943_0015899 3300035170 Bacteria 3424
520 Ga0373955_0056027 3300035172 Bacteria 2161
521 Ga0373961_0031806 3300035241 Unclassified 1476
522 Ga0373935_0232447 3300035692 Bacteria 1284
523 Ga0373927_0026063 3300035695 Bacteria 3821
524 Ga0373927_0047926 3300035695 Bacteria 2764
525 Ga0373933_0066294 3300035724 Bacteria 2188
526 Ga0373947_0001080 3300035725 Bacteria 16709
527 Ga0373947_0140650 3300035725 Bacteria 1548
528 Ga0373947_0282394 3300035725 Bacteria 1104
529 Ga0373937_0022996 3300036401 Bacteria 5606
530 Ga0373937_0289208 3300036401 Bacteria 1548
531 Ga0373925_0002415 3300037068 Bacteria 14985
532 Ga0373925_0008987 3300037068 Bacteria 7280
533 Ga0373925_0086312 3300037068 Bacteria 2394
534 Ga0436365_1514909 3300039437 Bacteria 3016
535 Ga0436365_1690471 3300039437 Bacteria 8058
536 Ga0451577_0138607 3300042876 Bacteria 2185
537 Ga0451577_0456344 3300042876 Bacteria 1161
538 Ga0466966_0040190 3300044684 Bacteria 3010
539 Ga0466966_0072142 3300044684 Bacteria 2163
540 Ga0466961_0027061 3300044693 Bacteria 3687
541 Ga0466959_0026236 3300045049 Bacteria 4319
542 Ga0466959_0063261 3300045049 Bacteria 2687
543 Ga0466959_0122733 3300045049 Bacteria 1845
544 Ga0451576_0129864 3300045051 Bacteria 2626
545 Ga0495592_0061611 3300046454 Bacteria 2757
546 Ga0495603_0019850 3300046455 Bacteria 4070
547 Ga0495603_0080578 3300046455 Bacteria 1908
548 Ga0495629_0018688 3300046459 Bacteria 4954
549 Ga0495629_0072562 3300046459 Bacteria 2403
550 Ga0495651_0014550 3300046462 Bacteria 6083
551 Ga0495651_0126630 3300046462 Bacteria 1870
552 Ga0495582_0027897 3300046473 Bacteria 3096
553 Ga0495582_0037822 3300046473 Bacteria 2654
554 Ga0495639_0169287 3300046475 Bacteria 1060
555 Ga0495664_0030617 3300046477 Bacteria 3153
556 Ga0495594_0010323 3300046499 Bacteria 4841
557 Ga0495618_0046958 3300046514 Bacteria 2726
558 Ga0495628_0131405 3300046516 Bacteria 1914
559 Ga0495630_0002914 3300046517 Bacteria 11890
560 Ga0495630_0030018 3300046517 Bacteria 4042
561 Ga0495663_0014006 3300046525 Bacteria 2245
562 Ga0495652_0033882 3300046529 Bacteria 4454
563 Ga0495665_0002174 3300046531 Bacteria 10603
564 Ga0495665_0056616 3300046531 Bacteria 2070
565 Ga0495586_0015993 3300046535 Bacteria 3992
566 Ga0495587_0001372 3300046536 Bacteria 16175
567 Ga0495587_0005408 3300046536 Bacteria 8336
568 Ga0495621_0086934 3300046539 Bacteria 1173
569 Ga0495645_0008622 3300046543 Bacteria 7120
570 Ga0495645_0031666 3300046543 Bacteria 3854
571 Ga0495622_0121192 3300046557 Unclassified 1194
572 Ga0495667_0000315 3300046559 Bacteria 30752
573 Ga0495657_0025334 3300046675 Bacteria 4214
574 Ga0495599_0006765 3300046678 Bacteria 6924
575 Ga0495599_0027948 3300046678 Bacteria 3534
576 Ga0495623_0110692 3300046679 Bacteria 1664
577 Ga0495658_0000414 3300046683 Bacteria 23948
578 Ga0495658_0252258 3300046683 Bacteria 1110
579 Ga0495613_0254353 3300046689 Unclassified 1225
580 Ga0495600_0119973 3300046809 Bacteria 1710
581 Ga0495581_0001975 3300047315 Bacteria 11498
582 Ga0495672_0100511 3300047320 Bacteria 1569
583 Ga0495675_0080318 3300047444 Bacteria 2054
584 Ga0495675_0120109 3300047444 Bacteria 1637
585 Ga0495685_021107 3300047447 Bacteria 2240
586 Ga0495684_0020352 3300047471 Bacteria 5112
587 Ga0495684_0069959 3300047471 Bacteria 2668
588 Ga0495684_0284159 3300047471 Unclassified 1193
589 Ga0495684_0290334 3300047471 Bacteria 1177
590 Ga0495684_0322171 3300047471 Bacteria 1105
591 Ga0495593_0000046 3300047673 Bacteria 50024
592 Ga0495593_0103348 3300047673 Unclassified 1460
593 Ga0495614_0000746 3300048089 Bacteria 13798
594 Ga0495615_0003372 3300048090 Bacteria 2671
595 Ga0496101_0463906 3300048904 Bacteria 999
596 Ga0496105_0103455 3300048908 Bacteria 2352
597 Ga0496108_0023627 3300048911 Bacteria 5060
598 Ga0496109_0027341 3300048912 Bacteria 5093
599 Ga0496109_0417634 3300048912 Bacteria 1267
600 Ga0496112_0002984 3300048915 Bacteria 13810
601 Ga0496112_0056524 3300048915 Bacteria 3862
602 Ga0496113_0001553 3300048916 Bacteria 12887
603 Ga0496113_0009084 3300048916 Bacteria 6514
604 Ga0501202_000890 3300049652 Bacteria 4560
605 Ga0501207_014485 3300049654 Bacteria 1204
606 Ga0501208_011598 3300049655 Bacteria 1274
607 Ga0501209_003108 3300049656 Bacteria 2683
608 Ga0501216_000165 3300049660 Bacteria 7036
609 Ga0501217_000864 3300049661 Bacteria 5378
610 Ga0501223_002577 3300049663 Bacteria 4002
611 Ga0501224_003096 3300049664 Bacteria 2303
612 Ga0501227_032909 3300049665 Bacteria 1252
613 Ga0501233_003981 3300049668 Unclassified 2682
614 Ga0501235_001296 3300049669 Bacteria 5293
615 Ga0501242_000289 3300049674 Bacteria 4103
616 Ga0501243_003534 3300049675 Bacteria 2320
617 Ga0501249_017147 3300049679 Bacteria 1560
618 Ga0501252_002877 3300049682 Bacteria 1739
619 Ga0501253_002066 3300049683 Bacteria 2200
620 Ga0501257_000806 3300049686 Bacteria 6269
621 Ga0501258_000284 3300049687 Unclassified 3179
622 Ga0501260_000451 3300049689 Bacteria 3206
623 Ga0501261_002200 3300049690 Bacteria 2393
624 Ga0501225_0004539 3300049705 Bacteria 4128
625 Ga0501234_005667 3300049707 Unclassified 1952
626 Ga0501245_005888 3300049708 Bacteria 1705
627 Ga0501241_006309 3300049758 Bacteria 2182
628 Ga0501262_002612 3300049759 Bacteria 2041
629 Ga0501263_000502 3300049760 Bacteria 2962
630 Ga0501266_001028 3300049763 Bacteria 3597
631 Ga0501268_000021 3300049765 Bacteria 13607
632 Ga0501270_002431 3300049767 Bacteria 1906
633 Ga0501272_005074 3300049769 Bacteria 1379
634 Ga0501273_006951 3300049770 Unclassified 1323
635 Ga0501279_004264 3300049775 Unclassified 1875
636 Ga0501212_000492 3300049851 Bacteria 3857
637 nmdc:mga05p37_39820_c1 3300050507 Bacteria 5771
638 nmdc:mga05p37_561996_c1 3300050507 Unclassified 1296
639 nmdc:mga09592_242600_c1 3300050508 Bacteria 1561
640 nmdc:mga09592_407795_c1 3300050508 Bacteria 1174
641 nmdc:mga09592_62889_c1 3300050508 Bacteria 3140
642 nmdc:mga0qj67_24601_c1 3300050509 Bacteria 4644
643 nmdc:mga0qj67_79881_c1 3300050509 Bacteria 2620
644 nmdc:mga06r32_4770_c1 3300050510 Bacteria 12194
645 nmdc:mga06r32_9240_c1 3300050510 Bacteria 8886
646 nmdc:mga08y16_491703_c1 3300050511 Unclassified 1247
647 nmdc:mga0n895_7938_c1 3300050512 Bacteria 9151
648 nmdc:mga0rr50_379725_c1 3300050513 Unclassified 1191
649 nmdc:mga0rr50_570536_c1 3300050513 Unclassified 964
650 nmdc:mga0a205_194025_c1 3300050515 Bacteria 1922
651 nmdc:mga0a205_61415_c1 3300050515 Bacteria 3630
652 Ga0495601_0091505 3300053077 Bacteria 1958
653 Ga0495619_0199225 3300053085 Bacteria 1386
654 Ga0070668_100038101
655 Ga0058863_11945992
656 Ga0065712_10080903
657 Ga0065712_10090354
658 Ga0065712_10153364
659 Ga0070658_10013629
660 Ga0070658_10043655
661 Ga0070658_10080382
662 Ga0070676_10022903
663 Ga0070683_100002337
664 Ga0070683_100002363
665 Ga0070683_100017761
666 Ga0070683_100056977
667 Ga0070683_100071622
668 Ga0070683_100107207
669 Ga0070683_100125360
670 Ga0070683_100673925
671 Ga0070690_100024257
672 Ga0070690_100263721
673 Ga0070670_100002906
674 Ga0070670_100041179
675 Ga0070670_100289259
676 Ga0070670_100291761
677 Ga0070677_10011082
678 Ga0070677_10205140
679 Ga0068869_100002687
680 Ga0070680_100000549
681 Ga0070680_100005387
682 Ga0070680_100069443
683 Ga0070680_100092556
684 Ga0070680_100200029
685 Ga0070682_100042028
686 Ga0068868_100035257
687 Ga0068868_100041434
688 Ga0068868_100060284
689 Ga0068868_100210213
690 Ga0070660_100008612
691 Ga0070660_100027702
692 Ga0070660_100090956
693 Ga0070660_100311124
694 Ga0070689_100003049
695 Ga0070689_100138818
696 Ga0070689_100364673
697 Ga0070691_10000508
698 Ga0070687_100004161
699 Ga0070687_100022578
700 Ga0070687_100032882
701 Ga0070687_100117518
702 Ga0070661_100001095
703 Ga0070661_100004491
704 Ga0070661_100069284
705 Ga0070661_100098345
706 Ga0070661_100135571
707 Ga0070661_100204296
708 Ga0070692_10095444
709 Ga0070668_100001458
710 Ga0070668_100100688
711 Ga0070668_100480362
712 Ga0070669_100003656
713 Ga0070669_100007548
714 Ga0070669_100019239
715 Ga0070669_100050059
716 Ga0070669_100157831
717 Ga0070669_100203747
718 Ga0070675_100044715
719 Ga0070675_100069949
720 Ga0070675_100078993
721 Ga0070675_100271642
722 Ga0070671_100117177
723 Ga0070671_100141308
724 Ga0070671_100337028
725 Ga0070674_100132456
726 Ga0070674_100175733
727 Ga0070674_100185182
728 Ga0070673_100031093
729 Ga0070673_100047116
730 Ga0070673_100204873
731 Ga0070673_100329766
732 Ga0070673_100510274
733 Ga0070688_100000737
734 Ga0070688_100011070
735 Ga0070688_100116764
736 Ga0070659_100010466
737 Ga0070659_100015836
738 Ga0070659_100224704
739 Ga0070659_100265824
740 Ga0070659_100384301
741 Ga0070667_100015449
742 Ga0070667_100016113
743 Ga0070709_10095385
744 Ga0070714_100003646
745 Ga0070714_100046269
746 Ga0070714_100102056
747 Ga0070714_100314381
748 Ga0070713_100007659
749 Ga0070711_100049053
750 Ga0070705_100075812
751 Ga0070700_100128169
752 Ga0070694_100209157
753 Ga0070708_100000113
754 Ga0070663_100027765
755 Ga0070662_100018732
756 Ga0070662_100043851
757 Ga0070662_100098445
758 Ga0070681_10000861
759 Ga0070681_10002680
760 Ga0070681_10084382
761 Ga0070681_10111194
762 Ga0070681_10239977
763 Ga0068867_100052911
764 Ga0068867_100176101
765 Ga0070685_10011674
766 Ga0070685_10110840
767 Ga0070707_100246505
768 Ga0070698_100023703
769 Ga0070698_100172846
770 Ga0070699_100012954
771 Ga0070699_100055866
772 Ga0070699_100080203
773 Ga0070679_100001591
774 Ga0070679_100001943
775 Ga0070679_100003776
776 Ga0070679_100018653
777 Ga0070679_100136644
778 Ga0070679_100184700
779 Ga0070679_100214502
780 Ga0070679_100232187
781 Ga0070679_100408522
782 Ga0070679_100518031
783 Ga0070684_100001622
784 Ga0070684_100011747
785 Ga0070684_100018823
786 Ga0070684_100028041
787 Ga0070684_100032199
788 Ga0070684_100034279
789 Ga0070684_100039542
790 Ga0070684_100039578
791 Ga0070684_100052197
792 Ga0070684_100079454
793 Ga0070684_100081461
794 Ga0070684_100142213
795 Ga0070684_100302522
796 Ga0070684_100487840
797 Ga0068853_100251587
798 Ga0070672_100040929
799 Ga0070672_100095099
800 Ga0070672_100308895
801 Ga0070672_100534483
802 Ga0070696_100154584
803 Ga0070665_100053419
804 Ga0070665_100099342
805 Ga0070665_100491364
806 Ga0068855_100003991
807 Ga0068855_100041600
808 Ga0068855_100058648
809 Ga0068855_100081414
810 Ga0068855_100351062
811 Ga0070664_100002366
812 Ga0070664_100004858
813 Ga0070664_100051373
814 Ga0070664_100075921
815 Ga0070664_100135342
816 Ga0070664_100197819
817 Ga0070664_100234293
818 Ga0070664_100286116
819 Ga0070664_100311577
820 Ga0070664_100343728
821 Ga0070664_100365526
822 Ga0070664_100403232
823 Ga0068857_100000717
824 Ga0068857_100029379
825 Ga0068857_100031913
826 Ga0068857_100096716
827 Ga0068856_100100738
828 Ga0068856_100354430
829 Ga0070702_100064495
830 Ga0068852_100003092
831 Ga0068852_100015846
832 Ga0068852_100026439
833 Ga0068852_100073516
834 Ga0068852_100624980
835 Ga0068852_100662813
836 Ga0068859_100045574
837 Ga0068859_100060837
838 Ga0068859_100117474
839 Ga0068864_100016431
840 Ga0068864_100056554
841 Ga0068864_100077834
842 Ga0068861_100012860
843 Ga0068861_100519231
844 Ga0068851_10008894
845 Ga0068851_10149275
846 Ga0068870_10001495
847 Ga0068870_10002245
848 Ga0068870_10215334
849 Ga0068870_10217753
850 Ga0068863_100003586
851 Ga0068863_100039336
852 Ga0068863_100381018
853 Ga0068858_100070310
854 Ga0068860_100112567
855 Ga0068862_100006543
856 Ga0068862_100020178
857 Ga0070717_10005385
858 Ga0070717_10550161
859 Ga0070712_100458872
860 Ga0097621_100085934
861 Ga0068871_100111363
862 Ga0075430_100002235
863 Ga0075430_100069206
864 Ga0075430_100078345
865 Ga0075431_100006586
866 Ga0075431_100012144
867 Ga0075431_100385442
868 Ga0075433_10113460
869 Ga0075434_100007836
870 Ga0075434_100046587
871 Ga0075434_100195484
872 Ga0075429_100133711
873 Ga0075429_100420961
874 Ga0068865_100000586
875 Ga0097620_100045569
876 Ga0097620_100060837
877 Ga0097620_100117470
878 Ga0075435_100058786
879 Ga0075435_100396416
880 Ga0075435_100527429
881 Ga0105250_10115745
882 Ga0105240_10064868
883 Ga0105240_10215524
884 Ga0105240_10457726
885 Ga0105245_10002700
886 Ga0105245_10070696
887 Ga0114129_10041167
888 Ga0114129_10737588
889 Ga0105241_10043681
890 Ga0105241_10044577
891 Ga0105242_10040740
892 Ga0105242_10109658
893 Ga0105248_10009852
894 Ga0105248_10080934
895 Ga0105248_10096992
896 Ga0105248_10122873
897 Ga0105248_10140893
898 Ga0105248_10176606
899 Ga0105248_10253749
900 Ga0105248_10619668
901 Ga0105248_10757648
902 Ga0105237_10109512
903 Ga0105238_10047536
904 Ga0105238_10126298
905 Ga0105249_10004615
906 Ga0105249_10004803
907 Ga0105239_10036698
908 Ga0105246_10204498
909 Ga0157373_10016647
910 Ga0157373_10020185
911 Ga0157373_10069954
912 Ga0157373_10193580
913 Ga0157371_10063973
914 Ga0157370_10000502
915 Ga0157370_10006161
916 Ga0157370_10014071
917 Ga0157370_10117260
918 Ga0157370_10240171
919 Ga0157370_10547351
920 Ga0157369_10013659
921 Ga0157369_10013726
922 Ga0157369_10068017
923 Ga0157369_10183304
924 Ga0157369_10349558
925 Ga0157369_10420750
926 Ga0157374_10090313
927 Ga0157374_10354685
928 Ga0157378_10011577
929 Ga0157378_10224518
930 Ga0163162_10077810
931 Ga0163162_10121996
932 Ga0163162_10128887
933 Ga0163162_10217857
934 Ga0157372_10007058
935 Ga0157372_10027926
936 Ga0157372_10043465
937 Ga0157372_10046539
938 Ga0157372_10094382
939 Ga0157372_10108759
940 Ga0157372_10242839
941 Ga0157372_11055119
942 Ga0157375_10012024
943 Ga0157375_10020924
944 Ga0157375_10042979
945 Ga0157375_10062270
946 Ga0157375_10342781
947 Ga0157375_10343144
948 Ga0163163_10004994
949 Ga0163163_10140379
950 Ga0163163_10157344
951 Ga0157380_10081184
952 Ga0157380_10230987
953 Ga0182008_10068287
954 Ga0157377_10000441
955 Ga0157377_10000840
956 Ga0157377_10146278
957 Ga0157379_10026411
958 Ga0157379_10181763
959 Ga0157379_10303921
960 Ga0163161_10389149
961 Ga0206353_10994938
962 Ga0213876_10029845
963 Ga0207697_10016917
964 Ga0207656_10016522
965 Ga0207656_10024461
966 Ga0207656_10092239
967 Ga0207682_10042901
968 Ga0207642_10078799
969 Ga0207688_10044116
970 Ga0207680_10133473
971 Ga0207647_10063827
972 Ga0207699_10012286
973 Ga0207699_10169859
974 Ga0207645_10000153
975 Ga0207645_10062613
976 Ga0207643_10004496
977 Ga0207643_10009034
978 Ga0207643_10043511
979 Ga0207643_10306225
980 Ga0207643_10307355
981 Ga0207705_10003175
982 Ga0207705_10022932
983 Ga0207705_10031900
984 Ga0207684_10068274
985 Ga0207684_10359327
986 Ga0207654_10024506
987 Ga0207707_10000782
988 Ga0207707_10003206
989 Ga0207707_10065539
990 Ga0207707_10227827
991 Ga0207695_10002156
992 Ga0207695_10398433
993 Ga0207671_10157713
994 Ga0207693_10010936
995 Ga0207693_10030132
996 Ga0207663_10038940
997 Ga0207663_10254677
998 Ga0207660_10001287
999 Ga0207662_10000185
1000 Ga0207662_10007770
1001 Ga0207662_10333070
1002 Ga0207657_10035840
1003 Ga0207657_10059544
1004 Ga0207649_10002644
1005 Ga0207649_10295062
1006 Ga0207652_10012839
1007 Ga0207652_10512635
1008 Ga0207646_10414827
1009 Ga0207681_10001909
1010 Ga0207681_10018645
1011 Ga0207681_10018654
1012 Ga0207681_10172111
1013 Ga0207681_10209131
1014 Ga0207694_10196440
1015 Ga0207650_10007393
1016 Ga0207650_10042150
1017 Ga0207650_10103988
1018 Ga0207659_10003451
1019 Ga0207659_10004609
1020 Ga0207659_10009969
1021 Ga0207659_10030008
1022 Ga0207687_10005594
1023 Ga0207687_10086042
1024 Ga0207700_10005722
1025 Ga0207664_10035812
1026 Ga0207664_10085974
1027 Ga0207664_10101657
1028 Ga0207664_10128364
1029 Ga0207664_10447421
1030 Ga0207644_10015384
1031 Ga0207644_10053546
1032 Ga0207644_10420059
1033 Ga0207690_10001509
1034 Ga0207690_10024179
1035 Ga0207690_10191229
1036 Ga0207690_10229260
1037 Ga0207706_10000879
1038 Ga0207706_10012832
1039 Ga0207706_10159492
1040 Ga0207706_10223700
1041 Ga0207686_10007860
1042 Ga0207686_10043576
1043 Ga0207709_10032354
1044 Ga0207670_10012375
1045 Ga0207670_10039005
1046 Ga0207669_10114150
1047 Ga0207704_10058697
1048 Ga0207691_10000397
1049 Ga0207691_10000749
1050 Ga0207691_10003860
1051 Ga0207691_10092906
1052 Ga0207691_10117684
1053 Ga0207691_10119476
1054 Ga0207711_10020616
1055 Ga0207711_10191165
1056 Ga0207689_10000090
1057 Ga0207689_10011150
1058 Ga0207661_10001604
1059 Ga0207661_10003043
1060 Ga0207661_10019313
1061 Ga0207661_10086805
1062 Ga0207661_10105886
1063 Ga0207661_10397208
1064 Ga0207661_10490185
1065 Ga0207679_10000718
1066 Ga0207679_10004658
1067 Ga0207679_10020980
1068 Ga0207679_10047671
1069 Ga0207679_10112314
1070 Ga0207679_10253139
1071 Ga0207679_10363811
1072 Ga0207667_10072850
1073 Ga0207651_10005028
1074 Ga0207651_10072943
1075 Ga0207651_10341162
1076 Ga0207651_10360736
1077 Ga0207651_10446374
1078 Ga0207651_10491311
1079 Ga0207712_10002151
1080 Ga0207712_10012632
1081 Ga0207658_10010012
1082 Ga0207677_10049667
1083 Ga0207677_10117323
1084 Ga0207677_10189590
1085 Ga0207703_10164704
1086 Ga0207639_10046571
1087 Ga0207678_10003898
1088 Ga0207678_10526570
1089 Ga0207708_10046466
1090 Ga0207708_10076178
1091 Ga0207708_10250463
1092 Ga0207702_10011270
1093 Ga0207702_10112935
1094 Ga0207702_10435453
1095 Ga0207641_10023605
1096 Ga0207641_10149158
1097 Ga0207648_10041968
1098 Ga0207648_10083732
1099 Ga0207676_10007907
1100 Ga0207676_10032135
1101 Ga0207676_10046958
1102 Ga0207674_10001731
1103 Ga0207674_10003535
1104 Ga0207674_10009777
1105 Ga0207674_10042611
1106 Ga0207675_100022748
1107 Ga0207675_100120737
1108 Ga0207683_10109580
1109 Ga0207698_10006745
1110 Ga0207698_10042363
1111 Ga0207698_10053307
1112 Ga0207698_10078544
1113 Ga0210000_1001789
1114 Ga0209968_1001873
1115 Ga0209999_1007747
1116 Ga0209971_1005161
1117 Ga0209966_1000441
1118 Ga0209998_10000136
1119 Ga0268266_10361896
1120 Ga0268265_10002372
1121 Ga0268265_10003111
1122 Ga0268264_10004414
1123 Ga0265332_10000963
1124 Ga0265332_10059017
1125 Ga0265327_10006134
1126 Ga0307408_100001960
1127 Ga0307408_100004895
1128 Ga0307408_100178361
1129 Ga0265314_10001811
1130 Ga0265314_10065657
1131 Ga0307405_10001183
1132 Ga0307405_10023308
1133 Ga0307405_10391323
1134 Ga0307413_10040454
1135 Ga0307413_10149902
1136 Ga0307410_10011425
1137 Ga0307410_10037020
1138 Ga0307406_10002806
1139 Ga0307406_10014649
1140 Ga0307406_10073344
1141 Ga0307407_10031986
1142 Ga0307407_10033586
1143 Ga0307407_10338360
1144 Ga0307412_10003419
1145 Ga0307412_10041120
1146 Ga0307412_10191490
1147 Ga0307409_100005738
1148 Ga0307409_100038117
1149 Ga0307416_100007768
1150 Ga0307416_100022165
1151 Ga0307416_100048728
1152 Ga0307416_100129440
1153 Ga0307416_100190826
1154 Ga0307416_100250468
1155 Ga0307416_100734504
1156 Ga0307416_100845658
1157 Ga0307414_10003234
1158 Ga0307411_10018850
1159 Ga0307411_10222493
1160 Ga0307411_10471500
1161 Ga0307415_100011199
1162 Ga0307415_100141836
1163 Ga0307415_100322038
1164 Ga0373926_0090370
1165 Ga0373934_0003368
1166 Ga0373934_0010466
1167 Ga0373944_0081122
1168 Ga0373923_0060401
1169 Ga0373945_0044478
1170 Ga0373956_0038498
1171 Ga0373957_0105014
1172 Ga0373943_0015899
1173 Ga0373955_0056027
1174 Ga0373961_0031806
1175 Ga0373935_0232447
1176 Ga0373927_0026063
1177 Ga0373927_0047926
1178 Ga0373933_0066294
1179 Ga0373947_0001080
1180 Ga0373947_0140650
1181 Ga0373947_0282394
1182 Ga0373937_0022996
1183 Ga0373937_0289208
1184 Ga0373925_0002415
1185 Ga0373925_0008987
1186 Ga0373925_0086312
1187 Ga0436365_1514909
1188 Ga0436365_1690471
1189 Ga0451577_0138607
1190 Ga0451577_0456344
1191 Ga0466966_0040190
1192 Ga0466966_0072142
1193 Ga0466961_0027061
1194 Ga0466959_0026236
1195 Ga0466959_0063261
1196 Ga0466959_0122733
1197 Ga0451576_0129864
1198 Ga0495592_0061611
1199 Ga0495603_0019850
1200 Ga0495603_0080578
1201 Ga0495629_0018688
1202 Ga0495629_0072562
1203 Ga0495651_0014550
1204 Ga0495651_0126630
1205 Ga0495582_0027897
1206 Ga0495582_0037822
1207 Ga0495639_0169287
1208 Ga0495664_0030617
1209 Ga0495594_0010323
1210 Ga0495618_0046958
1211 Ga0495628_0131405
1212 Ga0495630_0002914
1213 Ga0495630_0030018
1214 Ga0495663_0014006
1215 Ga0495652_0033882
1216 Ga0495665_0002174
1217 Ga0495665_0056616
1218 Ga0495586_0015993
1219 Ga0495587_0001372
1220 Ga0495587_0005408
1221 Ga0495621_0086934
1222 Ga0495645_0008622
1223 Ga0495645_0031666
1224 Ga0495622_0121192
1225 Ga0495667_0000315
1226 Ga0495657_0025334
1227 Ga0495599_0006765
1228 Ga0495599_0027948
1229 Ga0495623_0110692
1230 Ga0495658_0000414
1231 Ga0495658_0252258
1232 Ga0495613_0254353
1233 Ga0495600_0119973
1234 Ga0495581_0001975
1235 Ga0495672_0100511
1236 Ga0495675_0080318
1237 Ga0495675_0120109
1238 Ga0495685_021107
1239 Ga0495684_0020352
1240 Ga0495684_0069959
1241 Ga0495684_0284159
1242 Ga0495684_0290334
1243 Ga0495684_0322171
1244 Ga0495593_0000046
1245 Ga0495593_0103348
1246 Ga0495614_0000746
1247 Ga0495615_0003372
1248 Ga0496101_0463906
1249 Ga0496105_0103455
1250 Ga0496108_0023627
1251 Ga0496109_0027341
1252 Ga0496109_0417634
1253 Ga0496112_0002984
1254 Ga0496112_0056524
1255 Ga0496113_0001553
1256 Ga0496113_0009084
1257 Ga0501202_000890
1258 Ga0501207_014485
1259 Ga0501208_011598
1260 Ga0501209_003108
1261 Ga0501216_000165
1262 Ga0501217_000864
1263 Ga0501223_002577
1264 Ga0501224_003096
1265 Ga0501227_032909
1266 Ga0501233_003981
1267 Ga0501235_001296
1268 Ga0501242_000289
1269 Ga0501243_003534
1270 Ga0501249_017147
1271 Ga0501252_002877
1272 Ga0501253_002066
1273 Ga0501257_000806
1274 Ga0501258_000284
1275 Ga0501260_000451
1276 Ga0501261_002200
1277 Ga0501225_0004539
1278 Ga0501234_005667
1279 Ga0501245_005888
1280 Ga0501241_006309
1281 Ga0501262_002612
1282 Ga0501263_000502
1283 Ga0501266_001028
1284 Ga0501268_000021
1285 Ga0501270_002431
1286 Ga0501272_005074
1287 Ga0501273_006951
1288 Ga0501279_004264
1289 Ga0501212_000492
1290 nmdc:mga05p37_39820_c1
1291 nmdc:mga05p37_561996_c1
1292 nmdc:mga09592_242600_c1
1293 nmdc:mga09592_407795_c1
1294 nmdc:mga09592_62889_c1
1295 nmdc:mga0qj67_24601_c1
1296 nmdc:mga0qj67_79881_c1
1297 nmdc:mga06r32_4770_c1
1298 nmdc:mga06r32_9240_c1
1299 nmdc:mga08y16_491703_c1
1300 nmdc:mga0n895_7938_c1
1301 nmdc:mga0rr50_379725_c1
1302 nmdc:mga0rr50_570536_c1
1303 nmdc:mga0a205_194025_c1
1304 nmdc:mga0a205_61415_c1
1305 Ga0495601_0091505
1306 Ga0495619_0199225

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09678

Caa3_CtaG

Cytochrome c oxidase caa3 assembly factor (Caa3_CtaG)

39

276

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p3y-assembly1.cif.gz_H homomeric glua2 flip r/g-edited q/r-edited f231a mutant in tandem with tarp gamma-2, desensitized conformation 3 0.4658 147 266
8p3x-assembly1.cif.gz_F homomeric glua2 flip r/g-edited q/r-edited f231a mutant in tandem with tarp gamma-2, desensitized conformation 1 0.4586 147 266
8p3s-assembly1.cif.gz_F homomeric glua2 flip r/g-unedited q/r-edited f231a mutant in tandem with tarp gamma-2, desensitized conformation 2 0.4539 147 266
8c1r-assembly1.cif.gz_E resting state homomeric glua2 f231a mutant ampa receptor in complex with tarp gamma-2 0.4534 147 266
8c1p-assembly1.cif.gz_H active state homomeric glua1 ampa receptor in complex with tarp gamma 3 0.451 147 266
ID Description Score Start End Superfamily
af_P78369_1_191_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4727 161 260 1.20.140.150
af_A0A0R4IRK7_1_194_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.451 158 263 1.20.140.150
af_H8W3Z0_1_170_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4363 150 269 1.20.140.150
af_Q20410_5_311_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4059 54 276 1.20.1070.10
af_O17559_1_278_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.4004 58 263 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A3B9KF03-F1-model_v4 Cytochrome c oxidase assembly protein 0.9632 86 269 GO:0005886
AF-A0A7W1QJY8-F1-model_v4 Cytochrome c oxidase assembly protein 0.9628 52 269 GO:0005886
AF-A0A538U639-F1-model_v4 Cytochrome c oxidase assembly protein 0.9583 13 269 GO:0005886
AF-A0A535TAD9-F1-model_v4 Cytochrome c oxidase assembly protein 0.9582 16 202 GO:0005886
AF-A0A7V1VZ92-F1-model_v4 Cytochrome c oxidase assembly protein 0.9577 18 269 GO:0005886

Map