F472658

General Info

Members Datasets Scaffolds Average Seq Length
652 230 652 126

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10003993|Ga0070666_100039932
Length 148
Sequence MRRGTPATRGGFLGGSAKNEGTMHRSRINGILIDCNVDDIQAAARFWAQALGRPVDPDHPGTRGNYVMLETPPDEISVQIQRVDHESRVHIDIETDDIPAEIARLEKLGATVDKRLERWAVMRAPSGQRFCIVRVQREGFPKGATTWD

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
193 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 3.22
Rhizosphere 95.86
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1006172 3300001904 Bacteria 2020
2 JGI24736J21556_1010414 3300001904 Bacteria 1518
3 JGI24740J21852_10013781 3300001979 Bacteria 3005
4 JGI24737J22298_10041741 3300001990 Bacteria 1407
5 JGI24735J21928_10017941 3300002067 Bacteria 2186
6 JGI24738J21930_10019421 3300002075 Bacteria 1416
7 JGI24749J21850_1025010 3300002076 Bacteria 850
8 rootL2_10308702 3300003322 Bacteria 2070
9 Ga0065715_10117818 3300005293 Bacteria 2334
10 Ga0065715_10299185 3300005293 Bacteria 1045
11 Ga0065715_10359860 3300005293 Bacteria 937
12 Ga0070658_10008367 3300005327 Bacteria 8317
13 Ga0070658_10038048 3300005327 Bacteria 3880
14 Ga0070658_10082660 3300005327 Bacteria 2639
15 Ga0070658_10333353 3300005327 Bacteria 1297
16 Ga0070658_10364366 3300005327 Bacteria 1238
17 Ga0070658_11124524 3300005327 Unclassified 683
18 Ga0070658_11319635 3300005327 Bacteria 627
19 Ga0070676_10000682 3300005328 Bacteria 16629
20 Ga0070676_10420428 3300005328 Bacteria 934
21 Ga0070683_100006463 3300005329 Bacteria 9837
22 Ga0070683_100134672 3300005329 Bacteria 2339
23 Ga0070683_100675923 3300005329 Bacteria 989
24 Ga0070683_101876278 3300005329 Bacteria 576
25 Ga0070670_100002114 3300005331 Bacteria 16307
26 Ga0070677_10155498 3300005333 Bacteria 1068
27 Ga0068869_100106010 3300005334 Bacteria 2132
28 Ga0070666_10003993 3300005335 Bacteria 8950
29 Ga0070666_10871686 3300005335 Bacteria 665
30 Ga0070666_11357817 3300005335 Bacteria 531
31 Ga0070680_100005609 3300005336 Bacteria 9504
32 Ga0070682_100818093 3300005337 Bacteria 758
33 Ga0068868_100099536 3300005338 Bacteria 2352
34 Ga0070660_100005696 3300005339 Bacteria 8633
35 Ga0070660_100024581 3300005339 Bacteria 4469
36 Ga0070660_100047696 3300005339 Bacteria 3288
37 Ga0070660_100091750 3300005339 Bacteria 2396
38 Ga0070660_100139319 3300005339 Bacteria 1945
39 Ga0070660_100146733 3300005339 Bacteria 1895
40 Ga0070660_100188540 3300005339 Bacteria 1670
41 Ga0070660_100479480 3300005339 Bacteria 1033
42 Ga0070660_100633599 3300005339 Bacteria 895
43 Ga0070660_100731196 3300005339 Bacteria 830
44 Ga0070660_101608892 3300005339 Bacteria 553
45 Ga0070691_10001098 3300005341 Bacteria 11232
46 Ga0070661_100003037 3300005344 Bacteria 11542
47 Ga0070661_100005718 3300005344 Bacteria 8570
48 Ga0070661_100011620 3300005344 Bacteria 6138
49 Ga0070661_100024161 3300005344 Bacteria 4359
50 Ga0070661_100259232 3300005344 Bacteria 1344
51 Ga0070661_100630412 3300005344 Bacteria 869
52 Ga0070661_101176673 3300005344 Bacteria 641
53 Ga0070692_10015285 3300005345 Bacteria 3628
54 Ga0070692_10064669 3300005345 Bacteria 1935
55 Ga0070692_10850524 3300005345 Bacteria 627
56 Ga0070668_100000324 3300005347 Bacteria 31403
57 Ga0070668_100041353 3300005347 Bacteria 3531
58 Ga0070668_100284701 3300005347 Bacteria 1382
59 Ga0070668_100335509 3300005347 Bacteria 1276
60 Ga0070668_101483390 3300005347 Bacteria 620
61 Ga0070669_100033427 3300005353 Bacteria 3720
62 Ga0070669_100069490 3300005353 Bacteria 2601
63 Ga0070669_100771678 3300005353 Bacteria 815
64 Ga0070669_101256360 3300005353 Bacteria 641
65 Ga0070675_100000985 3300005354 Bacteria 20370
66 Ga0070675_100017593 3300005354 Bacteria 5682
67 Ga0070675_100316728 3300005354 Bacteria 1377
68 Ga0070675_100818058 3300005354 Bacteria 852
69 Ga0070671_100004978 3300005355 Bacteria 10579
70 Ga0070671_100153584 3300005355 Bacteria 1944
71 Ga0070674_100520985 3300005356 Bacteria 993
72 Ga0070673_100040573 3300005364 Bacteria 3572
73 Ga0070673_100083750 3300005364 Bacteria 2592
74 Ga0070673_100140940 3300005364 Bacteria 2033
75 Ga0070673_100288269 3300005364 Unclassified 1442
76 Ga0070673_100523984 3300005364 Bacteria 1074
77 Ga0070673_100819560 3300005364 Bacteria 860
78 Ga0070673_101080367 3300005364 Bacteria 749
79 Ga0070673_101319533 3300005364 Bacteria 678
80 Ga0070688_100169075 3300005365 Bacteria 1507
81 Ga0070659_100006134 3300005366 Bacteria 8676
82 Ga0070659_100016674 3300005366 Bacteria 5517
83 Ga0070659_100054153 3300005366 Bacteria 3160
84 Ga0070659_100221280 3300005366 Bacteria 1562
85 Ga0070659_100227000 3300005366 Bacteria 1542
86 Ga0070659_100287714 3300005366 Bacteria 1368
87 Ga0070659_101367946 3300005366 Bacteria 629
88 Ga0070659_101376117 3300005366 Bacteria 627
89 Ga0070659_101777541 3300005366 Bacteria 552
90 Ga0070667_100069495 3300005367 Bacteria 2997
91 Ga0070667_100390295 3300005367 Bacteria 1266
92 Ga0070667_100441412 3300005367 Bacteria 1188
93 Ga0070667_100506938 3300005367 Bacteria 1106
94 Ga0070667_100749822 3300005367 Bacteria 905
95 Ga0070667_100871989 3300005367 Bacteria 837
96 Ga0070667_100915066 3300005367 Bacteria 817
97 Ga0070709_10064558 3300005434 Bacteria 2341
98 Ga0070714_100216744 3300005435 Bacteria 1757
99 Ga0070714_100376063 3300005435 Bacteria 1338
100 Ga0070714_101374703 3300005435 Bacteria 689
101 Ga0070714_102173269 3300005435 Bacteria 540
102 Ga0070710_10963268 3300005437 Unclassified 619
103 Ga0070694_100007767 3300005444 Bacteria 6542
104 Ga0070694_100379040 3300005444 Bacteria 1103
105 Ga0070663_100023560 3300005455 Bacteria 4128
106 Ga0070663_100133454 3300005455 Bacteria 1888
107 Ga0070663_100133868 3300005455 Bacteria 1885
108 Ga0070663_100310306 3300005455 Bacteria 1265
109 Ga0070678_101453503 3300005456 Bacteria 641
110 Ga0070662_100007041 3300005457 Bacteria 7275
111 Ga0070662_100007360 3300005457 Bacteria 7132
112 Ga0070662_100013320 3300005457 Bacteria 5471
113 Ga0070662_100067175 3300005457 Bacteria 2633
114 Ga0070662_100350985 3300005457 Bacteria 1208
115 Ga0070662_100454299 3300005457 Bacteria 1064
116 Ga0070681_10275484 3300005458 Bacteria 1594
117 Ga0070681_10741242 3300005458 Bacteria 899
118 Ga0068867_100018109 3300005459 Bacteria 5005
119 Ga0070679_100191378 3300005530 Bacteria 2014
120 Ga0070679_100385755 3300005530 Bacteria 1347
121 Ga0070679_101361582 3300005530 Bacteria 656
122 Ga0070684_100004262 3300005535 Bacteria 10842
123 Ga0070684_100183051 3300005535 Bacteria 1905
124 Ga0068853_100017520 3300005539 Bacteria 5911
125 Ga0068853_100141186 3300005539 Bacteria 2162
126 Ga0068853_100167459 3300005539 Bacteria 1987
127 Ga0068853_100495049 3300005539 Unclassified 1154
128 Ga0068853_101318728 3300005539 Bacteria 698
129 Ga0070672_100001785 3300005543 Bacteria 13457
130 Ga0070672_100064740 3300005543 Bacteria 2889
131 Ga0070672_100067286 3300005543 Bacteria 2838
132 Ga0070672_100152268 3300005543 Bacteria 1914
133 Ga0070672_100247192 3300005543 Bacteria 1502
134 Ga0070686_100247301 3300005544 Bacteria 1301
135 Ga0070686_101787748 3300005544 Bacteria 523
136 Ga0070695_100768511 3300005545 Bacteria 770
137 Ga0070696_100705125 3300005546 Bacteria 823
138 Ga0070693_100109587 3300005547 Unclassified 1696
139 Ga0070665_100002713 3300005548 Bacteria 19193
140 Ga0070665_100493093 3300005548 Bacteria 1236
141 Ga0070704_100291665 3300005549 Bacteria 1356
142 Ga0068855_100000075 3300005563 Bacteria 119094
143 Ga0068855_100003629 3300005563 Bacteria 18867
144 Ga0068855_100013206 3300005563 Bacteria 9963
145 Ga0068855_100072813 3300005563 Bacteria 3993
146 Ga0068855_100207311 3300005563 Bacteria 2205
147 Ga0068855_100277132 3300005563 Bacteria 1864
148 Ga0068855_100841879 3300005563 Bacteria 972
149 Ga0068855_101063767 3300005563 Bacteria 847
150 Ga0068855_101186168 3300005563 Bacteria 794
151 Ga0068855_101480022 3300005563 Bacteria 698
152 Ga0068855_101857061 3300005563 Unclassified 611
153 Ga0068855_102167203 3300005563 Unclassified 558
154 Ga0070664_100005887 3300005564 Bacteria 9901
155 Ga0070664_100008847 3300005564 Bacteria 8159
156 Ga0070664_100014109 3300005564 Bacteria 6517
157 Ga0070664_100025221 3300005564 Bacteria 4925
158 Ga0070664_100369761 3300005564 Unclassified 1307
159 Ga0070664_100385040 3300005564 Bacteria 1281
160 Ga0068857_100013770 3300005577 Bacteria 7047
161 Ga0068857_100019440 3300005577 Bacteria 5964
162 Ga0068857_100052857 3300005577 Bacteria 3603
163 Ga0068857_100108558 3300005577 Bacteria 2493
164 Ga0068857_100500219 3300005577 Bacteria 1141
165 Ga0068857_100626936 3300005577 Bacteria 1018
166 Ga0068854_100078415 3300005578 Bacteria 2433
167 Ga0068854_100147680 3300005578 Bacteria 1810
168 Ga0068854_100194632 3300005578 Bacteria 1590
169 Ga0068854_100313443 3300005578 Bacteria 1273
170 Ga0068854_100322568 3300005578 Unclassified 1256
171 Ga0068854_100440084 3300005578 Bacteria 1086
172 Ga0068854_101113783 3300005578 Bacteria 704
173 Ga0068856_100032566 3300005614 Bacteria 5103
174 Ga0068856_100062204 3300005614 Bacteria 3687
175 Ga0068856_100350280 3300005614 Bacteria 1495
176 Ga0068856_101868135 3300005614 Bacteria 612
177 Ga0068856_101939991 3300005614 Bacteria 600
178 Ga0068856_102447368 3300005614 Bacteria 529
179 Ga0068852_100003664 3300005616 Bacteria 10765
180 Ga0068852_100018832 3300005616 Bacteria 5448
181 Ga0068852_100126196 3300005616 Bacteria 2350
182 Ga0068852_100590133 3300005616 Bacteria 1114
183 Ga0068852_100610757 3300005616 Bacteria 1095
184 Ga0068852_100764901 3300005616 Bacteria 979
185 Ga0068852_100821153 3300005616 Bacteria 944
186 Ga0068852_101284553 3300005616 Bacteria 753
187 Ga0068852_101738783 3300005616 Bacteria 646
188 Ga0068852_102247188 3300005616 Bacteria 567
189 Ga0068859_100312936 3300005617 Bacteria 1664
190 Ga0068859_100502409 3300005617 Bacteria 1308
191 Ga0068859_102136374 3300005617 Bacteria 618
192 Ga0068864_101366082 3300005618 Bacteria 710
193 Ga0068866_10254797 3300005718 Bacteria 1076
194 Ga0068861_100100331 3300005719 Bacteria 2301
195 Ga0068851_10165375 3300005834 Bacteria 1218
196 Ga0068851_10871071 3300005834 Bacteria 563
197 Ga0068870_10306884 3300005840 Bacteria 1004
198 Ga0068870_11066879 3300005840 Bacteria 579
199 Ga0068863_100147126 3300005841 Bacteria 2254
200 Ga0068858_100018374 3300005842 Bacteria 6547
201 Ga0068860_100013708 3300005843 Bacteria 7948
202 Ga0068860_100020068 3300005843 Bacteria 6474
203 Ga0068860_100107926 3300005843 Bacteria 2660
204 Ga0068862_100001114 3300005844 Bacteria 25468
205 Ga0068862_100346889 3300005844 Bacteria 1376
206 Ga0068862_100406636 3300005844 Bacteria 1274
207 Ga0068862_100424819 3300005844 Bacteria 1248
208 Ga0068862_100425160 3300005844 Bacteria 1247
209 Ga0070712_100226785 3300006175 Bacteria 1482
210 Ga0097621_100082423 3300006237 Bacteria 2678
211 Ga0097621_100199751 3300006237 Bacteria 1735
212 Ga0068871_100039025 3300006358 Bacteria 3797
213 Ga0075428_100100496 3300006844 Bacteria 3154
214 Ga0075428_100926010 3300006844 Bacteria 924
215 Ga0075428_102128889 3300006844 Bacteria 580
216 Ga0075430_100044619 3300006846 Bacteria 3748
217 Ga0075433_10003509 3300006852 Bacteria 12116
218 Ga0075429_101087604 3300006880 Bacteria 698
219 Ga0075429_101260124 3300006880 Unclassified 645
220 Ga0068865_100198134 3300006881 Bacteria 1557
221 Ga0068865_100794570 3300006881 Bacteria 816
222 Ga0068865_100844297 3300006881 Bacteria 793
223 Ga0068865_101055227 3300006881 Bacteria 714
224 Ga0097620_100312951 3300006931 Bacteria 1664
225 Ga0097620_100502390 3300006931 Bacteria 1308
226 Ga0097620_102136113 3300006931 Bacteria 618
227 Ga0105250_10382911 3300009092 Bacteria 621
228 Ga0105240_10000091 3300009093 Bacteria 182507
229 Ga0105240_10063524 3300009093 Bacteria 4593
230 Ga0105240_10379092 3300009093 Bacteria 1598
231 Ga0105240_10401634 3300009093 Bacteria 1543
232 Ga0105245_10442388 3300009098 Bacteria 1307
233 Ga0105245_10648439 3300009098 Bacteria 1086
234 Ga0105247_10556048 3300009101 Bacteria 844
235 Ga0114129_10028253 3300009147 Bacteria 7948
236 Ga0114129_10414454 3300009147 Bacteria 1773
237 Ga0105243_10317129 3300009148 Bacteria 1419
238 Ga0105241_10105023 3300009174 Bacteria 2252
239 Ga0105241_10157481 3300009174 Bacteria 1864
240 Ga0105241_10502351 3300009174 Bacteria 1081
241 Ga0105242_10096286 3300009176 Bacteria 2500
242 Ga0105248_10014420 3300009177 Bacteria 8699
243 Ga0105248_10074910 3300009177 Bacteria 3804
244 Ga0105248_10213759 3300009177 Bacteria 2172
245 Ga0105248_10264452 3300009177 Bacteria 1936
246 Ga0105248_10748728 3300009177 Bacteria 1102
247 Ga0105237_10117280 3300009545 Bacteria 2656
248 Ga0105237_10528314 3300009545 Bacteria 1186
249 Ga0105237_10586016 3300009545 Bacteria 1122
250 Ga0105237_12549982 3300009545 Bacteria 522
251 Ga0105238_10007597 3300009551 Bacteria 10862
252 Ga0105238_10014453 3300009551 Bacteria 7983
253 Ga0105238_10078669 3300009551 Bacteria 3288
254 Ga0105238_12002746 3300009551 Bacteria 613
255 Ga0105249_10118535 3300009553 Bacteria 2512
256 Ga0105249_10248885 3300009553 Bacteria 1761
257 Ga0105249_10848854 3300009553 Bacteria 979
258 Ga0105239_10000376 3300010375 Bacteria 65247
259 Ga0105239_10008832 3300010375 Bacteria 11406
260 Ga0105239_10415258 3300010375 Bacteria 1524
261 Ga0105239_10836534 3300010375 Bacteria 1055
262 Ga0157373_10008634 3300013100 Bacteria 7560
263 Ga0157373_10057439 3300013100 Bacteria 2760
264 Ga0157373_10071404 3300013100 Bacteria 2452
265 Ga0157373_10557127 3300013100 Bacteria 832
266 Ga0157373_10873377 3300013100 Bacteria 666
267 Ga0157373_10898740 3300013100 Bacteria 657
268 Ga0157371_10018979 3300013102 Bacteria 5076
269 Ga0157371_10029534 3300013102 Bacteria 3962
270 Ga0157371_10044815 3300013102 Bacteria 3149
271 Ga0157371_10226217 3300013102 Bacteria 1344
272 Ga0157371_11282031 3300013102 Bacteria 566
273 Ga0157370_10029403 3300013104 Bacteria 5392
274 Ga0157370_10033009 3300013104 Bacteria 5048
275 Ga0157370_10042598 3300013104 Bacteria 4373
276 Ga0157370_10336179 3300013104 Bacteria 1392
277 Ga0157370_11518941 3300013104 Bacteria 602
278 Ga0157369_10010785 3300013105 Bacteria 10404
279 Ga0157369_10012071 3300013105 Bacteria 9811
280 Ga0157369_10059903 3300013105 Bacteria 4106
281 Ga0157369_10137856 3300013105 Bacteria 2582
282 Ga0157369_10173295 3300013105 Bacteria 2272
283 Ga0157369_10964278 3300013105 Unclassified 874
284 Ga0157369_11013663 3300013105 Bacteria 850
285 Ga0157374_10020068 3300013296 Bacteria 5925
286 Ga0157374_11151254 3300013296 Bacteria 797
287 Ga0157378_10070470 3300013297 Bacteria 3139
288 Ga0157378_10516400 3300013297 Unclassified 1195
289 Ga0157378_12580559 3300013297 Bacteria 560
290 Ga0163162_10115369 3300013306 Bacteria 2786
291 Ga0163162_10858705 3300013306 Bacteria 1022
292 Ga0157372_10001493 3300013307 Bacteria 25423
293 Ga0157372_10106338 3300013307 Bacteria 3210
294 Ga0157372_10212687 3300013307 Bacteria 2241
295 Ga0157372_11695258 3300013307 Bacteria 727
296 Ga0157375_10033918 3300013308 Bacteria 4856
297 Ga0157375_10125711 3300013308 Bacteria 2679
298 Ga0157375_10229296 3300013308 Bacteria 2016
299 Ga0163163_10000714 3300014325 Bacteria 28173
300 Ga0163163_10273607 3300014325 Bacteria 1740
301 Ga0163163_11195182 3300014325 Bacteria 823
302 Ga0182008_10122667 3300014497 Bacteria 1292
303 Ga0157377_11082306 3300014745 Bacteria 613
304 Ga0157379_10511762 3300014968 Bacteria 1113
305 Ga0163161_10080229 3300017792 Bacteria 2401
306 Ga0163161_10275018 3300017792 Bacteria 1319
307 Ga0206353_12059669 3300020082 Bacteria 1142
308 Ga0207697_10070463 3300025315 Bacteria 1464
309 Ga0207656_10088861 3300025321 Bacteria 1400
310 Ga0207656_10174304 3300025321 Bacteria 1029
311 Ga0207642_10145801 3300025899 Bacteria 1254
312 Ga0207688_10011568 3300025901 Bacteria 4802
313 Ga0207688_10146906 3300025901 Bacteria 1390
314 Ga0207680_10015740 3300025903 Bacteria 3954
315 Ga0207680_10027901 3300025903 Bacteria 3152
316 Ga0207680_10042520 3300025903 Bacteria 2659
317 Ga0207647_10000304 3300025904 Bacteria 40516
318 Ga0207647_10001979 3300025904 Bacteria 15655
319 Ga0207647_10017375 3300025904 Bacteria 4890
320 Ga0207647_10088294 3300025904 Bacteria 1851
321 Ga0207699_10261558 3300025906 Bacteria 1196
322 Ga0207699_10965440 3300025906 Unclassified 630
323 Ga0207645_10002830 3300025907 Bacteria 13470
324 Ga0207645_10306502 3300025907 Bacteria 1058
325 Ga0207643_10075082 3300025908 Bacteria 1950
326 Ga0207705_10000135 3300025909 Bacteria 79350
327 Ga0207705_10006741 3300025909 Bacteria 8486
328 Ga0207705_10042065 3300025909 Bacteria 3280
329 Ga0207705_10078959 3300025909 Bacteria 2396
330 Ga0207705_10181348 3300025909 Bacteria 1589
331 Ga0207705_10523936 3300025909 Bacteria 921
332 Ga0207705_10748777 3300025909 Unclassified 759
333 Ga0207705_10877659 3300025909 Bacteria 695
334 Ga0207705_11033323 3300025909 Bacteria 634
335 Ga0207654_10015255 3300025911 Bacteria 3984
336 Ga0207707_10914750 3300025912 Unclassified 724
337 Ga0207695_10000018 3300025913 Bacteria 766611
338 Ga0207695_10000182 3300025913 Bacteria 184125
339 Ga0207695_10011980 3300025913 Bacteria 10434
340 Ga0207695_10268379 3300025913 Bacteria 1603
341 Ga0207671_10005975 3300025914 Bacteria 11019
342 Ga0207671_10239481 3300025914 Bacteria 1425
343 Ga0207660_10023742 3300025917 Bacteria 4144
344 Ga0207657_10000218 3300025919 Bacteria 59661
345 Ga0207657_10004622 3300025919 Bacteria 14538
346 Ga0207657_10015148 3300025919 Bacteria 7488
347 Ga0207657_10015997 3300025919 Bacteria 7243
348 Ga0207657_10095191 3300025919 Bacteria 2478
349 Ga0207657_10227527 3300025919 Unclassified 1492
350 Ga0207657_10499053 3300025919 Bacteria 953
351 Ga0207657_10744505 3300025919 Bacteria 760
352 Ga0207649_10001300 3300025920 Bacteria 14891
353 Ga0207649_10063433 3300025920 Bacteria 2333
354 Ga0207649_10067134 3300025920 Bacteria 2276
355 Ga0207649_10165348 3300025920 Bacteria 1536
356 Ga0207649_10288029 3300025920 Bacteria 1197
357 Ga0207649_10844935 3300025920 Bacteria 716
358 Ga0207649_11108614 3300025920 Bacteria 624
359 Ga0207652_10187838 3300025921 Bacteria 1858
360 Ga0207652_11102425 3300025921 Bacteria 694
361 Ga0207681_10002262 3300025923 Bacteria 12234
362 Ga0207681_10032831 3300025923 Bacteria 3401
363 Ga0207681_10155675 3300025923 Bacteria 1717
364 Ga0207681_10271946 3300025923 Unclassified 1330
365 Ga0207694_10000018 3300025924 Bacteria 331281
366 Ga0207694_10006600 3300025924 Bacteria 8819
367 Ga0207694_10034661 3300025924 Bacteria 3871
368 Ga0207694_10260832 3300025924 Bacteria 1420
369 Ga0207650_10002617 3300025925 Bacteria 12461
370 Ga0207650_10197756 3300025925 Bacteria 1609
371 Ga0207659_10008178 3300025926 Bacteria 6480
372 Ga0207659_10457188 3300025926 Bacteria 1076
373 Ga0207664_10477144 3300025929 Bacteria 1115
374 Ga0207664_10602573 3300025929 Bacteria 987
375 Ga0207644_10006138 3300025931 Bacteria 7836
376 Ga0207644_10025184 3300025931 Bacteria 4090
377 Ga0207644_10399847 3300025931 Bacteria 1123
378 Ga0207644_10803307 3300025931 Bacteria 787
379 Ga0207690_10002193 3300025932 Bacteria 11904
380 Ga0207690_10009646 3300025932 Bacteria 5732
381 Ga0207690_10046075 3300025932 Bacteria 2886
382 Ga0207690_10277460 3300025932 Bacteria 1304
383 Ga0207690_10829861 3300025932 Bacteria 765
384 Ga0207690_11220959 3300025932 Bacteria 628
385 Ga0207690_11678324 3300025932 Bacteria 531
386 Ga0207706_10007550 3300025933 Bacteria 10061
387 Ga0207706_10009959 3300025933 Bacteria 8711
388 Ga0207706_10136165 3300025933 Bacteria 2161
389 Ga0207706_10223260 3300025933 Bacteria 1649
390 Ga0207706_10251426 3300025933 Bacteria 1544
391 Ga0207706_10682304 3300025933 Bacteria 878
392 Ga0207706_10847014 3300025933 Bacteria 774
393 Ga0207686_10644790 3300025934 Bacteria 837
394 Ga0207709_10455537 3300025935 Bacteria 990
395 Ga0207669_10237469 3300025937 Bacteria 1349
396 Ga0207669_10319264 3300025937 Bacteria 1188
397 Ga0207704_10136713 3300025938 Bacteria 1707
398 Ga0207704_11002057 3300025938 Bacteria 706
399 Ga0207691_10003132 3300025940 Bacteria 16163
400 Ga0207691_10023380 3300025940 Bacteria 5817
401 Ga0207691_10059576 3300025940 Bacteria 3471
402 Ga0207691_10060280 3300025940 Bacteria 3448
403 Ga0207691_10064573 3300025940 Bacteria 3316
404 Ga0207711_10056934 3300025941 Bacteria 3360
405 Ga0207711_10444335 3300025941 Bacteria 1207
406 Ga0207711_11596356 3300025941 Bacteria 596
407 Ga0207711_12059541 3300025941 Bacteria 513
408 Ga0207689_10024146 3300025942 Bacteria 5100
409 Ga0207689_10131983 3300025942 Bacteria 2056
410 Ga0207661_10019687 3300025944 Bacteria 5037
411 Ga0207661_10036199 3300025944 Bacteria 3851
412 Ga0207661_10074018 3300025944 Bacteria 2791
413 Ga0207661_11210291 3300025944 Bacteria 695
414 Ga0207679_10003933 3300025945 Bacteria 9227
415 Ga0207679_10045226 3300025945 Bacteria 3183
416 Ga0207679_10072460 3300025945 Bacteria 2602
417 Ga0207679_10138512 3300025945 Bacteria 1963
418 Ga0207679_10220984 3300025945 Bacteria 1594
419 Ga0207667_10000052 3300025949 Bacteria 232415
420 Ga0207667_10000122 3300025949 Bacteria 121588
421 Ga0207667_10002731 3300025949 Bacteria 21813
422 Ga0207667_10024256 3300025949 Bacteria 6663
423 Ga0207667_10114384 3300025949 Bacteria 2781
424 Ga0207667_10145736 3300025949 Bacteria 2438
425 Ga0207667_11486505 3300025949 Bacteria 649
426 Ga0207651_10036061 3300025960 Bacteria 3224
427 Ga0207651_10600119 3300025960 Bacteria 962
428 Ga0207651_10799366 3300025960 Bacteria 836
429 Ga0207651_11243576 3300025960 Unclassified 669
430 Ga0207651_11288307 3300025960 Bacteria 657
431 Ga0207712_10046019 3300025961 Bacteria 3023
432 Ga0207712_10085485 3300025961 Bacteria 2309
433 Ga0207712_10589072 3300025961 Bacteria 961
434 Ga0207668_10000176 3300025972 Bacteria 43587
435 Ga0207668_10316515 3300025972 Bacteria 1293
436 Ga0207668_10646649 3300025972 Bacteria 925
437 Ga0207668_11646693 3300025972 Bacteria 579
438 Ga0207640_10003064 3300025981 Bacteria 9004
439 Ga0207640_10088899 3300025981 Bacteria 2134
440 Ga0207640_10099471 3300025981 Bacteria 2036
441 Ga0207640_10397049 3300025981 Bacteria 1122
442 Ga0207640_10788061 3300025981 Unclassified 822
443 Ga0207658_10050488 3300025986 Bacteria 3061
444 Ga0207658_10110539 3300025986 Bacteria 2171
445 Ga0207658_10125147 3300025986 Bacteria 2056
446 Ga0207658_10182202 3300025986 Bacteria 1739
447 Ga0207677_10188122 3300026023 Bacteria 1631
448 Ga0207677_10755238 3300026023 Bacteria 867
449 Ga0207703_10015939 3300026035 Bacteria 5861
450 Ga0207703_11029149 3300026035 Bacteria 790
451 Ga0207639_10001293 3300026041 Bacteria 16903
452 Ga0207639_10025287 3300026041 Bacteria 4304
453 Ga0207639_10123686 3300026041 Bacteria 2130
454 Ga0207639_11291569 3300026041 Bacteria 685
455 Ga0207678_10006571 3300026067 Bacteria 10308
456 Ga0207678_10237657 3300026067 Bacteria 1560
457 Ga0207678_10614225 3300026067 Bacteria 954
458 Ga0207702_10008605 3300026078 Bacteria 8605
459 Ga0207702_10029498 3300026078 Bacteria 4565
460 Ga0207702_10148145 3300026078 Bacteria 2132
461 Ga0207702_11911831 3300026078 Bacteria 585
462 Ga0207641_11078794 3300026088 Bacteria 801
463 Ga0207648_10001235 3300026089 Bacteria 28702
464 Ga0207648_10552020 3300026089 Bacteria 1058
465 Ga0207648_12146299 3300026089 Bacteria 519
466 Ga0207676_10161763 3300026095 Bacteria 1940
467 Ga0207674_10003594 3300026116 Bacteria 18907
468 Ga0207674_10005519 3300026116 Bacteria 15020
469 Ga0207674_10027930 3300026116 Bacteria 5962
470 Ga0207674_10048179 3300026116 Bacteria 4363
471 Ga0207675_100078855 3300026118 Bacteria 3086
472 Ga0207675_100336443 3300026118 Bacteria 1477
473 Ga0207675_100544554 3300026118 Bacteria 1159
474 Ga0207683_10375386 3300026121 Bacteria 1307
475 Ga0207683_10777150 3300026121 Bacteria 889
476 Ga0207698_10002558 3300026142 Bacteria 10794
477 Ga0207698_10043642 3300026142 Bacteria 3361
478 Ga0207698_10094813 3300026142 Bacteria 2455
479 Ga0207698_10493426 3300026142 Bacteria 1190
480 Ga0207698_10744209 3300026142 Bacteria 979
481 Ga0207698_11939163 3300026142 Bacteria 604
482 Ga0268266_10014168 3300028379 Bacteria 6860
483 Ga0268266_10068863 3300028379 Bacteria 3065
484 Ga0268266_11498434 3300028379 Bacteria 650
485 Ga0268265_10000904 3300028380 Bacteria 27551
486 Ga0268265_10048556 3300028380 Bacteria 3186
487 Ga0268265_10156085 3300028380 Bacteria 1931
488 Ga0268265_10569408 3300028380 Bacteria 1078
489 Ga0268264_10001156 3300028381 Bacteria 25715
490 Ga0268264_10016372 3300028381 Bacteria 6070
491 Ga0307408_100415632 3300031548 Bacteria 1158
492 Ga0307516_10111367 3300031730 Bacteria 2539
493 Ga0307413_10135808 3300031824 Bacteria 1691
494 Ga0307413_10265371 3300031824 Bacteria 1282
495 Ga0307413_10458826 3300031824 Bacteria 1013
496 Ga0307410_11374137 3300031852 Bacteria 619
497 Ga0307406_11667361 3300031901 Bacteria 564
498 Ga0307407_10422154 3300031903 Bacteria 961
499 Ga0307412_10157718 3300031911 Bacteria 1682
500 Ga0307412_10651269 3300031911 Bacteria 898
501 Ga0307409_100348334 3300031995 Bacteria 1397
502 Ga0307409_101055461 3300031995 Bacteria 832
503 Ga0307416_100071968 3300032002 Bacteria 2875
504 Ga0307416_100181694 3300032002 Bacteria 1972
505 Ga0307416_103027041 3300032002 Bacteria 562
506 Ga0307411_10014233 3300032005 Bacteria 4419
507 Ga0307411_10262106 3300032005 Bacteria 1365
508 Ga0307415_100122261 3300032126 Bacteria 1954
509 Ga0307415_101287285 3300032126 Bacteria 692
510 Ga0373957_0161724 3300035120 Bacteria 922
511 Ga0373946_0441453 3300035171 Unclassified 662
512 Ga0395899_0008386 3300037312 Bacteria 7957
513 Ga0395899_0111018 3300037312 Bacteria 1971
514 Ga0395899_0129549 3300037312 Bacteria 1802
515 Ga0395899_0151857 3300037312 Bacteria 1641
516 Ga0395899_0199188 3300037312 Bacteria 1397
517 Ga0395899_0309678 3300037312 Bacteria 1066
518 Ga0395899_0656003 3300037312 Bacteria 662
519 Ga0395899_0705927 3300037312 Bacteria 632
520 Ga0395900_0009073 3300037418 Bacteria 10195
521 Ga0395900_0083382 3300037418 Bacteria 3284
522 Ga0395900_0087987 3300037418 Bacteria 3193
523 Ga0395900_0122334 3300037418 Bacteria 2669
524 Ga0395900_0142309 3300037418 Bacteria 2455
525 Ga0395900_0172489 3300037418 Bacteria 2201
526 Ga0395900_0179898 3300037418 Bacteria 2149
527 Ga0395900_0463639 3300037418 Bacteria 1221
528 Ga0395900_0544104 3300037418 Bacteria 1106
529 Ga0395900_0577600 3300037418 Bacteria 1066
530 Ga0395900_0816722 3300037418 Unclassified 859
531 Ga0395898_0174900 3300037466 Bacteria 2052
532 Ga0395898_0224343 3300037466 Bacteria 1792
533 Ga0395898_0239235 3300037466 Bacteria 1731
534 Ga0395898_0292965 3300037466 Bacteria 1552
535 Ga0395898_0486032 3300037466 Bacteria 1175
536 Ga0395898_0606387 3300037466 Bacteria 1037
537 Ga0395898_0758196 3300037466 Bacteria 912
538 Ga0395898_0997191 3300037466 Bacteria 773
539 Ga0395898_1272127 3300037466 Bacteria 666
540 Ga0395905_0001242 3300037471 Bacteria 31620
541 Ga0395905_0030728 3300037471 Bacteria 5058
542 Ga0395905_0069544 3300037471 Bacteria 3297
543 Ga0395905_0104679 3300037471 Bacteria 2656
544 Ga0395905_0139308 3300037471 Bacteria 2282
545 Ga0395905_0143489 3300037471 Bacteria 2247
546 Ga0395905_0156886 3300037471 Bacteria 2140
547 Ga0395905_0235192 3300037471 Bacteria 1713
548 Ga0395905_0352337 3300037471 Bacteria 1364
549 Ga0395905_0353532 3300037471 Bacteria 1361
550 Ga0395905_0363950 3300037471 Bacteria 1339
551 Ga0395905_0391449 3300037471 Bacteria 1284
552 Ga0395905_0587324 3300037471 Bacteria 1015
553 Ga0395905_0662350 3300037471 Bacteria 946
554 Ga0395905_0774781 3300037471 Bacteria 862
555 Ga0395905_0819293 3300037471 Unclassified 834
556 Ga0395905_1865644 3300037471 Bacteria 507
557 Ga0395901_0039984 3300038443 Bacteria 4854
558 Ga0395901_0070766 3300038443 Bacteria 3634
559 Ga0395901_0087694 3300038443 Bacteria 3254
560 Ga0395901_0091910 3300038443 Bacteria 3176
561 Ga0395901_0351820 3300038443 Bacteria 1520
562 Ga0395901_0438251 3300038443 Bacteria 1338
563 Ga0395901_0450315 3300038443 Bacteria 1316
564 Ga0395901_0484106 3300038443 Bacteria 1262
565 Ga0395901_0791437 3300038443 Bacteria 938
566 Ga0395901_0804646 3300038443 Unclassified 928
567 Ga0395901_0957150 3300038443 Bacteria 834
568 Ga0395901_1399795 3300038443 Bacteria 658
569 Ga0395901_1902151 3300038443 Bacteria 542
570 Ga0395901_2118286 3300038443 Unclassified 507
571 Ga0436365_1455190 3300039437 Bacteria 626
572 Ga0436363_0286509 3300039450 Unclassified 933
573 Ga0436362_0313465 3300039453 Bacteria 509
574 Ga0466972_0043338 3300044658 Bacteria 2186
575 Ga0466972_0124719 3300044658 Bacteria 1214
576 Ga0466965_0155271 3300044683 Bacteria 1198
577 Ga0466965_0286873 3300044683 Bacteria 890
578 Ga0466961_0245935 3300044693 Bacteria 1099
579 Ga0466963_0098926 3300044694 Bacteria 1994
580 Ga0466971_0133143 3300044719 Bacteria 1155
581 Ga0466968_0554556 3300044735 Bacteria 577
582 Ga0466970_0157013 3300044765 Bacteria 1257
583 Ga0466957_0155899 3300044842 Bacteria 1480
584 Ga0466957_0341220 3300044842 Bacteria 1015
585 Ga0466959_0143961 3300045049 Bacteria 1683
586 Ga0466958_0376259 3300045836 Bacteria 915
587 Ga0466967_0025276 3300045976 Bacteria 4895
588 Ga0466967_0047283 3300045976 Bacteria 3750
589 Ga0466967_0182456 3300045976 Bacteria 1980
590 Ga0466967_0624932 3300045976 Bacteria 1064
591 Ga0466967_1396082 3300045976 Bacteria 697
592 Ga0495616_0063485 3300046513 Bacteria 1805
593 Ga0495622_0287546 3300046557 Bacteria 718
594 Ga0495668_0030068 3300046616 Bacteria 3068
595 Ga0495668_0328134 3300046616 Bacteria 839
596 Ga0495669_0000549 3300046684 Bacteria 16751
597 Ga0495669_0011110 3300046684 Bacteria 3815
598 Ga0495669_0138276 3300046684 Bacteria 1149
599 Ga0495669_0293543 3300046684 Bacteria 783
600 Ga0495669_0333553 3300046684 Bacteria 732
601 Ga0495604_1019052 3300047317 Bacteria 512
602 Ga0496100_0176715 3300048903 Bacteria 1542
603 Ga0496101_0463427 3300048904 Bacteria 1000
604 Ga0496101_0757758 3300048904 Bacteria 766
605 Ga0496104_0973694 3300048907 Unclassified 753
606 Ga0496106_0399771 3300048909 Bacteria 1104
607 Ga0496108_0131842 3300048911 Bacteria 2148
608 Ga0496108_0991350 3300048911 Unclassified 718
609 Ga0496109_0061968 3300048912 Bacteria 3420
610 Ga0496109_1700530 3300048912 Bacteria 565
611 Ga0496110_1262798 3300048913 Unclassified 648
612 Ga0496111_0005000 3300048914 Bacteria 8435
613 Ga0496111_0275715 3300048914 Unclassified 1248
614 Ga0496111_0483005 3300048914 Bacteria 913
615 Ga0496112_0010612 3300048915 Bacteria 8369
616 Ga0496112_0261489 3300048915 Bacteria 1680
617 Ga0496112_0389025 3300048915 Unclassified 1335
618 Ga0496112_1156826 3300048915 Bacteria 691
619 Ga0496113_1023633 3300048916 Bacteria 650
620 Ga0496114_0053296 3300048917 Bacteria 3372
621 Ga0496114_0143355 3300048917 Bacteria 2070
622 Ga0496115_0001963 3300048918 Bacteria 14678
623 Ga0495682_0001599 3300049460 Bacteria 11741
624 Ga0501047_0008272 3300049581 Bacteria 9821
625 Ga0501067_0001368 3300049583 Bacteria 13198
626 Ga0501067_0018749 3300049583 Bacteria 3830
627 Ga0501068_1134089 3300049584 Bacteria 517
628 Ga0501069_0304112 3300049585 Bacteria 936
629 Ga0501070_0058487 3300049586 Bacteria 3196
630 Ga0501070_0341610 3300049586 Bacteria 1216
631 Ga0501071_0530908 3300049587 Bacteria 903
632 Ga0501071_1116940 3300049587 Unclassified 609
633 Ga0501072_0019146 3300049588 Bacteria 5287
634 Ga0501073_0283728 3300049589 Bacteria 1142
635 Ga0501073_1000480 3300049589 Bacteria 575
636 Ga0501074_0948379 3300049590 Unclassified 605
637 Ga0501079_0196512 3300049741 Bacteria 1575
638 Ga0501080_0293458 3300049742 Bacteria 1476
639 Ga0501080_0355792 3300049742 Bacteria 1321
640 Ga0501083_0427276 3300049744 Unclassified 862
641 nmdc:mga05p37_560584_c1 3300050507 Bacteria 1298
642 nmdc:mga09592_544277_c1 3300050508 Bacteria 997
643 nmdc:mga09592_990168_c1 3300050508 Bacteria 703
644 nmdc:mga0qj67_22674_c1 3300050509 Bacteria 4824
645 nmdc:mga06r32_23609_c1 3300050510 Bacteria 5693
646 nmdc:mga06r32_305613_c1 3300050510 Bacteria 1576
647 nmdc:mga08y16_544379_c1 3300050511 Bacteria 1175
648 nmdc:mga0a205_696_c1 3300050515 Bacteria 26947
649 Ga0500655_015682 3300053133 Bacteria 1391
650 Ga0500655_069298 3300053133 Bacteria 717
651 Ga0501084_0185405 3300054114 Bacteria 1756
652 Ga0501082_1272647 3300060353 Unclassified 643

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10308702 rootL2_103087022 120
2 3300001904 JGI24736J21556_1006172 JGI24736J21556_10061722 126
3 3300001904 JGI24736J21556_1010414 JGI24736J21556_10104141 126
4 3300001979 JGI24740J21852_10013781 JGI24740J21852_100137812 126
5 3300001990 JGI24737J22298_10041741 JGI24737J22298_100417412 126
6 3300002067 JGI24735J21928_10017941 JGI24735J21928_100179413 126
7 3300002075 JGI24738J21930_10019421 JGI24738J21930_100194212 126
8 3300002076 JGI24749J21850_1025010 JGI24749J21850_10250102 126
9 3300005293 Ga0065715_10117818 Ga0065715_101178182 126
10 3300005293 Ga0065715_10299185 Ga0065715_102991852 126
11 3300005293 Ga0065715_10359860 Ga0065715_103598602 126
12 3300005327 Ga0070658_10008367 Ga0070658_100083671 126
13 3300005327 Ga0070658_10038048 Ga0070658_100380484 126
14 3300005327 Ga0070658_10082660 Ga0070658_100826602 126
15 3300005327 Ga0070658_10333353 Ga0070658_103333533 126
16 3300005327 Ga0070658_10364366 Ga0070658_103643662 126
17 3300005327 Ga0070658_11124524 Ga0070658_111245241 126
18 3300005327 Ga0070658_11319635 Ga0070658_113196351 126
19 3300005328 Ga0070676_10000682 Ga0070676_1000068221 126
20 3300005328 Ga0070676_10420428 Ga0070676_104204282 126
21 3300005329 Ga0070683_100006463 Ga0070683_1000064632 126
22 3300005329 Ga0070683_100134672 Ga0070683_1001346723 126
23 3300005329 Ga0070683_100675923 Ga0070683_1006759231 126
24 3300005329 Ga0070683_101876278 Ga0070683_1018762781 126
25 3300005331 Ga0070670_100002114 Ga0070670_10000211411 126
26 3300005333 Ga0070677_10155498 Ga0070677_101554982 126
27 3300005334 Ga0068869_100106010 Ga0068869_1001060102 126
28 3300005335 Ga0070666_10003993 Ga0070666_100039932 126
29 3300005335 Ga0070666_10871686 Ga0070666_108716861 126
30 3300005335 Ga0070666_11357817 Ga0070666_113578171 126
31 3300005336 Ga0070680_100005609 Ga0070680_1000056096 126
32 3300005337 Ga0070682_100818093 Ga0070682_1008180931 126
33 3300005338 Ga0068868_100099536 Ga0068868_1000995362 126
34 3300005339 Ga0070660_100005696 Ga0070660_1000056968 126
35 3300005339 Ga0070660_100024581 Ga0070660_1000245811 126
36 3300005339 Ga0070660_100047696 Ga0070660_1000476964 126
37 3300005339 Ga0070660_100091750 Ga0070660_1000917503 126
38 3300005339 Ga0070660_100139319 Ga0070660_1001393192 126
39 3300005339 Ga0070660_100146733 Ga0070660_1001467332 126
40 3300005339 Ga0070660_100188540 Ga0070660_1001885402 126
41 3300005339 Ga0070660_100479480 Ga0070660_1004794802 126
42 3300005339 Ga0070660_100633599 Ga0070660_1006335992 126
43 3300005339 Ga0070660_100731196 Ga0070660_1007311961 126
44 3300005339 Ga0070660_101608892 Ga0070660_1016088921 126
45 3300005341 Ga0070691_10001098 Ga0070691_1000109813 126
46 3300005344 Ga0070661_100003037 Ga0070661_10000303710 126
47 3300005344 Ga0070661_100005718 Ga0070661_10000571812 126
48 3300005344 Ga0070661_100011620 Ga0070661_1000116202 126
49 3300005344 Ga0070661_100024161 Ga0070661_1000241613 126
50 3300005344 Ga0070661_100259232 Ga0070661_1002592322 126
51 3300005344 Ga0070661_100630412 Ga0070661_1006304122 126
52 3300005344 Ga0070661_101176673 Ga0070661_1011766731 126
53 3300005345 Ga0070692_10015285 Ga0070692_100152853 126
54 3300005345 Ga0070692_10064669 Ga0070692_100646692 126
55 3300005345 Ga0070692_10850524 Ga0070692_108505241 126
56 3300005347 Ga0070668_100000324 Ga0070668_10000032430 126
57 3300005347 Ga0070668_100041353 Ga0070668_1000413533 126
58 3300005347 Ga0070668_100284701 Ga0070668_1002847012 126
59 3300005347 Ga0070668_100335509 Ga0070668_1003355091 126
60 3300005347 Ga0070668_101483390 Ga0070668_1014833901 126
61 3300005353 Ga0070669_100033427 Ga0070669_1000334274 126
62 3300005353 Ga0070669_100069490 Ga0070669_1000694902 126
63 3300005353 Ga0070669_100771678 Ga0070669_1007716781 126
64 3300005353 Ga0070669_101256360 Ga0070669_1012563601 126
65 3300005354 Ga0070675_100000985 Ga0070675_1000009858 126
66 3300005354 Ga0070675_100017593 Ga0070675_1000175934 126
67 3300005354 Ga0070675_100316728 Ga0070675_1003167282 126
68 3300005354 Ga0070675_100818058 Ga0070675_1008180581 126
69 3300005355 Ga0070671_100004978 Ga0070671_10000497811 126
70 3300005355 Ga0070671_100153584 Ga0070671_1001535843 126
71 3300005356 Ga0070674_100520985 Ga0070674_1005209852 126
72 3300005364 Ga0070673_100040573 Ga0070673_1000405732 126
73 3300005364 Ga0070673_100083750 Ga0070673_1000837503 126
74 3300005364 Ga0070673_100140940 Ga0070673_1001409402 126
75 3300005364 Ga0070673_100288269 Ga0070673_1002882692 126
76 3300005364 Ga0070673_100523984 Ga0070673_1005239842 126
77 3300005364 Ga0070673_100819560 Ga0070673_1008195602 126
78 3300005364 Ga0070673_101080367 Ga0070673_1010803672 126
79 3300005364 Ga0070673_101319533 Ga0070673_1013195331 126
80 3300005365 Ga0070688_100169075 Ga0070688_1001690752 126
81 3300005366 Ga0070659_100006134 Ga0070659_1000061346 126
82 3300005366 Ga0070659_100016674 Ga0070659_1000166742 126
83 3300005366 Ga0070659_100054153 Ga0070659_1000541533 126
84 3300005366 Ga0070659_100221280 Ga0070659_1002212802 126
85 3300005366 Ga0070659_100227000 Ga0070659_1002270003 126
86 3300005366 Ga0070659_100287714 Ga0070659_1002877142 126
87 3300005366 Ga0070659_101367946 Ga0070659_1013679462 126
88 3300005366 Ga0070659_101376117 Ga0070659_1013761172 126
89 3300005366 Ga0070659_101777541 Ga0070659_1017775411 126
90 3300005367 Ga0070667_100069495 Ga0070667_1000694954 126
91 3300005367 Ga0070667_100390295 Ga0070667_1003902952 126
92 3300005367 Ga0070667_100441412 Ga0070667_1004414122 126
93 3300005367 Ga0070667_100506938 Ga0070667_1005069382 126
94 3300005367 Ga0070667_100749822 Ga0070667_1007498221 126
95 3300005367 Ga0070667_100871989 Ga0070667_1008719891 126
96 3300005367 Ga0070667_100915066 Ga0070667_1009150661 126
97 3300005434 Ga0070709_10064558 Ga0070709_100645583 126
98 3300005435 Ga0070714_100216744 Ga0070714_1002167443 126
99 3300005435 Ga0070714_100376063 Ga0070714_1003760632 126
100 3300005435 Ga0070714_101374703 Ga0070714_1013747031 126
101 3300005435 Ga0070714_102173269 Ga0070714_1021732691 126
102 3300005437 Ga0070710_10963268 Ga0070710_109632681 126
103 3300005444 Ga0070694_100007767 Ga0070694_1000077672 126
104 3300005444 Ga0070694_100379040 Ga0070694_1003790402 126
105 3300005455 Ga0070663_100023560 Ga0070663_1000235605 126
106 3300005455 Ga0070663_100133454 Ga0070663_1001334542 126
107 3300005455 Ga0070663_100133868 Ga0070663_1001338681 126
108 3300005455 Ga0070663_100310306 Ga0070663_1003103063 126
109 3300005456 Ga0070678_101453503 Ga0070678_1014535032 126
110 3300005457 Ga0070662_100007041 Ga0070662_1000070415 126
111 3300005457 Ga0070662_100007360 Ga0070662_1000073605 126
112 3300005457 Ga0070662_100013320 Ga0070662_1000133202 126
113 3300005457 Ga0070662_100067175 Ga0070662_1000671753 126
114 3300005457 Ga0070662_100350985 Ga0070662_1003509851 126
115 3300005457 Ga0070662_100454299 Ga0070662_1004542992 126
116 3300005458 Ga0070681_10275484 Ga0070681_102754843 126
117 3300005458 Ga0070681_10741242 Ga0070681_107412422 126
118 3300005459 Ga0068867_100018109 Ga0068867_1000181095 126
119 3300005530 Ga0070679_100191378 Ga0070679_1001913782 126
120 3300005530 Ga0070679_100385755 Ga0070679_1003857553 126
121 3300005530 Ga0070679_101361582 Ga0070679_1013615821 126
122 3300005535 Ga0070684_100004262 Ga0070684_1000042622 126
123 3300005535 Ga0070684_100183051 Ga0070684_1001830512 126
124 3300005539 Ga0068853_100017520 Ga0068853_1000175202 126
125 3300005539 Ga0068853_100141186 Ga0068853_1001411863 126
126 3300005539 Ga0068853_100167459 Ga0068853_1001674593 126
127 3300005539 Ga0068853_100495049 Ga0068853_1004950492 126
128 3300005539 Ga0068853_101318728 Ga0068853_1013187282 126
129 3300005543 Ga0070672_100001785 Ga0070672_1000017857 126
130 3300005543 Ga0070672_100064740 Ga0070672_1000647403 126
131 3300005543 Ga0070672_100067286 Ga0070672_1000672862 126
132 3300005543 Ga0070672_100152268 Ga0070672_1001522682 126
133 3300005543 Ga0070672_100247192 Ga0070672_1002471922 126
134 3300005544 Ga0070686_100247301 Ga0070686_1002473011 126
135 3300005544 Ga0070686_101787748 Ga0070686_1017877481 126
136 3300005545 Ga0070695_100768511 Ga0070695_1007685112 126
137 3300005546 Ga0070696_100705125 Ga0070696_1007051251 126
138 3300005547 Ga0070693_100109587 Ga0070693_1001095872 126
139 3300005548 Ga0070665_100002713 Ga0070665_10000271325 126
140 3300005548 Ga0070665_100493093 Ga0070665_1004930932 126
141 3300005549 Ga0070704_100291665 Ga0070704_1002916652 126
142 3300005563 Ga0068855_100000075 Ga0068855_10000007564 126
143 3300005563 Ga0068855_100003629 Ga0068855_10000362915 126
144 3300005563 Ga0068855_100013206 Ga0068855_10001320612 126
145 3300005563 Ga0068855_100072813 Ga0068855_1000728133 126
146 3300005563 Ga0068855_100207311 Ga0068855_1002073113 126
147 3300005563 Ga0068855_100277132 Ga0068855_1002771322 126
148 3300005563 Ga0068855_100841879 Ga0068855_1008418793 126
149 3300005563 Ga0068855_101063767 Ga0068855_1010637672 126
150 3300005563 Ga0068855_101186168 Ga0068855_1011861681 126
151 3300005563 Ga0068855_101480022 Ga0068855_1014800221 126
152 3300005563 Ga0068855_101857061 Ga0068855_1018570612 126
153 3300005563 Ga0068855_102167203 Ga0068855_1021672031 126
154 3300005564 Ga0070664_100005887 Ga0070664_10000588710 126
155 3300005564 Ga0070664_100008847 Ga0070664_1000088479 126
156 3300005564 Ga0070664_100014109 Ga0070664_1000141094 126
157 3300005564 Ga0070664_100025221 Ga0070664_1000252215 126
158 3300005564 Ga0070664_100369761 Ga0070664_1003697612 126
159 3300005564 Ga0070664_100385040 Ga0070664_1003850402 126
160 3300005577 Ga0068857_100013770 Ga0068857_1000137704 126
161 3300005577 Ga0068857_100019440 Ga0068857_1000194405 126
162 3300005577 Ga0068857_100052857 Ga0068857_1000528572 126
163 3300005577 Ga0068857_100108558 Ga0068857_1001085584 126
164 3300005577 Ga0068857_100500219 Ga0068857_1005002192 126
165 3300005577 Ga0068857_100626936 Ga0068857_1006269362 126
166 3300005578 Ga0068854_100078415 Ga0068854_1000784153 126
167 3300005578 Ga0068854_100147680 Ga0068854_1001476801 126
168 3300005578 Ga0068854_100194632 Ga0068854_1001946322 126
169 3300005578 Ga0068854_100313443 Ga0068854_1003134432 126
170 3300005578 Ga0068854_100322568 Ga0068854_1003225682 126
171 3300005578 Ga0068854_100440084 Ga0068854_1004400842 126
172 3300005578 Ga0068854_101113783 Ga0068854_1011137831 126
173 3300005614 Ga0068856_100032566 Ga0068856_1000325664 126
174 3300005614 Ga0068856_100062204 Ga0068856_1000622043 126
175 3300005614 Ga0068856_100350280 Ga0068856_1003502802 126
176 3300005614 Ga0068856_101868135 Ga0068856_1018681351 126
177 3300005614 Ga0068856_101939991 Ga0068856_1019399911 126
178 3300005614 Ga0068856_102447368 Ga0068856_1024473681 126
179 3300005616 Ga0068852_100003664 Ga0068852_10000366412 126
180 3300005616 Ga0068852_100018832 Ga0068852_1000188323 126
181 3300005616 Ga0068852_100126196 Ga0068852_1001261963 126
182 3300005616 Ga0068852_100590133 Ga0068852_1005901332 126
183 3300005616 Ga0068852_100610757 Ga0068852_1006107572 126
184 3300005616 Ga0068852_100764901 Ga0068852_1007649012 126
185 3300005616 Ga0068852_100821153 Ga0068852_1008211532 126
186 3300005616 Ga0068852_101284553 Ga0068852_1012845532 126
187 3300005616 Ga0068852_101738783 Ga0068852_1017387832 126
188 3300005616 Ga0068852_102247188 Ga0068852_1022471881 126
189 3300005617 Ga0068859_100312936 Ga0068859_1003129363 126
190 3300005617 Ga0068859_100502409 Ga0068859_1005024093 126
191 3300005617 Ga0068859_102136374 Ga0068859_1021363742 126
192 3300005618 Ga0068864_101366082 Ga0068864_1013660822 126
193 3300005718 Ga0068866_10254797 Ga0068866_102547972 126
194 3300005719 Ga0068861_100100331 Ga0068861_1001003313 126
195 3300005834 Ga0068851_10165375 Ga0068851_101653752 126
196 3300005834 Ga0068851_10871071 Ga0068851_108710711 126
197 3300005840 Ga0068870_10306884 Ga0068870_103068842 126
198 3300005840 Ga0068870_11066879 Ga0068870_110668792 126
199 3300005841 Ga0068863_100147126 Ga0068863_1001471263 126
200 3300005842 Ga0068858_100018374 Ga0068858_1000183743 126
201 3300005843 Ga0068860_100013708 Ga0068860_1000137082 126
202 3300005843 Ga0068860_100020068 Ga0068860_1000200683 126
203 3300005843 Ga0068860_100107926 Ga0068860_1001079263 126
204 3300005844 Ga0068862_100001114 Ga0068862_10000111413 126
205 3300005844 Ga0068862_100346889 Ga0068862_1003468892 126
206 3300005844 Ga0068862_100406636 Ga0068862_1004066362 126
207 3300005844 Ga0068862_100424819 Ga0068862_1004248192 126
208 3300005844 Ga0068862_100425160 Ga0068862_1004251602 126
209 3300006175 Ga0070712_100226785 Ga0070712_1002267852 126
210 3300006237 Ga0097621_100082423 Ga0097621_1000824233 126
211 3300006237 Ga0097621_100199751 Ga0097621_1001997512 126
212 3300006358 Ga0068871_100039025 Ga0068871_1000390252 126
213 3300006844 Ga0075428_100100496 Ga0075428_1001004962 126
214 3300006844 Ga0075428_100926010 Ga0075428_1009260101 126
215 3300006844 Ga0075428_102128889 Ga0075428_1021288891 126
216 3300006846 Ga0075430_100044619 Ga0075430_1000446195 126
217 3300006852 Ga0075433_10003509 Ga0075433_100035099 126
218 3300006880 Ga0075429_101087604 Ga0075429_1010876042 126
219 3300006880 Ga0075429_101260124 Ga0075429_1012601242 126
220 3300006881 Ga0068865_100198134 Ga0068865_1001981342 126
221 3300006881 Ga0068865_100794570 Ga0068865_1007945702 126
222 3300006881 Ga0068865_100844297 Ga0068865_1008442972 126
223 3300006881 Ga0068865_101055227 Ga0068865_1010552272 126
224 3300006931 Ga0097620_100312951 Ga0097620_1003129512 126
225 3300006931 Ga0097620_100502390 Ga0097620_1005023903 126
226 3300006931 Ga0097620_102136113 Ga0097620_1021361132 126
227 3300009092 Ga0105250_10382911 Ga0105250_103829111 126
228 3300009093 Ga0105240_10000091 Ga0105240_10000091168 126
229 3300009093 Ga0105240_10063524 Ga0105240_100635242 126
230 3300009093 Ga0105240_10379092 Ga0105240_103790923 126
231 3300009093 Ga0105240_10401634 Ga0105240_104016342 126
232 3300009098 Ga0105245_10442388 Ga0105245_104423882 126
233 3300009098 Ga0105245_10648439 Ga0105245_106484391 126
234 3300009101 Ga0105247_10556048 Ga0105247_105560481 126
235 3300009147 Ga0114129_10028253 Ga0114129_100282538 126
236 3300009147 Ga0114129_10414454 Ga0114129_104144543 126
237 3300009148 Ga0105243_10317129 Ga0105243_103171293 126
238 3300009174 Ga0105241_10105023 Ga0105241_101050233 126
239 3300009174 Ga0105241_10157481 Ga0105241_101574812 126
240 3300009174 Ga0105241_10502351 Ga0105241_105023512 126
241 3300009176 Ga0105242_10096286 Ga0105242_100962863 126
242 3300009177 Ga0105248_10014420 Ga0105248_100144208 126
243 3300009177 Ga0105248_10074910 Ga0105248_100749104 126
244 3300009177 Ga0105248_10213759 Ga0105248_102137592 126
245 3300009177 Ga0105248_10264452 Ga0105248_102644523 126
246 3300009177 Ga0105248_10748728 Ga0105248_107487282 126
247 3300009545 Ga0105237_10117280 Ga0105237_101172802 126
248 3300009545 Ga0105237_10528314 Ga0105237_105283142 126
249 3300009545 Ga0105237_10586016 Ga0105237_105860161 126
250 3300009545 Ga0105237_12549982 Ga0105237_125499821 126
251 3300009551 Ga0105238_10007597 Ga0105238_100075976 126
252 3300009551 Ga0105238_10014453 Ga0105238_100144532 126
253 3300009551 Ga0105238_10078669 Ga0105238_100786693 126
254 3300009551 Ga0105238_12002746 Ga0105238_120027462 126
255 3300009553 Ga0105249_10118535 Ga0105249_101185353 126
256 3300009553 Ga0105249_10248885 Ga0105249_102488852 126
257 3300009553 Ga0105249_10848854 Ga0105249_108488542 126
258 3300010375 Ga0105239_10000376 Ga0105239_1000037651 126
259 3300010375 Ga0105239_10008832 Ga0105239_100088325 126
260 3300010375 Ga0105239_10415258 Ga0105239_104152583 126
261 3300010375 Ga0105239_10836534 Ga0105239_108365342 126
262 3300013100 Ga0157373_10008634 Ga0157373_100086348 126
263 3300013100 Ga0157373_10057439 Ga0157373_100574393 126
264 3300013100 Ga0157373_10071404 Ga0157373_100714042 126
265 3300013100 Ga0157373_10557127 Ga0157373_105571272 126
266 3300013100 Ga0157373_10873377 Ga0157373_108733771 126
267 3300013100 Ga0157373_10898740 Ga0157373_108987402 126
268 3300013102 Ga0157371_10018979 Ga0157371_100189796 126
269 3300013102 Ga0157371_10029534 Ga0157371_100295342 126
270 3300013102 Ga0157371_10044815 Ga0157371_100448152 126
271 3300013102 Ga0157371_10226217 Ga0157371_102262172 126
272 3300013102 Ga0157371_11282031 Ga0157371_112820312 126
273 3300013104 Ga0157370_10029403 Ga0157370_100294037 126
274 3300013104 Ga0157370_10033009 Ga0157370_100330092 126
275 3300013104 Ga0157370_10042598 Ga0157370_100425982 126
276 3300013104 Ga0157370_10336179 Ga0157370_103361792 126
277 3300013104 Ga0157370_11518941 Ga0157370_115189411 126
278 3300013105 Ga0157369_10010785 Ga0157369_100107855 126
279 3300013105 Ga0157369_10012071 Ga0157369_100120712 126
280 3300013105 Ga0157369_10059903 Ga0157369_100599033 126
281 3300013105 Ga0157369_10137856 Ga0157369_101378564 126
282 3300013105 Ga0157369_10173295 Ga0157369_101732953 126
283 3300013105 Ga0157369_10964278 Ga0157369_109642782 126
284 3300013105 Ga0157369_11013663 Ga0157369_110136632 126
285 3300013296 Ga0157374_10020068 Ga0157374_100200688 126
286 3300013296 Ga0157374_11151254 Ga0157374_111512542 126
287 3300013297 Ga0157378_10070470 Ga0157378_100704706 126
288 3300013297 Ga0157378_10516400 Ga0157378_105164002 126
289 3300013297 Ga0157378_12580559 Ga0157378_125805591 126
290 3300013306 Ga0163162_10115369 Ga0163162_101153693 126
291 3300013306 Ga0163162_10858705 Ga0163162_108587052 126
292 3300013307 Ga0157372_10001493 Ga0157372_100014932 126
293 3300013307 Ga0157372_10106338 Ga0157372_101063382 126
294 3300013307 Ga0157372_10212687 Ga0157372_102126873 126
295 3300013307 Ga0157372_11695258 Ga0157372_116952581 126
296 3300013308 Ga0157375_10033918 Ga0157375_100339182 126
297 3300013308 Ga0157375_10125711 Ga0157375_101257113 126
298 3300013308 Ga0157375_10229296 Ga0157375_102292962 126
299 3300014325 Ga0163163_10000714 Ga0163163_1000071427 126
300 3300014325 Ga0163163_10273607 Ga0163163_102736072 126
301 3300014325 Ga0163163_11195182 Ga0163163_111951822 126
302 3300014497 Ga0182008_10122667 Ga0182008_101226672 126
303 3300014745 Ga0157377_11082306 Ga0157377_110823062 126
304 3300014968 Ga0157379_10511762 Ga0157379_105117622 126
305 3300017792 Ga0163161_10080229 Ga0163161_100802293 126
306 3300017792 Ga0163161_10275018 Ga0163161_102750183 126
307 3300020082 Ga0206353_12059669 Ga0206353_120596692 126
308 3300025315 Ga0207697_10070463 Ga0207697_100704632 126
309 3300025321 Ga0207656_10088861 Ga0207656_100888612 126
310 3300025321 Ga0207656_10174304 Ga0207656_101743042 126
311 3300025899 Ga0207642_10145801 Ga0207642_101458012 126
312 3300025901 Ga0207688_10011568 Ga0207688_100115682 126
313 3300025901 Ga0207688_10146906 Ga0207688_101469062 126
314 3300025903 Ga0207680_10015740 Ga0207680_100157406 126
315 3300025903 Ga0207680_10027901 Ga0207680_100279011 126
316 3300025903 Ga0207680_10042520 Ga0207680_100425204 126
317 3300025904 Ga0207647_10000304 Ga0207647_1000030421 126
318 3300025904 Ga0207647_10001979 Ga0207647_100019793 126
319 3300025904 Ga0207647_10017375 Ga0207647_100173752 126
320 3300025904 Ga0207647_10088294 Ga0207647_100882942 126
321 3300025906 Ga0207699_10261558 Ga0207699_102615582 126
322 3300025906 Ga0207699_10965440 Ga0207699_109654401 126
323 3300025907 Ga0207645_10002830 Ga0207645_100028303 126
324 3300025907 Ga0207645_10306502 Ga0207645_103065022 126
325 3300025908 Ga0207643_10075082 Ga0207643_100750822 126
326 3300025909 Ga0207705_10000135 Ga0207705_1000013573 126
327 3300025909 Ga0207705_10006741 Ga0207705_1000674111 126
328 3300025909 Ga0207705_10042065 Ga0207705_100420654 126
329 3300025909 Ga0207705_10078959 Ga0207705_100789593 126
330 3300025909 Ga0207705_10181348 Ga0207705_101813482 126
331 3300025909 Ga0207705_10523936 Ga0207705_105239362 126
332 3300025909 Ga0207705_10748777 Ga0207705_107487772 126
333 3300025909 Ga0207705_10877659 Ga0207705_108776592 126
334 3300025909 Ga0207705_11033323 Ga0207705_110333231 126
335 3300025911 Ga0207654_10015255 Ga0207654_100152553 126
336 3300025912 Ga0207707_10914750 Ga0207707_109147502 126
337 3300025913 Ga0207695_10000018 Ga0207695_10000018270 126
338 3300025913 Ga0207695_10000182 Ga0207695_10000182164 126
339 3300025913 Ga0207695_10011980 Ga0207695_100119806 126
340 3300025913 Ga0207695_10268379 Ga0207695_102683793 126
341 3300025914 Ga0207671_10005975 Ga0207671_1000597516 126
342 3300025914 Ga0207671_10239481 Ga0207671_102394812 126
343 3300025917 Ga0207660_10023742 Ga0207660_100237425 126
344 3300025919 Ga0207657_10000218 Ga0207657_1000021815 126
345 3300025919 Ga0207657_10004622 Ga0207657_100046223 126
346 3300025919 Ga0207657_10015148 Ga0207657_100151487 126
347 3300025919 Ga0207657_10015997 Ga0207657_100159979 126
348 3300025919 Ga0207657_10095191 Ga0207657_100951913 126
349 3300025919 Ga0207657_10227527 Ga0207657_102275273 126
350 3300025919 Ga0207657_10499053 Ga0207657_104990531 126
351 3300025919 Ga0207657_10744505 Ga0207657_107445051 126
352 3300025920 Ga0207649_10001300 Ga0207649_1000130013 126
353 3300025920 Ga0207649_10063433 Ga0207649_100634332 126
354 3300025920 Ga0207649_10067134 Ga0207649_100671344 126
355 3300025920 Ga0207649_10165348 Ga0207649_101653484 126
356 3300025920 Ga0207649_10288029 Ga0207649_102880292 126
357 3300025920 Ga0207649_10844935 Ga0207649_108449352 126
358 3300025920 Ga0207649_11108614 Ga0207649_111086142 126
359 3300025921 Ga0207652_10187838 Ga0207652_101878382 126
360 3300025921 Ga0207652_11102425 Ga0207652_111024252 126
361 3300025923 Ga0207681_10002262 Ga0207681_100022622 126
362 3300025923 Ga0207681_10032831 Ga0207681_100328313 126
363 3300025923 Ga0207681_10155675 Ga0207681_101556753 126
364 3300025923 Ga0207681_10271946 Ga0207681_102719462 126
365 3300025924 Ga0207694_10000018 Ga0207694_10000018269 126
366 3300025924 Ga0207694_10006600 Ga0207694_100066007 126
367 3300025924 Ga0207694_10034661 Ga0207694_100346613 126
368 3300025924 Ga0207694_10260832 Ga0207694_102608321 126
369 3300025925 Ga0207650_10002617 Ga0207650_1000261710 126
370 3300025925 Ga0207650_10197756 Ga0207650_101977562 126
371 3300025926 Ga0207659_10008178 Ga0207659_100081786 126
372 3300025926 Ga0207659_10457188 Ga0207659_104571882 126
373 3300025929 Ga0207664_10477144 Ga0207664_104771441 126
374 3300025929 Ga0207664_10602573 Ga0207664_106025731 126
375 3300025931 Ga0207644_10006138 Ga0207644_100061387 126
376 3300025931 Ga0207644_10025184 Ga0207644_100251843 126
377 3300025931 Ga0207644_10399847 Ga0207644_103998472 126
378 3300025931 Ga0207644_10803307 Ga0207644_108033072 126
379 3300025932 Ga0207690_10002193 Ga0207690_100021932 126
380 3300025932 Ga0207690_10009646 Ga0207690_100096466 126
381 3300025932 Ga0207690_10046075 Ga0207690_100460755 126
382 3300025932 Ga0207690_10277460 Ga0207690_102774602 126
383 3300025932 Ga0207690_10829861 Ga0207690_108298612 126
384 3300025932 Ga0207690_11220959 Ga0207690_112209591 126
385 3300025932 Ga0207690_11678324 Ga0207690_116783242 126
386 3300025933 Ga0207706_10007550 Ga0207706_100075502 126
387 3300025933 Ga0207706_10009959 Ga0207706_100099596 126
388 3300025933 Ga0207706_10136165 Ga0207706_101361653 126
389 3300025933 Ga0207706_10223260 Ga0207706_102232602 126
390 3300025933 Ga0207706_10251426 Ga0207706_102514262 126
391 3300025933 Ga0207706_10682304 Ga0207706_106823042 126
392 3300025933 Ga0207706_10847014 Ga0207706_108470141 126
393 3300025934 Ga0207686_10644790 Ga0207686_106447901 126
394 3300025935 Ga0207709_10455537 Ga0207709_104555372 126
395 3300025937 Ga0207669_10237469 Ga0207669_102374692 126
396 3300025937 Ga0207669_10319264 Ga0207669_103192642 126
397 3300025938 Ga0207704_10136713 Ga0207704_101367132 126
398 3300025938 Ga0207704_11002057 Ga0207704_110020572 126
399 3300025940 Ga0207691_10003132 Ga0207691_1000313210 126
400 3300025940 Ga0207691_10023380 Ga0207691_100233803 126
401 3300025940 Ga0207691_10059576 Ga0207691_100595763 126
402 3300025940 Ga0207691_10060280 Ga0207691_100602802 126
403 3300025940 Ga0207691_10064573 Ga0207691_100645733 126
404 3300025941 Ga0207711_10056934 Ga0207711_100569342 126
405 3300025941 Ga0207711_10444335 Ga0207711_104443352 126
406 3300025941 Ga0207711_11596356 Ga0207711_115963561 126
407 3300025941 Ga0207711_12059541 Ga0207711_120595411 126
408 3300025942 Ga0207689_10024146 Ga0207689_100241465 126
409 3300025942 Ga0207689_10131983 Ga0207689_101319833 126
410 3300025944 Ga0207661_10019687 Ga0207661_100196875 126
411 3300025944 Ga0207661_10036199 Ga0207661_100361992 126
412 3300025944 Ga0207661_10074018 Ga0207661_100740184 126
413 3300025944 Ga0207661_11210291 Ga0207661_112102911 126
414 3300025945 Ga0207679_10003933 Ga0207679_100039332 126
415 3300025945 Ga0207679_10045226 Ga0207679_100452263 126
416 3300025945 Ga0207679_10072460 Ga0207679_100724603 126
417 3300025945 Ga0207679_10138512 Ga0207679_101385122 126
418 3300025945 Ga0207679_10220984 Ga0207679_102209842 126
419 3300025949 Ga0207667_10000052 Ga0207667_1000005284 126
420 3300025949 Ga0207667_10000122 Ga0207667_1000012294 126
421 3300025949 Ga0207667_10002731 Ga0207667_100027315 126
422 3300025949 Ga0207667_10024256 Ga0207667_100242567 126
423 3300025949 Ga0207667_10114384 Ga0207667_101143842 126
424 3300025949 Ga0207667_10145736 Ga0207667_101457363 126
425 3300025949 Ga0207667_11486505 Ga0207667_114865052 126
426 3300025960 Ga0207651_10036061 Ga0207651_100360612 126
427 3300025960 Ga0207651_10600119 Ga0207651_106001191 126
428 3300025960 Ga0207651_10799366 Ga0207651_107993662 126
429 3300025960 Ga0207651_11243576 Ga0207651_112435761 126
430 3300025960 Ga0207651_11288307 Ga0207651_112883072 126
431 3300025961 Ga0207712_10046019 Ga0207712_100460192 126
432 3300025961 Ga0207712_10085485 Ga0207712_100854853 126
433 3300025961 Ga0207712_10589072 Ga0207712_105890721 126
434 3300025972 Ga0207668_10000176 Ga0207668_1000017627 126
435 3300025972 Ga0207668_10316515 Ga0207668_103165152 126
436 3300025972 Ga0207668_10646649 Ga0207668_106466492 126
437 3300025972 Ga0207668_11646693 Ga0207668_116466932 126
438 3300025981 Ga0207640_10003064 Ga0207640_1000306410 126
439 3300025981 Ga0207640_10088899 Ga0207640_100888992 126
440 3300025981 Ga0207640_10099471 Ga0207640_100994713 126
441 3300025981 Ga0207640_10397049 Ga0207640_103970492 126
442 3300025981 Ga0207640_10788061 Ga0207640_107880611 126
443 3300025986 Ga0207658_10050488 Ga0207658_100504884 126
444 3300025986 Ga0207658_10110539 Ga0207658_101105392 126
445 3300025986 Ga0207658_10125147 Ga0207658_101251473 126
446 3300025986 Ga0207658_10182202 Ga0207658_101822022 126
447 3300026023 Ga0207677_10188122 Ga0207677_101881222 126
448 3300026023 Ga0207677_10755238 Ga0207677_107552382 126
449 3300026035 Ga0207703_10015939 Ga0207703_100159395 126
450 3300026035 Ga0207703_11029149 Ga0207703_110291492 126
451 3300026041 Ga0207639_10001293 Ga0207639_1000129314 126
452 3300026041 Ga0207639_10025287 Ga0207639_100252875 126
453 3300026041 Ga0207639_10123686 Ga0207639_101236863 126
454 3300026041 Ga0207639_11291569 Ga0207639_112915692 126
455 3300026067 Ga0207678_10006571 Ga0207678_100065712 126
456 3300026067 Ga0207678_10237657 Ga0207678_102376573 126
457 3300026067 Ga0207678_10614225 Ga0207678_106142251 126
458 3300026078 Ga0207702_10008605 Ga0207702_100086055 126
459 3300026078 Ga0207702_10029498 Ga0207702_100294984 126
460 3300026078 Ga0207702_10148145 Ga0207702_101481453 126
461 3300026078 Ga0207702_11911831 Ga0207702_119118311 126
462 3300026088 Ga0207641_11078794 Ga0207641_110787942 126
463 3300026089 Ga0207648_10001235 Ga0207648_100012352 126
464 3300026089 Ga0207648_10552020 Ga0207648_105520202 126
465 3300026089 Ga0207648_12146299 Ga0207648_121462991 126
466 3300026095 Ga0207676_10161763 Ga0207676_101617633 126
467 3300026116 Ga0207674_10003594 Ga0207674_1000359416 126
468 3300026116 Ga0207674_10005519 Ga0207674_1000551919 126
469 3300026116 Ga0207674_10027930 Ga0207674_100279309 126
470 3300026116 Ga0207674_10048179 Ga0207674_100481793 126
471 3300026118 Ga0207675_100078855 Ga0207675_1000788553 126
472 3300026118 Ga0207675_100336443 Ga0207675_1003364432 126
473 3300026118 Ga0207675_100544554 Ga0207675_1005445542 126
474 3300026121 Ga0207683_10375386 Ga0207683_103753862 126
475 3300026121 Ga0207683_10777150 Ga0207683_107771502 126
476 3300026142 Ga0207698_10002558 Ga0207698_100025587 126
477 3300026142 Ga0207698_10043642 Ga0207698_100436424 126
478 3300026142 Ga0207698_10094813 Ga0207698_100948133 126
479 3300026142 Ga0207698_10493426 Ga0207698_104934262 126
480 3300026142 Ga0207698_10744209 Ga0207698_107442092 126
481 3300026142 Ga0207698_11939163 Ga0207698_119391632 126
482 3300028379 Ga0268266_10014168 Ga0268266_100141685 126
483 3300028379 Ga0268266_10068863 Ga0268266_100688631 126
484 3300028379 Ga0268266_11498434 Ga0268266_114984341 126
485 3300028380 Ga0268265_10000904 Ga0268265_1000090415 126
486 3300028380 Ga0268265_10048556 Ga0268265_100485563 126
487 3300028380 Ga0268265_10156085 Ga0268265_101560853 126
488 3300028380 Ga0268265_10569408 Ga0268265_105694082 126
489 3300028381 Ga0268264_10001156 Ga0268264_1000115625 126
490 3300028381 Ga0268264_10016372 Ga0268264_100163723 126
491 3300031548 Ga0307408_100415632 Ga0307408_1004156322 126
492 3300031730 Ga0307516_10111367 Ga0307516_101113672 126
493 3300031824 Ga0307413_10135808 Ga0307413_101358082 126
494 3300031824 Ga0307413_10265371 Ga0307413_102653713 126
495 3300031824 Ga0307413_10458826 Ga0307413_104588263 126
496 3300031852 Ga0307410_11374137 Ga0307410_113741372 126
497 3300031901 Ga0307406_11667361 Ga0307406_116673611 126
498 3300031903 Ga0307407_10422154 Ga0307407_104221542 126
499 3300031911 Ga0307412_10157718 Ga0307412_101577182 126
500 3300031911 Ga0307412_10651269 Ga0307412_106512692 126
501 3300031995 Ga0307409_100348334 Ga0307409_1003483343 126
502 3300031995 Ga0307409_101055461 Ga0307409_1010554611 126
503 3300032002 Ga0307416_100071968 Ga0307416_1000719682 126
504 3300032002 Ga0307416_100181694 Ga0307416_1001816942 126
505 3300032002 Ga0307416_103027041 Ga0307416_1030270412 126
506 3300032005 Ga0307411_10014233 Ga0307411_100142332 126
507 3300032005 Ga0307411_10262106 Ga0307411_102621062 126
508 3300032126 Ga0307415_100122261 Ga0307415_1001222612 126
509 3300032126 Ga0307415_101287285 Ga0307415_1012872852 126
510 3300035120 Ga0373957_0161724 Ga0373957_0161724_179_562 126
511 3300035171 Ga0373946_0441453 Ga0373946_0441453_196_576 126
512 3300037312 Ga0395899_0008386 Ga0395899_0008386_6444_6824 126
513 3300037312 Ga0395899_0111018 Ga0395899_0111018_543_923 126
514 3300037312 Ga0395899_0129549 Ga0395899_0129549_95_475 126
515 3300037312 Ga0395899_0151857 Ga0395899_0151857_70_450 126
516 3300037312 Ga0395899_0199188 Ga0395899_0199188_155_535 126
517 3300037312 Ga0395899_0309678 Ga0395899_0309678_598_978 126
518 3300037312 Ga0395899_0656003 Ga0395899_0656003_61_444 126
519 3300037312 Ga0395899_0705927 Ga0395899_0705927_109_489 126
520 3300037418 Ga0395900_0009073 Ga0395900_0009073_326_706 126
521 3300037418 Ga0395900_0083382 Ga0395900_0083382_1978_2358 126
522 3300037418 Ga0395900_0087987 Ga0395900_0087987_1475_1855 126
523 3300037418 Ga0395900_0122334 Ga0395900_0122334_815_1195 126
524 3300037418 Ga0395900_0142309 Ga0395900_0142309_1593_1973 126
525 3300037418 Ga0395900_0172489 Ga0395900_0172489_20_400 126
526 3300037418 Ga0395900_0179898 Ga0395900_0179898_1150_1530 126
527 3300037418 Ga0395900_0463639 Ga0395900_0463639_534_914 126
528 3300037418 Ga0395900_0544104 Ga0395900_0544104_183_566 126
529 3300037418 Ga0395900_0577600 Ga0395900_0577600_309_689 126
530 3300037418 Ga0395900_0816722 Ga0395900_0816722_375_755 126
531 3300037466 Ga0395898_0174900 Ga0395898_0174900_1269_1649 126
532 3300037466 Ga0395898_0224343 Ga0395898_0224343_598_978 126
533 3300037466 Ga0395898_0239235 Ga0395898_0239235_1038_1418 126
534 3300037466 Ga0395898_0292965 Ga0395898_0292965_815_1195 126
535 3300037466 Ga0395898_0486032 Ga0395898_0486032_227_607 126
536 3300037466 Ga0395898_0606387 Ga0395898_0606387_165_548 126
537 3300037466 Ga0395898_0758196 Ga0395898_0758196_348_728 126
538 3300037466 Ga0395898_0997191 Ga0395898_0997191_377_757 126
539 3300037466 Ga0395898_1272127 Ga0395898_1272127_135_515 126
540 3300037471 Ga0395905_0001242 Ga0395905_0001242_10693_11076 126
541 3300037471 Ga0395905_0030728 Ga0395905_0030728_2643_3023 126
542 3300037471 Ga0395905_0069544 Ga0395905_0069544_1767_2147 126
543 3300037471 Ga0395905_0104679 Ga0395905_0104679_620_1000 126
544 3300037471 Ga0395905_0139308 Ga0395905_0139308_593_973 126
545 3300037471 Ga0395905_0143489 Ga0395905_0143489_99_479 126
546 3300037471 Ga0395905_0156886 Ga0395905_0156886_1268_1648 126
547 3300037471 Ga0395905_0235192 Ga0395905_0235192_298_678 126
548 3300037471 Ga0395905_0352337 Ga0395905_0352337_590_970 126
549 3300037471 Ga0395905_0353532 Ga0395905_0353532_620_1000 126
550 3300037471 Ga0395905_0363950 Ga0395905_0363950_930_1310 126
551 3300037471 Ga0395905_0391449 Ga0395905_0391449_368_757 126
552 3300037471 Ga0395905_0587324 Ga0395905_0587324_477_860 126
553 3300037471 Ga0395905_0662350 Ga0395905_0662350_51_431 126
554 3300037471 Ga0395905_0774781 Ga0395905_0774781_144_527 126
555 3300037471 Ga0395905_0819293 Ga0395905_0819293_400_780 126
556 3300037471 Ga0395905_1865644 Ga0395905_1865644_108_488 126
557 3300038443 Ga0395901_0039984 Ga0395901_0039984_2609_2989 126
558 3300038443 Ga0395901_0070766 Ga0395901_0070766_827_1207 126
559 3300038443 Ga0395901_0087694 Ga0395901_0087694_2704_3084 126
560 3300038443 Ga0395901_0091910 Ga0395901_0091910_620_1000 126
561 3300038443 Ga0395901_0351820 Ga0395901_0351820_40_420 126
562 3300038443 Ga0395901_0438251 Ga0395901_0438251_211_594 126
563 3300038443 Ga0395901_0450315 Ga0395901_0450315_412_792 126
564 3300038443 Ga0395901_0484106 Ga0395901_0484106_781_1161 126
565 3300038443 Ga0395901_0791437 Ga0395901_0791437_33_413 126
566 3300038443 Ga0395901_0804646 Ga0395901_0804646_444_824 126
567 3300038443 Ga0395901_0957150 Ga0395901_0957150_328_711 126
568 3300038443 Ga0395901_1399795 Ga0395901_1399795_131_511 126
569 3300038443 Ga0395901_1902151 Ga0395901_1902151_88_468 126
570 3300038443 Ga0395901_2118286 Ga0395901_2118286_92_472 126
571 3300039437 Ga0436365_1455190 Ga0436365_1455190_79_459 126
572 3300039450 Ga0436363_0286509 Ga0436363_0286509_396_776 126
573 3300039453 Ga0436362_0313465 Ga0436362_0313465_43_423 126
574 3300044658 Ga0466972_0043338 Ga0466972_0043338_1355_1735 126
575 3300044658 Ga0466972_0124719 Ga0466972_0124719_452_832 126
576 3300044683 Ga0466965_0155271 Ga0466965_0155271_364_744 126
577 3300044683 Ga0466965_0286873 Ga0466965_0286873_498_878 126
578 3300044693 Ga0466961_0245935 Ga0466961_0245935_304_684 126
579 3300044694 Ga0466963_0098926 Ga0466963_0098926_1473_1853 126
580 3300044719 Ga0466971_0133143 Ga0466971_0133143_12_413 126
581 3300044735 Ga0466968_0554556 Ga0466968_0554556_134_514 126
582 3300044765 Ga0466970_0157013 Ga0466970_0157013_644_1024 126
583 3300044842 Ga0466957_0155899 Ga0466957_0155899_91_471 126
584 3300044842 Ga0466957_0341220 Ga0466957_0341220_336_716 126
585 3300045049 Ga0466959_0143961 Ga0466959_0143961_1148_1528 126
586 3300045836 Ga0466958_0376259 Ga0466958_0376259_307_687 126
587 3300045976 Ga0466967_0025276 Ga0466967_0025276_943_1323 126
588 3300045976 Ga0466967_0047283 Ga0466967_0047283_976_1356 126
589 3300045976 Ga0466967_0182456 Ga0466967_0182456_573_953 126
590 3300045976 Ga0466967_0624932 Ga0466967_0624932_66_446 126
591 3300045976 Ga0466967_1396082 Ga0466967_1396082_203_583 126
592 3300046513 Ga0495616_0063485 Ga0495616_0063485_400_780 126
593 3300046557 Ga0495622_0287546 Ga0495622_0287546_169_549 126
594 3300046616 Ga0495668_0030068 Ga0495668_0030068_1990_2370 126
595 3300046616 Ga0495668_0328134 Ga0495668_0328134_344_724 126
596 3300046684 Ga0495669_0000549 Ga0495669_0000549_342_722 126
597 3300046684 Ga0495669_0011110 Ga0495669_0011110_1386_1766 126
598 3300046684 Ga0495669_0138276 Ga0495669_0138276_369_749 126
599 3300046684 Ga0495669_0293543 Ga0495669_0293543_361_741 126
600 3300046684 Ga0495669_0333553 Ga0495669_0333553_277_657 126
601 3300047317 Ga0495604_1019052 Ga0495604_1019052_106_486 126
602 3300048903 Ga0496100_0176715 Ga0496100_0176715_89_469 126
603 3300048904 Ga0496101_0463427 Ga0496101_0463427_171_551 126
604 3300048904 Ga0496101_0757758 Ga0496101_0757758_328_708 126
605 3300048907 Ga0496104_0973694 Ga0496104_0973694_148_528 126
606 3300048909 Ga0496106_0399771 Ga0496106_0399771_425_805 126
607 3300048911 Ga0496108_0131842 Ga0496108_0131842_1747_2127 126
608 3300048911 Ga0496108_0991350 Ga0496108_0991350_13_393 126
609 3300048912 Ga0496109_0061968 Ga0496109_0061968_1442_1822 126
610 3300048912 Ga0496109_1700530 Ga0496109_1700530_40_420 126
611 3300048913 Ga0496110_1262798 Ga0496110_1262798_141_521 126
612 3300048914 Ga0496111_0005000 Ga0496111_0005000_2322_2702 126
613 3300048914 Ga0496111_0275715 Ga0496111_0275715_460_840 126
614 3300048914 Ga0496111_0483005 Ga0496111_0483005_336_716 126
615 3300048915 Ga0496112_0010612 Ga0496112_0010612_4209_4589 126
616 3300048915 Ga0496112_0261489 Ga0496112_0261489_817_1197 126
617 3300048915 Ga0496112_0389025 Ga0496112_0389025_150_530 126
618 3300048915 Ga0496112_1156826 Ga0496112_1156826_105_485 126
619 3300048916 Ga0496113_1023633 Ga0496113_1023633_175_555 126
620 3300048917 Ga0496114_0053296 Ga0496114_0053296_1475_1855 126
621 3300048917 Ga0496114_0143355 Ga0496114_0143355_871_1251 126
622 3300048918 Ga0496115_0001963 Ga0496115_0001963_11621_12001 126
623 3300049460 Ga0495682_0001599 Ga0495682_0001599_259_639 126
624 3300049581 Ga0501047_0008272 Ga0501047_0008272_4837_5217 126
625 3300049583 Ga0501067_0001368 Ga0501067_0001368_11385_11765 126
626 3300049583 Ga0501067_0018749 Ga0501067_0018749_2835_3218 126
627 3300049584 Ga0501068_1134089 Ga0501068_1134089_123_506 126
628 3300049585 Ga0501069_0304112 Ga0501069_0304112_533_919 126
629 3300049586 Ga0501070_0058487 Ga0501070_0058487_2056_2436 126
630 3300049586 Ga0501070_0341610 Ga0501070_0341610_438_824 126
631 3300049587 Ga0501071_0530908 Ga0501071_0530908_219_602 126
632 3300049587 Ga0501071_1116940 Ga0501071_1116940_15_401 126
633 3300049588 Ga0501072_0019146 Ga0501072_0019146_25_405 126
634 3300049589 Ga0501073_0283728 Ga0501073_0283728_482_862 126
635 3300049589 Ga0501073_1000480 Ga0501073_1000480_120_500 126
636 3300049590 Ga0501074_0948379 Ga0501074_0948379_146_526 126
637 3300049741 Ga0501079_0196512 Ga0501079_0196512_1170_1550 126
638 3300049742 Ga0501080_0293458 Ga0501080_0293458_157_543 126
639 3300049742 Ga0501080_0355792 Ga0501080_0355792_576_956 126
640 3300049744 Ga0501083_0427276 Ga0501083_0427276_41_421 126
641 3300050507 nmdc:mga05p37_560584_c1 nmdc:mga05p37_560584_c1_220_621 126
642 3300050508 nmdc:mga09592_544277_c1 nmdc:mga09592_544277_c1_283_663 126
643 3300050508 nmdc:mga09592_990168_c1 nmdc:mga09592_990168_c1_185_586 126
644 3300050509 nmdc:mga0qj67_22674_c1 nmdc:mga0qj67_22674_c1_955_1335 126
645 3300050510 nmdc:mga06r32_23609_c1 nmdc:mga06r32_23609_c1_1023_1403 126
646 3300050510 nmdc:mga06r32_305613_c1 nmdc:mga06r32_305613_c1_485_886 126
647 3300050511 nmdc:mga08y16_544379_c1 nmdc:mga08y16_544379_c1_599_979 126
648 3300050515 nmdc:mga0a205_696_c1 nmdc:mga0a205_696_c1_6288_6668 126
649 3300053133 Ga0500655_015682 Ga0500655_015682_609_989 126
650 3300053133 Ga0500655_069298 Ga0500655_069298_33_413 126
651 3300054114 Ga0501084_0185405 Ga0501084_0185405_931_1311 126
652 3300060353 Ga0501082_1272647 Ga0501082_1272647_81_467 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

30

133

0.9

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

27

132

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z7t-assembly1.cif.gz_A nucleotide-free myosin-ii motor domain 0.9063 88 111
6z7t-assembly2.cif.gz_B nucleotide-free myosin-ii motor domain 0.8924 88 111
4lqb-assembly1.cif.gz_B crystal structure of uncharacterized protein kfla3161 0.8576 1 126
7muw-assembly1.cif.gz_Cf reconstruction of the legionella pneumophila dot/icm t4ss 3dva map 4 0.8529 88 111
4lqb-assembly1.cif.gz_B crystal structure of uncharacterized protein kfla3161 0.8514 1 126
ID Description Score Start End Superfamily
af_Q54ZV3_691_741_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.9251 88 111 2.30.30.60
af_Q2G117_134_187_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.8986 89 111 2.30.30.60
af_Q09915_1043_1121_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8942 88 111 2.40.50.140
af_A0A0R4IJY6_29_78_2.30.30.360 Mainly Beta;Roll;SH3 type barrels.;Myosin S1 fragment, N-terminal 0.887 88 111 2.30.30.360
af_Q55A48_1158_1269_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8811 88 111 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A369ULU2-F1-model_v4 VOC family protein 0.9643 1 126
AF-A0A534AGY9-F1-model_v4 VOC family protein 0.9455 70 126
AF-A0A5C5TGV8-F1-model_v4 VOC family protein 0.9341 1 126
AF-A0A839SSJ9-F1-model_v4 VOC domain-containing protein 0.9297 2 126
AF-A0A5D0WGG5-F1-model_v4 deleted 0.929 1 126

Feature Viewer

pLDDT pTM Quality
94.68 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map