F472658
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 652 | 230 | 652 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300005335|Ga0070666_10003993|Ga0070666_100039932 |
| Length | 148 |
| Sequence | MRRGTPATRGGFLGGSAKNEGTMHRSRINGILIDCNVDDIQAAARFWAQALGRPVDPDHPGTRGNYVMLETPPDEISVQIQRVDHESRVHIDIETDDIPAEIARLEKLGATVDKRLERWAVMRAPSGQRFCIVRVQREGFPKGATTWD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 161 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 162 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 163 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 164 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 165 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 166 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 172 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 173 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 174 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 175 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 176 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 179 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 180 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 181 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 182 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 183 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 184 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 185 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 186 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 187 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 188 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 189 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 190 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 191 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 192 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 200 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 201 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 204 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 205 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 206 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 207 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 208 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 209 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 229 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.85 |
| Metatranscriptomes | 0.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.31 |
| Nodule | 0 |
| Rhizoplane | 3.22 |
| Rhizosphere | 95.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1006172 | 3300001904 | Bacteria | 2020 |
| 2 | JGI24736J21556_1010414 | 3300001904 | Bacteria | 1518 |
| 3 | JGI24740J21852_10013781 | 3300001979 | Bacteria | 3005 |
| 4 | JGI24737J22298_10041741 | 3300001990 | Bacteria | 1407 |
| 5 | JGI24735J21928_10017941 | 3300002067 | Bacteria | 2186 |
| 6 | JGI24738J21930_10019421 | 3300002075 | Bacteria | 1416 |
| 7 | JGI24749J21850_1025010 | 3300002076 | Bacteria | 850 |
| 8 | rootL2_10308702 | 3300003322 | Bacteria | 2070 |
| 9 | Ga0065715_10117818 | 3300005293 | Bacteria | 2334 |
| 10 | Ga0065715_10299185 | 3300005293 | Bacteria | 1045 |
| 11 | Ga0065715_10359860 | 3300005293 | Bacteria | 937 |
| 12 | Ga0070658_10008367 | 3300005327 | Bacteria | 8317 |
| 13 | Ga0070658_10038048 | 3300005327 | Bacteria | 3880 |
| 14 | Ga0070658_10082660 | 3300005327 | Bacteria | 2639 |
| 15 | Ga0070658_10333353 | 3300005327 | Bacteria | 1297 |
| 16 | Ga0070658_10364366 | 3300005327 | Bacteria | 1238 |
| 17 | Ga0070658_11124524 | 3300005327 | Unclassified | 683 |
| 18 | Ga0070658_11319635 | 3300005327 | Bacteria | 627 |
| 19 | Ga0070676_10000682 | 3300005328 | Bacteria | 16629 |
| 20 | Ga0070676_10420428 | 3300005328 | Bacteria | 934 |
| 21 | Ga0070683_100006463 | 3300005329 | Bacteria | 9837 |
| 22 | Ga0070683_100134672 | 3300005329 | Bacteria | 2339 |
| 23 | Ga0070683_100675923 | 3300005329 | Bacteria | 989 |
| 24 | Ga0070683_101876278 | 3300005329 | Bacteria | 576 |
| 25 | Ga0070670_100002114 | 3300005331 | Bacteria | 16307 |
| 26 | Ga0070677_10155498 | 3300005333 | Bacteria | 1068 |
| 27 | Ga0068869_100106010 | 3300005334 | Bacteria | 2132 |
| 28 | Ga0070666_10003993 | 3300005335 | Bacteria | 8950 |
| 29 | Ga0070666_10871686 | 3300005335 | Bacteria | 665 |
| 30 | Ga0070666_11357817 | 3300005335 | Bacteria | 531 |
| 31 | Ga0070680_100005609 | 3300005336 | Bacteria | 9504 |
| 32 | Ga0070682_100818093 | 3300005337 | Bacteria | 758 |
| 33 | Ga0068868_100099536 | 3300005338 | Bacteria | 2352 |
| 34 | Ga0070660_100005696 | 3300005339 | Bacteria | 8633 |
| 35 | Ga0070660_100024581 | 3300005339 | Bacteria | 4469 |
| 36 | Ga0070660_100047696 | 3300005339 | Bacteria | 3288 |
| 37 | Ga0070660_100091750 | 3300005339 | Bacteria | 2396 |
| 38 | Ga0070660_100139319 | 3300005339 | Bacteria | 1945 |
| 39 | Ga0070660_100146733 | 3300005339 | Bacteria | 1895 |
| 40 | Ga0070660_100188540 | 3300005339 | Bacteria | 1670 |
| 41 | Ga0070660_100479480 | 3300005339 | Bacteria | 1033 |
| 42 | Ga0070660_100633599 | 3300005339 | Bacteria | 895 |
| 43 | Ga0070660_100731196 | 3300005339 | Bacteria | 830 |
| 44 | Ga0070660_101608892 | 3300005339 | Bacteria | 553 |
| 45 | Ga0070691_10001098 | 3300005341 | Bacteria | 11232 |
| 46 | Ga0070661_100003037 | 3300005344 | Bacteria | 11542 |
| 47 | Ga0070661_100005718 | 3300005344 | Bacteria | 8570 |
| 48 | Ga0070661_100011620 | 3300005344 | Bacteria | 6138 |
| 49 | Ga0070661_100024161 | 3300005344 | Bacteria | 4359 |
| 50 | Ga0070661_100259232 | 3300005344 | Bacteria | 1344 |
| 51 | Ga0070661_100630412 | 3300005344 | Bacteria | 869 |
| 52 | Ga0070661_101176673 | 3300005344 | Bacteria | 641 |
| 53 | Ga0070692_10015285 | 3300005345 | Bacteria | 3628 |
| 54 | Ga0070692_10064669 | 3300005345 | Bacteria | 1935 |
| 55 | Ga0070692_10850524 | 3300005345 | Bacteria | 627 |
| 56 | Ga0070668_100000324 | 3300005347 | Bacteria | 31403 |
| 57 | Ga0070668_100041353 | 3300005347 | Bacteria | 3531 |
| 58 | Ga0070668_100284701 | 3300005347 | Bacteria | 1382 |
| 59 | Ga0070668_100335509 | 3300005347 | Bacteria | 1276 |
| 60 | Ga0070668_101483390 | 3300005347 | Bacteria | 620 |
| 61 | Ga0070669_100033427 | 3300005353 | Bacteria | 3720 |
| 62 | Ga0070669_100069490 | 3300005353 | Bacteria | 2601 |
| 63 | Ga0070669_100771678 | 3300005353 | Bacteria | 815 |
| 64 | Ga0070669_101256360 | 3300005353 | Bacteria | 641 |
| 65 | Ga0070675_100000985 | 3300005354 | Bacteria | 20370 |
| 66 | Ga0070675_100017593 | 3300005354 | Bacteria | 5682 |
| 67 | Ga0070675_100316728 | 3300005354 | Bacteria | 1377 |
| 68 | Ga0070675_100818058 | 3300005354 | Bacteria | 852 |
| 69 | Ga0070671_100004978 | 3300005355 | Bacteria | 10579 |
| 70 | Ga0070671_100153584 | 3300005355 | Bacteria | 1944 |
| 71 | Ga0070674_100520985 | 3300005356 | Bacteria | 993 |
| 72 | Ga0070673_100040573 | 3300005364 | Bacteria | 3572 |
| 73 | Ga0070673_100083750 | 3300005364 | Bacteria | 2592 |
| 74 | Ga0070673_100140940 | 3300005364 | Bacteria | 2033 |
| 75 | Ga0070673_100288269 | 3300005364 | Unclassified | 1442 |
| 76 | Ga0070673_100523984 | 3300005364 | Bacteria | 1074 |
| 77 | Ga0070673_100819560 | 3300005364 | Bacteria | 860 |
| 78 | Ga0070673_101080367 | 3300005364 | Bacteria | 749 |
| 79 | Ga0070673_101319533 | 3300005364 | Bacteria | 678 |
| 80 | Ga0070688_100169075 | 3300005365 | Bacteria | 1507 |
| 81 | Ga0070659_100006134 | 3300005366 | Bacteria | 8676 |
| 82 | Ga0070659_100016674 | 3300005366 | Bacteria | 5517 |
| 83 | Ga0070659_100054153 | 3300005366 | Bacteria | 3160 |
| 84 | Ga0070659_100221280 | 3300005366 | Bacteria | 1562 |
| 85 | Ga0070659_100227000 | 3300005366 | Bacteria | 1542 |
| 86 | Ga0070659_100287714 | 3300005366 | Bacteria | 1368 |
| 87 | Ga0070659_101367946 | 3300005366 | Bacteria | 629 |
| 88 | Ga0070659_101376117 | 3300005366 | Bacteria | 627 |
| 89 | Ga0070659_101777541 | 3300005366 | Bacteria | 552 |
| 90 | Ga0070667_100069495 | 3300005367 | Bacteria | 2997 |
| 91 | Ga0070667_100390295 | 3300005367 | Bacteria | 1266 |
| 92 | Ga0070667_100441412 | 3300005367 | Bacteria | 1188 |
| 93 | Ga0070667_100506938 | 3300005367 | Bacteria | 1106 |
| 94 | Ga0070667_100749822 | 3300005367 | Bacteria | 905 |
| 95 | Ga0070667_100871989 | 3300005367 | Bacteria | 837 |
| 96 | Ga0070667_100915066 | 3300005367 | Bacteria | 817 |
| 97 | Ga0070709_10064558 | 3300005434 | Bacteria | 2341 |
| 98 | Ga0070714_100216744 | 3300005435 | Bacteria | 1757 |
| 99 | Ga0070714_100376063 | 3300005435 | Bacteria | 1338 |
| 100 | Ga0070714_101374703 | 3300005435 | Bacteria | 689 |
| 101 | Ga0070714_102173269 | 3300005435 | Bacteria | 540 |
| 102 | Ga0070710_10963268 | 3300005437 | Unclassified | 619 |
| 103 | Ga0070694_100007767 | 3300005444 | Bacteria | 6542 |
| 104 | Ga0070694_100379040 | 3300005444 | Bacteria | 1103 |
| 105 | Ga0070663_100023560 | 3300005455 | Bacteria | 4128 |
| 106 | Ga0070663_100133454 | 3300005455 | Bacteria | 1888 |
| 107 | Ga0070663_100133868 | 3300005455 | Bacteria | 1885 |
| 108 | Ga0070663_100310306 | 3300005455 | Bacteria | 1265 |
| 109 | Ga0070678_101453503 | 3300005456 | Bacteria | 641 |
| 110 | Ga0070662_100007041 | 3300005457 | Bacteria | 7275 |
| 111 | Ga0070662_100007360 | 3300005457 | Bacteria | 7132 |
| 112 | Ga0070662_100013320 | 3300005457 | Bacteria | 5471 |
| 113 | Ga0070662_100067175 | 3300005457 | Bacteria | 2633 |
| 114 | Ga0070662_100350985 | 3300005457 | Bacteria | 1208 |
| 115 | Ga0070662_100454299 | 3300005457 | Bacteria | 1064 |
| 116 | Ga0070681_10275484 | 3300005458 | Bacteria | 1594 |
| 117 | Ga0070681_10741242 | 3300005458 | Bacteria | 899 |
| 118 | Ga0068867_100018109 | 3300005459 | Bacteria | 5005 |
| 119 | Ga0070679_100191378 | 3300005530 | Bacteria | 2014 |
| 120 | Ga0070679_100385755 | 3300005530 | Bacteria | 1347 |
| 121 | Ga0070679_101361582 | 3300005530 | Bacteria | 656 |
| 122 | Ga0070684_100004262 | 3300005535 | Bacteria | 10842 |
| 123 | Ga0070684_100183051 | 3300005535 | Bacteria | 1905 |
| 124 | Ga0068853_100017520 | 3300005539 | Bacteria | 5911 |
| 125 | Ga0068853_100141186 | 3300005539 | Bacteria | 2162 |
| 126 | Ga0068853_100167459 | 3300005539 | Bacteria | 1987 |
| 127 | Ga0068853_100495049 | 3300005539 | Unclassified | 1154 |
| 128 | Ga0068853_101318728 | 3300005539 | Bacteria | 698 |
| 129 | Ga0070672_100001785 | 3300005543 | Bacteria | 13457 |
| 130 | Ga0070672_100064740 | 3300005543 | Bacteria | 2889 |
| 131 | Ga0070672_100067286 | 3300005543 | Bacteria | 2838 |
| 132 | Ga0070672_100152268 | 3300005543 | Bacteria | 1914 |
| 133 | Ga0070672_100247192 | 3300005543 | Bacteria | 1502 |
| 134 | Ga0070686_100247301 | 3300005544 | Bacteria | 1301 |
| 135 | Ga0070686_101787748 | 3300005544 | Bacteria | 523 |
| 136 | Ga0070695_100768511 | 3300005545 | Bacteria | 770 |
| 137 | Ga0070696_100705125 | 3300005546 | Bacteria | 823 |
| 138 | Ga0070693_100109587 | 3300005547 | Unclassified | 1696 |
| 139 | Ga0070665_100002713 | 3300005548 | Bacteria | 19193 |
| 140 | Ga0070665_100493093 | 3300005548 | Bacteria | 1236 |
| 141 | Ga0070704_100291665 | 3300005549 | Bacteria | 1356 |
| 142 | Ga0068855_100000075 | 3300005563 | Bacteria | 119094 |
| 143 | Ga0068855_100003629 | 3300005563 | Bacteria | 18867 |
| 144 | Ga0068855_100013206 | 3300005563 | Bacteria | 9963 |
| 145 | Ga0068855_100072813 | 3300005563 | Bacteria | 3993 |
| 146 | Ga0068855_100207311 | 3300005563 | Bacteria | 2205 |
| 147 | Ga0068855_100277132 | 3300005563 | Bacteria | 1864 |
| 148 | Ga0068855_100841879 | 3300005563 | Bacteria | 972 |
| 149 | Ga0068855_101063767 | 3300005563 | Bacteria | 847 |
| 150 | Ga0068855_101186168 | 3300005563 | Bacteria | 794 |
| 151 | Ga0068855_101480022 | 3300005563 | Bacteria | 698 |
| 152 | Ga0068855_101857061 | 3300005563 | Unclassified | 611 |
| 153 | Ga0068855_102167203 | 3300005563 | Unclassified | 558 |
| 154 | Ga0070664_100005887 | 3300005564 | Bacteria | 9901 |
| 155 | Ga0070664_100008847 | 3300005564 | Bacteria | 8159 |
| 156 | Ga0070664_100014109 | 3300005564 | Bacteria | 6517 |
| 157 | Ga0070664_100025221 | 3300005564 | Bacteria | 4925 |
| 158 | Ga0070664_100369761 | 3300005564 | Unclassified | 1307 |
| 159 | Ga0070664_100385040 | 3300005564 | Bacteria | 1281 |
| 160 | Ga0068857_100013770 | 3300005577 | Bacteria | 7047 |
| 161 | Ga0068857_100019440 | 3300005577 | Bacteria | 5964 |
| 162 | Ga0068857_100052857 | 3300005577 | Bacteria | 3603 |
| 163 | Ga0068857_100108558 | 3300005577 | Bacteria | 2493 |
| 164 | Ga0068857_100500219 | 3300005577 | Bacteria | 1141 |
| 165 | Ga0068857_100626936 | 3300005577 | Bacteria | 1018 |
| 166 | Ga0068854_100078415 | 3300005578 | Bacteria | 2433 |
| 167 | Ga0068854_100147680 | 3300005578 | Bacteria | 1810 |
| 168 | Ga0068854_100194632 | 3300005578 | Bacteria | 1590 |
| 169 | Ga0068854_100313443 | 3300005578 | Bacteria | 1273 |
| 170 | Ga0068854_100322568 | 3300005578 | Unclassified | 1256 |
| 171 | Ga0068854_100440084 | 3300005578 | Bacteria | 1086 |
| 172 | Ga0068854_101113783 | 3300005578 | Bacteria | 704 |
| 173 | Ga0068856_100032566 | 3300005614 | Bacteria | 5103 |
| 174 | Ga0068856_100062204 | 3300005614 | Bacteria | 3687 |
| 175 | Ga0068856_100350280 | 3300005614 | Bacteria | 1495 |
| 176 | Ga0068856_101868135 | 3300005614 | Bacteria | 612 |
| 177 | Ga0068856_101939991 | 3300005614 | Bacteria | 600 |
| 178 | Ga0068856_102447368 | 3300005614 | Bacteria | 529 |
| 179 | Ga0068852_100003664 | 3300005616 | Bacteria | 10765 |
| 180 | Ga0068852_100018832 | 3300005616 | Bacteria | 5448 |
| 181 | Ga0068852_100126196 | 3300005616 | Bacteria | 2350 |
| 182 | Ga0068852_100590133 | 3300005616 | Bacteria | 1114 |
| 183 | Ga0068852_100610757 | 3300005616 | Bacteria | 1095 |
| 184 | Ga0068852_100764901 | 3300005616 | Bacteria | 979 |
| 185 | Ga0068852_100821153 | 3300005616 | Bacteria | 944 |
| 186 | Ga0068852_101284553 | 3300005616 | Bacteria | 753 |
| 187 | Ga0068852_101738783 | 3300005616 | Bacteria | 646 |
| 188 | Ga0068852_102247188 | 3300005616 | Bacteria | 567 |
| 189 | Ga0068859_100312936 | 3300005617 | Bacteria | 1664 |
| 190 | Ga0068859_100502409 | 3300005617 | Bacteria | 1308 |
| 191 | Ga0068859_102136374 | 3300005617 | Bacteria | 618 |
| 192 | Ga0068864_101366082 | 3300005618 | Bacteria | 710 |
| 193 | Ga0068866_10254797 | 3300005718 | Bacteria | 1076 |
| 194 | Ga0068861_100100331 | 3300005719 | Bacteria | 2301 |
| 195 | Ga0068851_10165375 | 3300005834 | Bacteria | 1218 |
| 196 | Ga0068851_10871071 | 3300005834 | Bacteria | 563 |
| 197 | Ga0068870_10306884 | 3300005840 | Bacteria | 1004 |
| 198 | Ga0068870_11066879 | 3300005840 | Bacteria | 579 |
| 199 | Ga0068863_100147126 | 3300005841 | Bacteria | 2254 |
| 200 | Ga0068858_100018374 | 3300005842 | Bacteria | 6547 |
| 201 | Ga0068860_100013708 | 3300005843 | Bacteria | 7948 |
| 202 | Ga0068860_100020068 | 3300005843 | Bacteria | 6474 |
| 203 | Ga0068860_100107926 | 3300005843 | Bacteria | 2660 |
| 204 | Ga0068862_100001114 | 3300005844 | Bacteria | 25468 |
| 205 | Ga0068862_100346889 | 3300005844 | Bacteria | 1376 |
| 206 | Ga0068862_100406636 | 3300005844 | Bacteria | 1274 |
| 207 | Ga0068862_100424819 | 3300005844 | Bacteria | 1248 |
| 208 | Ga0068862_100425160 | 3300005844 | Bacteria | 1247 |
| 209 | Ga0070712_100226785 | 3300006175 | Bacteria | 1482 |
| 210 | Ga0097621_100082423 | 3300006237 | Bacteria | 2678 |
| 211 | Ga0097621_100199751 | 3300006237 | Bacteria | 1735 |
| 212 | Ga0068871_100039025 | 3300006358 | Bacteria | 3797 |
| 213 | Ga0075428_100100496 | 3300006844 | Bacteria | 3154 |
| 214 | Ga0075428_100926010 | 3300006844 | Bacteria | 924 |
| 215 | Ga0075428_102128889 | 3300006844 | Bacteria | 580 |
| 216 | Ga0075430_100044619 | 3300006846 | Bacteria | 3748 |
| 217 | Ga0075433_10003509 | 3300006852 | Bacteria | 12116 |
| 218 | Ga0075429_101087604 | 3300006880 | Bacteria | 698 |
| 219 | Ga0075429_101260124 | 3300006880 | Unclassified | 645 |
| 220 | Ga0068865_100198134 | 3300006881 | Bacteria | 1557 |
| 221 | Ga0068865_100794570 | 3300006881 | Bacteria | 816 |
| 222 | Ga0068865_100844297 | 3300006881 | Bacteria | 793 |
| 223 | Ga0068865_101055227 | 3300006881 | Bacteria | 714 |
| 224 | Ga0097620_100312951 | 3300006931 | Bacteria | 1664 |
| 225 | Ga0097620_100502390 | 3300006931 | Bacteria | 1308 |
| 226 | Ga0097620_102136113 | 3300006931 | Bacteria | 618 |
| 227 | Ga0105250_10382911 | 3300009092 | Bacteria | 621 |
| 228 | Ga0105240_10000091 | 3300009093 | Bacteria | 182507 |
| 229 | Ga0105240_10063524 | 3300009093 | Bacteria | 4593 |
| 230 | Ga0105240_10379092 | 3300009093 | Bacteria | 1598 |
| 231 | Ga0105240_10401634 | 3300009093 | Bacteria | 1543 |
| 232 | Ga0105245_10442388 | 3300009098 | Bacteria | 1307 |
| 233 | Ga0105245_10648439 | 3300009098 | Bacteria | 1086 |
| 234 | Ga0105247_10556048 | 3300009101 | Bacteria | 844 |
| 235 | Ga0114129_10028253 | 3300009147 | Bacteria | 7948 |
| 236 | Ga0114129_10414454 | 3300009147 | Bacteria | 1773 |
| 237 | Ga0105243_10317129 | 3300009148 | Bacteria | 1419 |
| 238 | Ga0105241_10105023 | 3300009174 | Bacteria | 2252 |
| 239 | Ga0105241_10157481 | 3300009174 | Bacteria | 1864 |
| 240 | Ga0105241_10502351 | 3300009174 | Bacteria | 1081 |
| 241 | Ga0105242_10096286 | 3300009176 | Bacteria | 2500 |
| 242 | Ga0105248_10014420 | 3300009177 | Bacteria | 8699 |
| 243 | Ga0105248_10074910 | 3300009177 | Bacteria | 3804 |
| 244 | Ga0105248_10213759 | 3300009177 | Bacteria | 2172 |
| 245 | Ga0105248_10264452 | 3300009177 | Bacteria | 1936 |
| 246 | Ga0105248_10748728 | 3300009177 | Bacteria | 1102 |
| 247 | Ga0105237_10117280 | 3300009545 | Bacteria | 2656 |
| 248 | Ga0105237_10528314 | 3300009545 | Bacteria | 1186 |
| 249 | Ga0105237_10586016 | 3300009545 | Bacteria | 1122 |
| 250 | Ga0105237_12549982 | 3300009545 | Bacteria | 522 |
| 251 | Ga0105238_10007597 | 3300009551 | Bacteria | 10862 |
| 252 | Ga0105238_10014453 | 3300009551 | Bacteria | 7983 |
| 253 | Ga0105238_10078669 | 3300009551 | Bacteria | 3288 |
| 254 | Ga0105238_12002746 | 3300009551 | Bacteria | 613 |
| 255 | Ga0105249_10118535 | 3300009553 | Bacteria | 2512 |
| 256 | Ga0105249_10248885 | 3300009553 | Bacteria | 1761 |
| 257 | Ga0105249_10848854 | 3300009553 | Bacteria | 979 |
| 258 | Ga0105239_10000376 | 3300010375 | Bacteria | 65247 |
| 259 | Ga0105239_10008832 | 3300010375 | Bacteria | 11406 |
| 260 | Ga0105239_10415258 | 3300010375 | Bacteria | 1524 |
| 261 | Ga0105239_10836534 | 3300010375 | Bacteria | 1055 |
| 262 | Ga0157373_10008634 | 3300013100 | Bacteria | 7560 |
| 263 | Ga0157373_10057439 | 3300013100 | Bacteria | 2760 |
| 264 | Ga0157373_10071404 | 3300013100 | Bacteria | 2452 |
| 265 | Ga0157373_10557127 | 3300013100 | Bacteria | 832 |
| 266 | Ga0157373_10873377 | 3300013100 | Bacteria | 666 |
| 267 | Ga0157373_10898740 | 3300013100 | Bacteria | 657 |
| 268 | Ga0157371_10018979 | 3300013102 | Bacteria | 5076 |
| 269 | Ga0157371_10029534 | 3300013102 | Bacteria | 3962 |
| 270 | Ga0157371_10044815 | 3300013102 | Bacteria | 3149 |
| 271 | Ga0157371_10226217 | 3300013102 | Bacteria | 1344 |
| 272 | Ga0157371_11282031 | 3300013102 | Bacteria | 566 |
| 273 | Ga0157370_10029403 | 3300013104 | Bacteria | 5392 |
| 274 | Ga0157370_10033009 | 3300013104 | Bacteria | 5048 |
| 275 | Ga0157370_10042598 | 3300013104 | Bacteria | 4373 |
| 276 | Ga0157370_10336179 | 3300013104 | Bacteria | 1392 |
| 277 | Ga0157370_11518941 | 3300013104 | Bacteria | 602 |
| 278 | Ga0157369_10010785 | 3300013105 | Bacteria | 10404 |
| 279 | Ga0157369_10012071 | 3300013105 | Bacteria | 9811 |
| 280 | Ga0157369_10059903 | 3300013105 | Bacteria | 4106 |
| 281 | Ga0157369_10137856 | 3300013105 | Bacteria | 2582 |
| 282 | Ga0157369_10173295 | 3300013105 | Bacteria | 2272 |
| 283 | Ga0157369_10964278 | 3300013105 | Unclassified | 874 |
| 284 | Ga0157369_11013663 | 3300013105 | Bacteria | 850 |
| 285 | Ga0157374_10020068 | 3300013296 | Bacteria | 5925 |
| 286 | Ga0157374_11151254 | 3300013296 | Bacteria | 797 |
| 287 | Ga0157378_10070470 | 3300013297 | Bacteria | 3139 |
| 288 | Ga0157378_10516400 | 3300013297 | Unclassified | 1195 |
| 289 | Ga0157378_12580559 | 3300013297 | Bacteria | 560 |
| 290 | Ga0163162_10115369 | 3300013306 | Bacteria | 2786 |
| 291 | Ga0163162_10858705 | 3300013306 | Bacteria | 1022 |
| 292 | Ga0157372_10001493 | 3300013307 | Bacteria | 25423 |
| 293 | Ga0157372_10106338 | 3300013307 | Bacteria | 3210 |
| 294 | Ga0157372_10212687 | 3300013307 | Bacteria | 2241 |
| 295 | Ga0157372_11695258 | 3300013307 | Bacteria | 727 |
| 296 | Ga0157375_10033918 | 3300013308 | Bacteria | 4856 |
| 297 | Ga0157375_10125711 | 3300013308 | Bacteria | 2679 |
| 298 | Ga0157375_10229296 | 3300013308 | Bacteria | 2016 |
| 299 | Ga0163163_10000714 | 3300014325 | Bacteria | 28173 |
| 300 | Ga0163163_10273607 | 3300014325 | Bacteria | 1740 |
| 301 | Ga0163163_11195182 | 3300014325 | Bacteria | 823 |
| 302 | Ga0182008_10122667 | 3300014497 | Bacteria | 1292 |
| 303 | Ga0157377_11082306 | 3300014745 | Bacteria | 613 |
| 304 | Ga0157379_10511762 | 3300014968 | Bacteria | 1113 |
| 305 | Ga0163161_10080229 | 3300017792 | Bacteria | 2401 |
| 306 | Ga0163161_10275018 | 3300017792 | Bacteria | 1319 |
| 307 | Ga0206353_12059669 | 3300020082 | Bacteria | 1142 |
| 308 | Ga0207697_10070463 | 3300025315 | Bacteria | 1464 |
| 309 | Ga0207656_10088861 | 3300025321 | Bacteria | 1400 |
| 310 | Ga0207656_10174304 | 3300025321 | Bacteria | 1029 |
| 311 | Ga0207642_10145801 | 3300025899 | Bacteria | 1254 |
| 312 | Ga0207688_10011568 | 3300025901 | Bacteria | 4802 |
| 313 | Ga0207688_10146906 | 3300025901 | Bacteria | 1390 |
| 314 | Ga0207680_10015740 | 3300025903 | Bacteria | 3954 |
| 315 | Ga0207680_10027901 | 3300025903 | Bacteria | 3152 |
| 316 | Ga0207680_10042520 | 3300025903 | Bacteria | 2659 |
| 317 | Ga0207647_10000304 | 3300025904 | Bacteria | 40516 |
| 318 | Ga0207647_10001979 | 3300025904 | Bacteria | 15655 |
| 319 | Ga0207647_10017375 | 3300025904 | Bacteria | 4890 |
| 320 | Ga0207647_10088294 | 3300025904 | Bacteria | 1851 |
| 321 | Ga0207699_10261558 | 3300025906 | Bacteria | 1196 |
| 322 | Ga0207699_10965440 | 3300025906 | Unclassified | 630 |
| 323 | Ga0207645_10002830 | 3300025907 | Bacteria | 13470 |
| 324 | Ga0207645_10306502 | 3300025907 | Bacteria | 1058 |
| 325 | Ga0207643_10075082 | 3300025908 | Bacteria | 1950 |
| 326 | Ga0207705_10000135 | 3300025909 | Bacteria | 79350 |
| 327 | Ga0207705_10006741 | 3300025909 | Bacteria | 8486 |
| 328 | Ga0207705_10042065 | 3300025909 | Bacteria | 3280 |
| 329 | Ga0207705_10078959 | 3300025909 | Bacteria | 2396 |
| 330 | Ga0207705_10181348 | 3300025909 | Bacteria | 1589 |
| 331 | Ga0207705_10523936 | 3300025909 | Bacteria | 921 |
| 332 | Ga0207705_10748777 | 3300025909 | Unclassified | 759 |
| 333 | Ga0207705_10877659 | 3300025909 | Bacteria | 695 |
| 334 | Ga0207705_11033323 | 3300025909 | Bacteria | 634 |
| 335 | Ga0207654_10015255 | 3300025911 | Bacteria | 3984 |
| 336 | Ga0207707_10914750 | 3300025912 | Unclassified | 724 |
| 337 | Ga0207695_10000018 | 3300025913 | Bacteria | 766611 |
| 338 | Ga0207695_10000182 | 3300025913 | Bacteria | 184125 |
| 339 | Ga0207695_10011980 | 3300025913 | Bacteria | 10434 |
| 340 | Ga0207695_10268379 | 3300025913 | Bacteria | 1603 |
| 341 | Ga0207671_10005975 | 3300025914 | Bacteria | 11019 |
| 342 | Ga0207671_10239481 | 3300025914 | Bacteria | 1425 |
| 343 | Ga0207660_10023742 | 3300025917 | Bacteria | 4144 |
| 344 | Ga0207657_10000218 | 3300025919 | Bacteria | 59661 |
| 345 | Ga0207657_10004622 | 3300025919 | Bacteria | 14538 |
| 346 | Ga0207657_10015148 | 3300025919 | Bacteria | 7488 |
| 347 | Ga0207657_10015997 | 3300025919 | Bacteria | 7243 |
| 348 | Ga0207657_10095191 | 3300025919 | Bacteria | 2478 |
| 349 | Ga0207657_10227527 | 3300025919 | Unclassified | 1492 |
| 350 | Ga0207657_10499053 | 3300025919 | Bacteria | 953 |
| 351 | Ga0207657_10744505 | 3300025919 | Bacteria | 760 |
| 352 | Ga0207649_10001300 | 3300025920 | Bacteria | 14891 |
| 353 | Ga0207649_10063433 | 3300025920 | Bacteria | 2333 |
| 354 | Ga0207649_10067134 | 3300025920 | Bacteria | 2276 |
| 355 | Ga0207649_10165348 | 3300025920 | Bacteria | 1536 |
| 356 | Ga0207649_10288029 | 3300025920 | Bacteria | 1197 |
| 357 | Ga0207649_10844935 | 3300025920 | Bacteria | 716 |
| 358 | Ga0207649_11108614 | 3300025920 | Bacteria | 624 |
| 359 | Ga0207652_10187838 | 3300025921 | Bacteria | 1858 |
| 360 | Ga0207652_11102425 | 3300025921 | Bacteria | 694 |
| 361 | Ga0207681_10002262 | 3300025923 | Bacteria | 12234 |
| 362 | Ga0207681_10032831 | 3300025923 | Bacteria | 3401 |
| 363 | Ga0207681_10155675 | 3300025923 | Bacteria | 1717 |
| 364 | Ga0207681_10271946 | 3300025923 | Unclassified | 1330 |
| 365 | Ga0207694_10000018 | 3300025924 | Bacteria | 331281 |
| 366 | Ga0207694_10006600 | 3300025924 | Bacteria | 8819 |
| 367 | Ga0207694_10034661 | 3300025924 | Bacteria | 3871 |
| 368 | Ga0207694_10260832 | 3300025924 | Bacteria | 1420 |
| 369 | Ga0207650_10002617 | 3300025925 | Bacteria | 12461 |
| 370 | Ga0207650_10197756 | 3300025925 | Bacteria | 1609 |
| 371 | Ga0207659_10008178 | 3300025926 | Bacteria | 6480 |
| 372 | Ga0207659_10457188 | 3300025926 | Bacteria | 1076 |
| 373 | Ga0207664_10477144 | 3300025929 | Bacteria | 1115 |
| 374 | Ga0207664_10602573 | 3300025929 | Bacteria | 987 |
| 375 | Ga0207644_10006138 | 3300025931 | Bacteria | 7836 |
| 376 | Ga0207644_10025184 | 3300025931 | Bacteria | 4090 |
| 377 | Ga0207644_10399847 | 3300025931 | Bacteria | 1123 |
| 378 | Ga0207644_10803307 | 3300025931 | Bacteria | 787 |
| 379 | Ga0207690_10002193 | 3300025932 | Bacteria | 11904 |
| 380 | Ga0207690_10009646 | 3300025932 | Bacteria | 5732 |
| 381 | Ga0207690_10046075 | 3300025932 | Bacteria | 2886 |
| 382 | Ga0207690_10277460 | 3300025932 | Bacteria | 1304 |
| 383 | Ga0207690_10829861 | 3300025932 | Bacteria | 765 |
| 384 | Ga0207690_11220959 | 3300025932 | Bacteria | 628 |
| 385 | Ga0207690_11678324 | 3300025932 | Bacteria | 531 |
| 386 | Ga0207706_10007550 | 3300025933 | Bacteria | 10061 |
| 387 | Ga0207706_10009959 | 3300025933 | Bacteria | 8711 |
| 388 | Ga0207706_10136165 | 3300025933 | Bacteria | 2161 |
| 389 | Ga0207706_10223260 | 3300025933 | Bacteria | 1649 |
| 390 | Ga0207706_10251426 | 3300025933 | Bacteria | 1544 |
| 391 | Ga0207706_10682304 | 3300025933 | Bacteria | 878 |
| 392 | Ga0207706_10847014 | 3300025933 | Bacteria | 774 |
| 393 | Ga0207686_10644790 | 3300025934 | Bacteria | 837 |
| 394 | Ga0207709_10455537 | 3300025935 | Bacteria | 990 |
| 395 | Ga0207669_10237469 | 3300025937 | Bacteria | 1349 |
| 396 | Ga0207669_10319264 | 3300025937 | Bacteria | 1188 |
| 397 | Ga0207704_10136713 | 3300025938 | Bacteria | 1707 |
| 398 | Ga0207704_11002057 | 3300025938 | Bacteria | 706 |
| 399 | Ga0207691_10003132 | 3300025940 | Bacteria | 16163 |
| 400 | Ga0207691_10023380 | 3300025940 | Bacteria | 5817 |
| 401 | Ga0207691_10059576 | 3300025940 | Bacteria | 3471 |
| 402 | Ga0207691_10060280 | 3300025940 | Bacteria | 3448 |
| 403 | Ga0207691_10064573 | 3300025940 | Bacteria | 3316 |
| 404 | Ga0207711_10056934 | 3300025941 | Bacteria | 3360 |
| 405 | Ga0207711_10444335 | 3300025941 | Bacteria | 1207 |
| 406 | Ga0207711_11596356 | 3300025941 | Bacteria | 596 |
| 407 | Ga0207711_12059541 | 3300025941 | Bacteria | 513 |
| 408 | Ga0207689_10024146 | 3300025942 | Bacteria | 5100 |
| 409 | Ga0207689_10131983 | 3300025942 | Bacteria | 2056 |
| 410 | Ga0207661_10019687 | 3300025944 | Bacteria | 5037 |
| 411 | Ga0207661_10036199 | 3300025944 | Bacteria | 3851 |
| 412 | Ga0207661_10074018 | 3300025944 | Bacteria | 2791 |
| 413 | Ga0207661_11210291 | 3300025944 | Bacteria | 695 |
| 414 | Ga0207679_10003933 | 3300025945 | Bacteria | 9227 |
| 415 | Ga0207679_10045226 | 3300025945 | Bacteria | 3183 |
| 416 | Ga0207679_10072460 | 3300025945 | Bacteria | 2602 |
| 417 | Ga0207679_10138512 | 3300025945 | Bacteria | 1963 |
| 418 | Ga0207679_10220984 | 3300025945 | Bacteria | 1594 |
| 419 | Ga0207667_10000052 | 3300025949 | Bacteria | 232415 |
| 420 | Ga0207667_10000122 | 3300025949 | Bacteria | 121588 |
| 421 | Ga0207667_10002731 | 3300025949 | Bacteria | 21813 |
| 422 | Ga0207667_10024256 | 3300025949 | Bacteria | 6663 |
| 423 | Ga0207667_10114384 | 3300025949 | Bacteria | 2781 |
| 424 | Ga0207667_10145736 | 3300025949 | Bacteria | 2438 |
| 425 | Ga0207667_11486505 | 3300025949 | Bacteria | 649 |
| 426 | Ga0207651_10036061 | 3300025960 | Bacteria | 3224 |
| 427 | Ga0207651_10600119 | 3300025960 | Bacteria | 962 |
| 428 | Ga0207651_10799366 | 3300025960 | Bacteria | 836 |
| 429 | Ga0207651_11243576 | 3300025960 | Unclassified | 669 |
| 430 | Ga0207651_11288307 | 3300025960 | Bacteria | 657 |
| 431 | Ga0207712_10046019 | 3300025961 | Bacteria | 3023 |
| 432 | Ga0207712_10085485 | 3300025961 | Bacteria | 2309 |
| 433 | Ga0207712_10589072 | 3300025961 | Bacteria | 961 |
| 434 | Ga0207668_10000176 | 3300025972 | Bacteria | 43587 |
| 435 | Ga0207668_10316515 | 3300025972 | Bacteria | 1293 |
| 436 | Ga0207668_10646649 | 3300025972 | Bacteria | 925 |
| 437 | Ga0207668_11646693 | 3300025972 | Bacteria | 579 |
| 438 | Ga0207640_10003064 | 3300025981 | Bacteria | 9004 |
| 439 | Ga0207640_10088899 | 3300025981 | Bacteria | 2134 |
| 440 | Ga0207640_10099471 | 3300025981 | Bacteria | 2036 |
| 441 | Ga0207640_10397049 | 3300025981 | Bacteria | 1122 |
| 442 | Ga0207640_10788061 | 3300025981 | Unclassified | 822 |
| 443 | Ga0207658_10050488 | 3300025986 | Bacteria | 3061 |
| 444 | Ga0207658_10110539 | 3300025986 | Bacteria | 2171 |
| 445 | Ga0207658_10125147 | 3300025986 | Bacteria | 2056 |
| 446 | Ga0207658_10182202 | 3300025986 | Bacteria | 1739 |
| 447 | Ga0207677_10188122 | 3300026023 | Bacteria | 1631 |
| 448 | Ga0207677_10755238 | 3300026023 | Bacteria | 867 |
| 449 | Ga0207703_10015939 | 3300026035 | Bacteria | 5861 |
| 450 | Ga0207703_11029149 | 3300026035 | Bacteria | 790 |
| 451 | Ga0207639_10001293 | 3300026041 | Bacteria | 16903 |
| 452 | Ga0207639_10025287 | 3300026041 | Bacteria | 4304 |
| 453 | Ga0207639_10123686 | 3300026041 | Bacteria | 2130 |
| 454 | Ga0207639_11291569 | 3300026041 | Bacteria | 685 |
| 455 | Ga0207678_10006571 | 3300026067 | Bacteria | 10308 |
| 456 | Ga0207678_10237657 | 3300026067 | Bacteria | 1560 |
| 457 | Ga0207678_10614225 | 3300026067 | Bacteria | 954 |
| 458 | Ga0207702_10008605 | 3300026078 | Bacteria | 8605 |
| 459 | Ga0207702_10029498 | 3300026078 | Bacteria | 4565 |
| 460 | Ga0207702_10148145 | 3300026078 | Bacteria | 2132 |
| 461 | Ga0207702_11911831 | 3300026078 | Bacteria | 585 |
| 462 | Ga0207641_11078794 | 3300026088 | Bacteria | 801 |
| 463 | Ga0207648_10001235 | 3300026089 | Bacteria | 28702 |
| 464 | Ga0207648_10552020 | 3300026089 | Bacteria | 1058 |
| 465 | Ga0207648_12146299 | 3300026089 | Bacteria | 519 |
| 466 | Ga0207676_10161763 | 3300026095 | Bacteria | 1940 |
| 467 | Ga0207674_10003594 | 3300026116 | Bacteria | 18907 |
| 468 | Ga0207674_10005519 | 3300026116 | Bacteria | 15020 |
| 469 | Ga0207674_10027930 | 3300026116 | Bacteria | 5962 |
| 470 | Ga0207674_10048179 | 3300026116 | Bacteria | 4363 |
| 471 | Ga0207675_100078855 | 3300026118 | Bacteria | 3086 |
| 472 | Ga0207675_100336443 | 3300026118 | Bacteria | 1477 |
| 473 | Ga0207675_100544554 | 3300026118 | Bacteria | 1159 |
| 474 | Ga0207683_10375386 | 3300026121 | Bacteria | 1307 |
| 475 | Ga0207683_10777150 | 3300026121 | Bacteria | 889 |
| 476 | Ga0207698_10002558 | 3300026142 | Bacteria | 10794 |
| 477 | Ga0207698_10043642 | 3300026142 | Bacteria | 3361 |
| 478 | Ga0207698_10094813 | 3300026142 | Bacteria | 2455 |
| 479 | Ga0207698_10493426 | 3300026142 | Bacteria | 1190 |
| 480 | Ga0207698_10744209 | 3300026142 | Bacteria | 979 |
| 481 | Ga0207698_11939163 | 3300026142 | Bacteria | 604 |
| 482 | Ga0268266_10014168 | 3300028379 | Bacteria | 6860 |
| 483 | Ga0268266_10068863 | 3300028379 | Bacteria | 3065 |
| 484 | Ga0268266_11498434 | 3300028379 | Bacteria | 650 |
| 485 | Ga0268265_10000904 | 3300028380 | Bacteria | 27551 |
| 486 | Ga0268265_10048556 | 3300028380 | Bacteria | 3186 |
| 487 | Ga0268265_10156085 | 3300028380 | Bacteria | 1931 |
| 488 | Ga0268265_10569408 | 3300028380 | Bacteria | 1078 |
| 489 | Ga0268264_10001156 | 3300028381 | Bacteria | 25715 |
| 490 | Ga0268264_10016372 | 3300028381 | Bacteria | 6070 |
| 491 | Ga0307408_100415632 | 3300031548 | Bacteria | 1158 |
| 492 | Ga0307516_10111367 | 3300031730 | Bacteria | 2539 |
| 493 | Ga0307413_10135808 | 3300031824 | Bacteria | 1691 |
| 494 | Ga0307413_10265371 | 3300031824 | Bacteria | 1282 |
| 495 | Ga0307413_10458826 | 3300031824 | Bacteria | 1013 |
| 496 | Ga0307410_11374137 | 3300031852 | Bacteria | 619 |
| 497 | Ga0307406_11667361 | 3300031901 | Bacteria | 564 |
| 498 | Ga0307407_10422154 | 3300031903 | Bacteria | 961 |
| 499 | Ga0307412_10157718 | 3300031911 | Bacteria | 1682 |
| 500 | Ga0307412_10651269 | 3300031911 | Bacteria | 898 |
| 501 | Ga0307409_100348334 | 3300031995 | Bacteria | 1397 |
| 502 | Ga0307409_101055461 | 3300031995 | Bacteria | 832 |
| 503 | Ga0307416_100071968 | 3300032002 | Bacteria | 2875 |
| 504 | Ga0307416_100181694 | 3300032002 | Bacteria | 1972 |
| 505 | Ga0307416_103027041 | 3300032002 | Bacteria | 562 |
| 506 | Ga0307411_10014233 | 3300032005 | Bacteria | 4419 |
| 507 | Ga0307411_10262106 | 3300032005 | Bacteria | 1365 |
| 508 | Ga0307415_100122261 | 3300032126 | Bacteria | 1954 |
| 509 | Ga0307415_101287285 | 3300032126 | Bacteria | 692 |
| 510 | Ga0373957_0161724 | 3300035120 | Bacteria | 922 |
| 511 | Ga0373946_0441453 | 3300035171 | Unclassified | 662 |
| 512 | Ga0395899_0008386 | 3300037312 | Bacteria | 7957 |
| 513 | Ga0395899_0111018 | 3300037312 | Bacteria | 1971 |
| 514 | Ga0395899_0129549 | 3300037312 | Bacteria | 1802 |
| 515 | Ga0395899_0151857 | 3300037312 | Bacteria | 1641 |
| 516 | Ga0395899_0199188 | 3300037312 | Bacteria | 1397 |
| 517 | Ga0395899_0309678 | 3300037312 | Bacteria | 1066 |
| 518 | Ga0395899_0656003 | 3300037312 | Bacteria | 662 |
| 519 | Ga0395899_0705927 | 3300037312 | Bacteria | 632 |
| 520 | Ga0395900_0009073 | 3300037418 | Bacteria | 10195 |
| 521 | Ga0395900_0083382 | 3300037418 | Bacteria | 3284 |
| 522 | Ga0395900_0087987 | 3300037418 | Bacteria | 3193 |
| 523 | Ga0395900_0122334 | 3300037418 | Bacteria | 2669 |
| 524 | Ga0395900_0142309 | 3300037418 | Bacteria | 2455 |
| 525 | Ga0395900_0172489 | 3300037418 | Bacteria | 2201 |
| 526 | Ga0395900_0179898 | 3300037418 | Bacteria | 2149 |
| 527 | Ga0395900_0463639 | 3300037418 | Bacteria | 1221 |
| 528 | Ga0395900_0544104 | 3300037418 | Bacteria | 1106 |
| 529 | Ga0395900_0577600 | 3300037418 | Bacteria | 1066 |
| 530 | Ga0395900_0816722 | 3300037418 | Unclassified | 859 |
| 531 | Ga0395898_0174900 | 3300037466 | Bacteria | 2052 |
| 532 | Ga0395898_0224343 | 3300037466 | Bacteria | 1792 |
| 533 | Ga0395898_0239235 | 3300037466 | Bacteria | 1731 |
| 534 | Ga0395898_0292965 | 3300037466 | Bacteria | 1552 |
| 535 | Ga0395898_0486032 | 3300037466 | Bacteria | 1175 |
| 536 | Ga0395898_0606387 | 3300037466 | Bacteria | 1037 |
| 537 | Ga0395898_0758196 | 3300037466 | Bacteria | 912 |
| 538 | Ga0395898_0997191 | 3300037466 | Bacteria | 773 |
| 539 | Ga0395898_1272127 | 3300037466 | Bacteria | 666 |
| 540 | Ga0395905_0001242 | 3300037471 | Bacteria | 31620 |
| 541 | Ga0395905_0030728 | 3300037471 | Bacteria | 5058 |
| 542 | Ga0395905_0069544 | 3300037471 | Bacteria | 3297 |
| 543 | Ga0395905_0104679 | 3300037471 | Bacteria | 2656 |
| 544 | Ga0395905_0139308 | 3300037471 | Bacteria | 2282 |
| 545 | Ga0395905_0143489 | 3300037471 | Bacteria | 2247 |
| 546 | Ga0395905_0156886 | 3300037471 | Bacteria | 2140 |
| 547 | Ga0395905_0235192 | 3300037471 | Bacteria | 1713 |
| 548 | Ga0395905_0352337 | 3300037471 | Bacteria | 1364 |
| 549 | Ga0395905_0353532 | 3300037471 | Bacteria | 1361 |
| 550 | Ga0395905_0363950 | 3300037471 | Bacteria | 1339 |
| 551 | Ga0395905_0391449 | 3300037471 | Bacteria | 1284 |
| 552 | Ga0395905_0587324 | 3300037471 | Bacteria | 1015 |
| 553 | Ga0395905_0662350 | 3300037471 | Bacteria | 946 |
| 554 | Ga0395905_0774781 | 3300037471 | Bacteria | 862 |
| 555 | Ga0395905_0819293 | 3300037471 | Unclassified | 834 |
| 556 | Ga0395905_1865644 | 3300037471 | Bacteria | 507 |
| 557 | Ga0395901_0039984 | 3300038443 | Bacteria | 4854 |
| 558 | Ga0395901_0070766 | 3300038443 | Bacteria | 3634 |
| 559 | Ga0395901_0087694 | 3300038443 | Bacteria | 3254 |
| 560 | Ga0395901_0091910 | 3300038443 | Bacteria | 3176 |
| 561 | Ga0395901_0351820 | 3300038443 | Bacteria | 1520 |
| 562 | Ga0395901_0438251 | 3300038443 | Bacteria | 1338 |
| 563 | Ga0395901_0450315 | 3300038443 | Bacteria | 1316 |
| 564 | Ga0395901_0484106 | 3300038443 | Bacteria | 1262 |
| 565 | Ga0395901_0791437 | 3300038443 | Bacteria | 938 |
| 566 | Ga0395901_0804646 | 3300038443 | Unclassified | 928 |
| 567 | Ga0395901_0957150 | 3300038443 | Bacteria | 834 |
| 568 | Ga0395901_1399795 | 3300038443 | Bacteria | 658 |
| 569 | Ga0395901_1902151 | 3300038443 | Bacteria | 542 |
| 570 | Ga0395901_2118286 | 3300038443 | Unclassified | 507 |
| 571 | Ga0436365_1455190 | 3300039437 | Bacteria | 626 |
| 572 | Ga0436363_0286509 | 3300039450 | Unclassified | 933 |
| 573 | Ga0436362_0313465 | 3300039453 | Bacteria | 509 |
| 574 | Ga0466972_0043338 | 3300044658 | Bacteria | 2186 |
| 575 | Ga0466972_0124719 | 3300044658 | Bacteria | 1214 |
| 576 | Ga0466965_0155271 | 3300044683 | Bacteria | 1198 |
| 577 | Ga0466965_0286873 | 3300044683 | Bacteria | 890 |
| 578 | Ga0466961_0245935 | 3300044693 | Bacteria | 1099 |
| 579 | Ga0466963_0098926 | 3300044694 | Bacteria | 1994 |
| 580 | Ga0466971_0133143 | 3300044719 | Bacteria | 1155 |
| 581 | Ga0466968_0554556 | 3300044735 | Bacteria | 577 |
| 582 | Ga0466970_0157013 | 3300044765 | Bacteria | 1257 |
| 583 | Ga0466957_0155899 | 3300044842 | Bacteria | 1480 |
| 584 | Ga0466957_0341220 | 3300044842 | Bacteria | 1015 |
| 585 | Ga0466959_0143961 | 3300045049 | Bacteria | 1683 |
| 586 | Ga0466958_0376259 | 3300045836 | Bacteria | 915 |
| 587 | Ga0466967_0025276 | 3300045976 | Bacteria | 4895 |
| 588 | Ga0466967_0047283 | 3300045976 | Bacteria | 3750 |
| 589 | Ga0466967_0182456 | 3300045976 | Bacteria | 1980 |
| 590 | Ga0466967_0624932 | 3300045976 | Bacteria | 1064 |
| 591 | Ga0466967_1396082 | 3300045976 | Bacteria | 697 |
| 592 | Ga0495616_0063485 | 3300046513 | Bacteria | 1805 |
| 593 | Ga0495622_0287546 | 3300046557 | Bacteria | 718 |
| 594 | Ga0495668_0030068 | 3300046616 | Bacteria | 3068 |
| 595 | Ga0495668_0328134 | 3300046616 | Bacteria | 839 |
| 596 | Ga0495669_0000549 | 3300046684 | Bacteria | 16751 |
| 597 | Ga0495669_0011110 | 3300046684 | Bacteria | 3815 |
| 598 | Ga0495669_0138276 | 3300046684 | Bacteria | 1149 |
| 599 | Ga0495669_0293543 | 3300046684 | Bacteria | 783 |
| 600 | Ga0495669_0333553 | 3300046684 | Bacteria | 732 |
| 601 | Ga0495604_1019052 | 3300047317 | Bacteria | 512 |
| 602 | Ga0496100_0176715 | 3300048903 | Bacteria | 1542 |
| 603 | Ga0496101_0463427 | 3300048904 | Bacteria | 1000 |
| 604 | Ga0496101_0757758 | 3300048904 | Bacteria | 766 |
| 605 | Ga0496104_0973694 | 3300048907 | Unclassified | 753 |
| 606 | Ga0496106_0399771 | 3300048909 | Bacteria | 1104 |
| 607 | Ga0496108_0131842 | 3300048911 | Bacteria | 2148 |
| 608 | Ga0496108_0991350 | 3300048911 | Unclassified | 718 |
| 609 | Ga0496109_0061968 | 3300048912 | Bacteria | 3420 |
| 610 | Ga0496109_1700530 | 3300048912 | Bacteria | 565 |
| 611 | Ga0496110_1262798 | 3300048913 | Unclassified | 648 |
| 612 | Ga0496111_0005000 | 3300048914 | Bacteria | 8435 |
| 613 | Ga0496111_0275715 | 3300048914 | Unclassified | 1248 |
| 614 | Ga0496111_0483005 | 3300048914 | Bacteria | 913 |
| 615 | Ga0496112_0010612 | 3300048915 | Bacteria | 8369 |
| 616 | Ga0496112_0261489 | 3300048915 | Bacteria | 1680 |
| 617 | Ga0496112_0389025 | 3300048915 | Unclassified | 1335 |
| 618 | Ga0496112_1156826 | 3300048915 | Bacteria | 691 |
| 619 | Ga0496113_1023633 | 3300048916 | Bacteria | 650 |
| 620 | Ga0496114_0053296 | 3300048917 | Bacteria | 3372 |
| 621 | Ga0496114_0143355 | 3300048917 | Bacteria | 2070 |
| 622 | Ga0496115_0001963 | 3300048918 | Bacteria | 14678 |
| 623 | Ga0495682_0001599 | 3300049460 | Bacteria | 11741 |
| 624 | Ga0501047_0008272 | 3300049581 | Bacteria | 9821 |
| 625 | Ga0501067_0001368 | 3300049583 | Bacteria | 13198 |
| 626 | Ga0501067_0018749 | 3300049583 | Bacteria | 3830 |
| 627 | Ga0501068_1134089 | 3300049584 | Bacteria | 517 |
| 628 | Ga0501069_0304112 | 3300049585 | Bacteria | 936 |
| 629 | Ga0501070_0058487 | 3300049586 | Bacteria | 3196 |
| 630 | Ga0501070_0341610 | 3300049586 | Bacteria | 1216 |
| 631 | Ga0501071_0530908 | 3300049587 | Bacteria | 903 |
| 632 | Ga0501071_1116940 | 3300049587 | Unclassified | 609 |
| 633 | Ga0501072_0019146 | 3300049588 | Bacteria | 5287 |
| 634 | Ga0501073_0283728 | 3300049589 | Bacteria | 1142 |
| 635 | Ga0501073_1000480 | 3300049589 | Bacteria | 575 |
| 636 | Ga0501074_0948379 | 3300049590 | Unclassified | 605 |
| 637 | Ga0501079_0196512 | 3300049741 | Bacteria | 1575 |
| 638 | Ga0501080_0293458 | 3300049742 | Bacteria | 1476 |
| 639 | Ga0501080_0355792 | 3300049742 | Bacteria | 1321 |
| 640 | Ga0501083_0427276 | 3300049744 | Unclassified | 862 |
| 641 | nmdc:mga05p37_560584_c1 | 3300050507 | Bacteria | 1298 |
| 642 | nmdc:mga09592_544277_c1 | 3300050508 | Bacteria | 997 |
| 643 | nmdc:mga09592_990168_c1 | 3300050508 | Bacteria | 703 |
| 644 | nmdc:mga0qj67_22674_c1 | 3300050509 | Bacteria | 4824 |
| 645 | nmdc:mga06r32_23609_c1 | 3300050510 | Bacteria | 5693 |
| 646 | nmdc:mga06r32_305613_c1 | 3300050510 | Bacteria | 1576 |
| 647 | nmdc:mga08y16_544379_c1 | 3300050511 | Bacteria | 1175 |
| 648 | nmdc:mga0a205_696_c1 | 3300050515 | Bacteria | 26947 |
| 649 | Ga0500655_015682 | 3300053133 | Bacteria | 1391 |
| 650 | Ga0500655_069298 | 3300053133 | Bacteria | 717 |
| 651 | Ga0501084_0185405 | 3300054114 | Bacteria | 1756 |
| 652 | Ga0501082_1272647 | 3300060353 | Unclassified | 643 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003322 | rootL2_10308702 | rootL2_103087022 | 120 |
| 2 | 3300001904 | JGI24736J21556_1006172 | JGI24736J21556_10061722 | 126 |
| 3 | 3300001904 | JGI24736J21556_1010414 | JGI24736J21556_10104141 | 126 |
| 4 | 3300001979 | JGI24740J21852_10013781 | JGI24740J21852_100137812 | 126 |
| 5 | 3300001990 | JGI24737J22298_10041741 | JGI24737J22298_100417412 | 126 |
| 6 | 3300002067 | JGI24735J21928_10017941 | JGI24735J21928_100179413 | 126 |
| 7 | 3300002075 | JGI24738J21930_10019421 | JGI24738J21930_100194212 | 126 |
| 8 | 3300002076 | JGI24749J21850_1025010 | JGI24749J21850_10250102 | 126 |
| 9 | 3300005293 | Ga0065715_10117818 | Ga0065715_101178182 | 126 |
| 10 | 3300005293 | Ga0065715_10299185 | Ga0065715_102991852 | 126 |
| 11 | 3300005293 | Ga0065715_10359860 | Ga0065715_103598602 | 126 |
| 12 | 3300005327 | Ga0070658_10008367 | Ga0070658_100083671 | 126 |
| 13 | 3300005327 | Ga0070658_10038048 | Ga0070658_100380484 | 126 |
| 14 | 3300005327 | Ga0070658_10082660 | Ga0070658_100826602 | 126 |
| 15 | 3300005327 | Ga0070658_10333353 | Ga0070658_103333533 | 126 |
| 16 | 3300005327 | Ga0070658_10364366 | Ga0070658_103643662 | 126 |
| 17 | 3300005327 | Ga0070658_11124524 | Ga0070658_111245241 | 126 |
| 18 | 3300005327 | Ga0070658_11319635 | Ga0070658_113196351 | 126 |
| 19 | 3300005328 | Ga0070676_10000682 | Ga0070676_1000068221 | 126 |
| 20 | 3300005328 | Ga0070676_10420428 | Ga0070676_104204282 | 126 |
| 21 | 3300005329 | Ga0070683_100006463 | Ga0070683_1000064632 | 126 |
| 22 | 3300005329 | Ga0070683_100134672 | Ga0070683_1001346723 | 126 |
| 23 | 3300005329 | Ga0070683_100675923 | Ga0070683_1006759231 | 126 |
| 24 | 3300005329 | Ga0070683_101876278 | Ga0070683_1018762781 | 126 |
| 25 | 3300005331 | Ga0070670_100002114 | Ga0070670_10000211411 | 126 |
| 26 | 3300005333 | Ga0070677_10155498 | Ga0070677_101554982 | 126 |
| 27 | 3300005334 | Ga0068869_100106010 | Ga0068869_1001060102 | 126 |
| 28 | 3300005335 | Ga0070666_10003993 | Ga0070666_100039932 | 126 |
| 29 | 3300005335 | Ga0070666_10871686 | Ga0070666_108716861 | 126 |
| 30 | 3300005335 | Ga0070666_11357817 | Ga0070666_113578171 | 126 |
| 31 | 3300005336 | Ga0070680_100005609 | Ga0070680_1000056096 | 126 |
| 32 | 3300005337 | Ga0070682_100818093 | Ga0070682_1008180931 | 126 |
| 33 | 3300005338 | Ga0068868_100099536 | Ga0068868_1000995362 | 126 |
| 34 | 3300005339 | Ga0070660_100005696 | Ga0070660_1000056968 | 126 |
| 35 | 3300005339 | Ga0070660_100024581 | Ga0070660_1000245811 | 126 |
| 36 | 3300005339 | Ga0070660_100047696 | Ga0070660_1000476964 | 126 |
| 37 | 3300005339 | Ga0070660_100091750 | Ga0070660_1000917503 | 126 |
| 38 | 3300005339 | Ga0070660_100139319 | Ga0070660_1001393192 | 126 |
| 39 | 3300005339 | Ga0070660_100146733 | Ga0070660_1001467332 | 126 |
| 40 | 3300005339 | Ga0070660_100188540 | Ga0070660_1001885402 | 126 |
| 41 | 3300005339 | Ga0070660_100479480 | Ga0070660_1004794802 | 126 |
| 42 | 3300005339 | Ga0070660_100633599 | Ga0070660_1006335992 | 126 |
| 43 | 3300005339 | Ga0070660_100731196 | Ga0070660_1007311961 | 126 |
| 44 | 3300005339 | Ga0070660_101608892 | Ga0070660_1016088921 | 126 |
| 45 | 3300005341 | Ga0070691_10001098 | Ga0070691_1000109813 | 126 |
| 46 | 3300005344 | Ga0070661_100003037 | Ga0070661_10000303710 | 126 |
| 47 | 3300005344 | Ga0070661_100005718 | Ga0070661_10000571812 | 126 |
| 48 | 3300005344 | Ga0070661_100011620 | Ga0070661_1000116202 | 126 |
| 49 | 3300005344 | Ga0070661_100024161 | Ga0070661_1000241613 | 126 |
| 50 | 3300005344 | Ga0070661_100259232 | Ga0070661_1002592322 | 126 |
| 51 | 3300005344 | Ga0070661_100630412 | Ga0070661_1006304122 | 126 |
| 52 | 3300005344 | Ga0070661_101176673 | Ga0070661_1011766731 | 126 |
| 53 | 3300005345 | Ga0070692_10015285 | Ga0070692_100152853 | 126 |
| 54 | 3300005345 | Ga0070692_10064669 | Ga0070692_100646692 | 126 |
| 55 | 3300005345 | Ga0070692_10850524 | Ga0070692_108505241 | 126 |
| 56 | 3300005347 | Ga0070668_100000324 | Ga0070668_10000032430 | 126 |
| 57 | 3300005347 | Ga0070668_100041353 | Ga0070668_1000413533 | 126 |
| 58 | 3300005347 | Ga0070668_100284701 | Ga0070668_1002847012 | 126 |
| 59 | 3300005347 | Ga0070668_100335509 | Ga0070668_1003355091 | 126 |
| 60 | 3300005347 | Ga0070668_101483390 | Ga0070668_1014833901 | 126 |
| 61 | 3300005353 | Ga0070669_100033427 | Ga0070669_1000334274 | 126 |
| 62 | 3300005353 | Ga0070669_100069490 | Ga0070669_1000694902 | 126 |
| 63 | 3300005353 | Ga0070669_100771678 | Ga0070669_1007716781 | 126 |
| 64 | 3300005353 | Ga0070669_101256360 | Ga0070669_1012563601 | 126 |
| 65 | 3300005354 | Ga0070675_100000985 | Ga0070675_1000009858 | 126 |
| 66 | 3300005354 | Ga0070675_100017593 | Ga0070675_1000175934 | 126 |
| 67 | 3300005354 | Ga0070675_100316728 | Ga0070675_1003167282 | 126 |
| 68 | 3300005354 | Ga0070675_100818058 | Ga0070675_1008180581 | 126 |
| 69 | 3300005355 | Ga0070671_100004978 | Ga0070671_10000497811 | 126 |
| 70 | 3300005355 | Ga0070671_100153584 | Ga0070671_1001535843 | 126 |
| 71 | 3300005356 | Ga0070674_100520985 | Ga0070674_1005209852 | 126 |
| 72 | 3300005364 | Ga0070673_100040573 | Ga0070673_1000405732 | 126 |
| 73 | 3300005364 | Ga0070673_100083750 | Ga0070673_1000837503 | 126 |
| 74 | 3300005364 | Ga0070673_100140940 | Ga0070673_1001409402 | 126 |
| 75 | 3300005364 | Ga0070673_100288269 | Ga0070673_1002882692 | 126 |
| 76 | 3300005364 | Ga0070673_100523984 | Ga0070673_1005239842 | 126 |
| 77 | 3300005364 | Ga0070673_100819560 | Ga0070673_1008195602 | 126 |
| 78 | 3300005364 | Ga0070673_101080367 | Ga0070673_1010803672 | 126 |
| 79 | 3300005364 | Ga0070673_101319533 | Ga0070673_1013195331 | 126 |
| 80 | 3300005365 | Ga0070688_100169075 | Ga0070688_1001690752 | 126 |
| 81 | 3300005366 | Ga0070659_100006134 | Ga0070659_1000061346 | 126 |
| 82 | 3300005366 | Ga0070659_100016674 | Ga0070659_1000166742 | 126 |
| 83 | 3300005366 | Ga0070659_100054153 | Ga0070659_1000541533 | 126 |
| 84 | 3300005366 | Ga0070659_100221280 | Ga0070659_1002212802 | 126 |
| 85 | 3300005366 | Ga0070659_100227000 | Ga0070659_1002270003 | 126 |
| 86 | 3300005366 | Ga0070659_100287714 | Ga0070659_1002877142 | 126 |
| 87 | 3300005366 | Ga0070659_101367946 | Ga0070659_1013679462 | 126 |
| 88 | 3300005366 | Ga0070659_101376117 | Ga0070659_1013761172 | 126 |
| 89 | 3300005366 | Ga0070659_101777541 | Ga0070659_1017775411 | 126 |
| 90 | 3300005367 | Ga0070667_100069495 | Ga0070667_1000694954 | 126 |
| 91 | 3300005367 | Ga0070667_100390295 | Ga0070667_1003902952 | 126 |
| 92 | 3300005367 | Ga0070667_100441412 | Ga0070667_1004414122 | 126 |
| 93 | 3300005367 | Ga0070667_100506938 | Ga0070667_1005069382 | 126 |
| 94 | 3300005367 | Ga0070667_100749822 | Ga0070667_1007498221 | 126 |
| 95 | 3300005367 | Ga0070667_100871989 | Ga0070667_1008719891 | 126 |
| 96 | 3300005367 | Ga0070667_100915066 | Ga0070667_1009150661 | 126 |
| 97 | 3300005434 | Ga0070709_10064558 | Ga0070709_100645583 | 126 |
| 98 | 3300005435 | Ga0070714_100216744 | Ga0070714_1002167443 | 126 |
| 99 | 3300005435 | Ga0070714_100376063 | Ga0070714_1003760632 | 126 |
| 100 | 3300005435 | Ga0070714_101374703 | Ga0070714_1013747031 | 126 |
| 101 | 3300005435 | Ga0070714_102173269 | Ga0070714_1021732691 | 126 |
| 102 | 3300005437 | Ga0070710_10963268 | Ga0070710_109632681 | 126 |
| 103 | 3300005444 | Ga0070694_100007767 | Ga0070694_1000077672 | 126 |
| 104 | 3300005444 | Ga0070694_100379040 | Ga0070694_1003790402 | 126 |
| 105 | 3300005455 | Ga0070663_100023560 | Ga0070663_1000235605 | 126 |
| 106 | 3300005455 | Ga0070663_100133454 | Ga0070663_1001334542 | 126 |
| 107 | 3300005455 | Ga0070663_100133868 | Ga0070663_1001338681 | 126 |
| 108 | 3300005455 | Ga0070663_100310306 | Ga0070663_1003103063 | 126 |
| 109 | 3300005456 | Ga0070678_101453503 | Ga0070678_1014535032 | 126 |
| 110 | 3300005457 | Ga0070662_100007041 | Ga0070662_1000070415 | 126 |
| 111 | 3300005457 | Ga0070662_100007360 | Ga0070662_1000073605 | 126 |
| 112 | 3300005457 | Ga0070662_100013320 | Ga0070662_1000133202 | 126 |
| 113 | 3300005457 | Ga0070662_100067175 | Ga0070662_1000671753 | 126 |
| 114 | 3300005457 | Ga0070662_100350985 | Ga0070662_1003509851 | 126 |
| 115 | 3300005457 | Ga0070662_100454299 | Ga0070662_1004542992 | 126 |
| 116 | 3300005458 | Ga0070681_10275484 | Ga0070681_102754843 | 126 |
| 117 | 3300005458 | Ga0070681_10741242 | Ga0070681_107412422 | 126 |
| 118 | 3300005459 | Ga0068867_100018109 | Ga0068867_1000181095 | 126 |
| 119 | 3300005530 | Ga0070679_100191378 | Ga0070679_1001913782 | 126 |
| 120 | 3300005530 | Ga0070679_100385755 | Ga0070679_1003857553 | 126 |
| 121 | 3300005530 | Ga0070679_101361582 | Ga0070679_1013615821 | 126 |
| 122 | 3300005535 | Ga0070684_100004262 | Ga0070684_1000042622 | 126 |
| 123 | 3300005535 | Ga0070684_100183051 | Ga0070684_1001830512 | 126 |
| 124 | 3300005539 | Ga0068853_100017520 | Ga0068853_1000175202 | 126 |
| 125 | 3300005539 | Ga0068853_100141186 | Ga0068853_1001411863 | 126 |
| 126 | 3300005539 | Ga0068853_100167459 | Ga0068853_1001674593 | 126 |
| 127 | 3300005539 | Ga0068853_100495049 | Ga0068853_1004950492 | 126 |
| 128 | 3300005539 | Ga0068853_101318728 | Ga0068853_1013187282 | 126 |
| 129 | 3300005543 | Ga0070672_100001785 | Ga0070672_1000017857 | 126 |
| 130 | 3300005543 | Ga0070672_100064740 | Ga0070672_1000647403 | 126 |
| 131 | 3300005543 | Ga0070672_100067286 | Ga0070672_1000672862 | 126 |
| 132 | 3300005543 | Ga0070672_100152268 | Ga0070672_1001522682 | 126 |
| 133 | 3300005543 | Ga0070672_100247192 | Ga0070672_1002471922 | 126 |
| 134 | 3300005544 | Ga0070686_100247301 | Ga0070686_1002473011 | 126 |
| 135 | 3300005544 | Ga0070686_101787748 | Ga0070686_1017877481 | 126 |
| 136 | 3300005545 | Ga0070695_100768511 | Ga0070695_1007685112 | 126 |
| 137 | 3300005546 | Ga0070696_100705125 | Ga0070696_1007051251 | 126 |
| 138 | 3300005547 | Ga0070693_100109587 | Ga0070693_1001095872 | 126 |
| 139 | 3300005548 | Ga0070665_100002713 | Ga0070665_10000271325 | 126 |
| 140 | 3300005548 | Ga0070665_100493093 | Ga0070665_1004930932 | 126 |
| 141 | 3300005549 | Ga0070704_100291665 | Ga0070704_1002916652 | 126 |
| 142 | 3300005563 | Ga0068855_100000075 | Ga0068855_10000007564 | 126 |
| 143 | 3300005563 | Ga0068855_100003629 | Ga0068855_10000362915 | 126 |
| 144 | 3300005563 | Ga0068855_100013206 | Ga0068855_10001320612 | 126 |
| 145 | 3300005563 | Ga0068855_100072813 | Ga0068855_1000728133 | 126 |
| 146 | 3300005563 | Ga0068855_100207311 | Ga0068855_1002073113 | 126 |
| 147 | 3300005563 | Ga0068855_100277132 | Ga0068855_1002771322 | 126 |
| 148 | 3300005563 | Ga0068855_100841879 | Ga0068855_1008418793 | 126 |
| 149 | 3300005563 | Ga0068855_101063767 | Ga0068855_1010637672 | 126 |
| 150 | 3300005563 | Ga0068855_101186168 | Ga0068855_1011861681 | 126 |
| 151 | 3300005563 | Ga0068855_101480022 | Ga0068855_1014800221 | 126 |
| 152 | 3300005563 | Ga0068855_101857061 | Ga0068855_1018570612 | 126 |
| 153 | 3300005563 | Ga0068855_102167203 | Ga0068855_1021672031 | 126 |
| 154 | 3300005564 | Ga0070664_100005887 | Ga0070664_10000588710 | 126 |
| 155 | 3300005564 | Ga0070664_100008847 | Ga0070664_1000088479 | 126 |
| 156 | 3300005564 | Ga0070664_100014109 | Ga0070664_1000141094 | 126 |
| 157 | 3300005564 | Ga0070664_100025221 | Ga0070664_1000252215 | 126 |
| 158 | 3300005564 | Ga0070664_100369761 | Ga0070664_1003697612 | 126 |
| 159 | 3300005564 | Ga0070664_100385040 | Ga0070664_1003850402 | 126 |
| 160 | 3300005577 | Ga0068857_100013770 | Ga0068857_1000137704 | 126 |
| 161 | 3300005577 | Ga0068857_100019440 | Ga0068857_1000194405 | 126 |
| 162 | 3300005577 | Ga0068857_100052857 | Ga0068857_1000528572 | 126 |
| 163 | 3300005577 | Ga0068857_100108558 | Ga0068857_1001085584 | 126 |
| 164 | 3300005577 | Ga0068857_100500219 | Ga0068857_1005002192 | 126 |
| 165 | 3300005577 | Ga0068857_100626936 | Ga0068857_1006269362 | 126 |
| 166 | 3300005578 | Ga0068854_100078415 | Ga0068854_1000784153 | 126 |
| 167 | 3300005578 | Ga0068854_100147680 | Ga0068854_1001476801 | 126 |
| 168 | 3300005578 | Ga0068854_100194632 | Ga0068854_1001946322 | 126 |
| 169 | 3300005578 | Ga0068854_100313443 | Ga0068854_1003134432 | 126 |
| 170 | 3300005578 | Ga0068854_100322568 | Ga0068854_1003225682 | 126 |
| 171 | 3300005578 | Ga0068854_100440084 | Ga0068854_1004400842 | 126 |
| 172 | 3300005578 | Ga0068854_101113783 | Ga0068854_1011137831 | 126 |
| 173 | 3300005614 | Ga0068856_100032566 | Ga0068856_1000325664 | 126 |
| 174 | 3300005614 | Ga0068856_100062204 | Ga0068856_1000622043 | 126 |
| 175 | 3300005614 | Ga0068856_100350280 | Ga0068856_1003502802 | 126 |
| 176 | 3300005614 | Ga0068856_101868135 | Ga0068856_1018681351 | 126 |
| 177 | 3300005614 | Ga0068856_101939991 | Ga0068856_1019399911 | 126 |
| 178 | 3300005614 | Ga0068856_102447368 | Ga0068856_1024473681 | 126 |
| 179 | 3300005616 | Ga0068852_100003664 | Ga0068852_10000366412 | 126 |
| 180 | 3300005616 | Ga0068852_100018832 | Ga0068852_1000188323 | 126 |
| 181 | 3300005616 | Ga0068852_100126196 | Ga0068852_1001261963 | 126 |
| 182 | 3300005616 | Ga0068852_100590133 | Ga0068852_1005901332 | 126 |
| 183 | 3300005616 | Ga0068852_100610757 | Ga0068852_1006107572 | 126 |
| 184 | 3300005616 | Ga0068852_100764901 | Ga0068852_1007649012 | 126 |
| 185 | 3300005616 | Ga0068852_100821153 | Ga0068852_1008211532 | 126 |
| 186 | 3300005616 | Ga0068852_101284553 | Ga0068852_1012845532 | 126 |
| 187 | 3300005616 | Ga0068852_101738783 | Ga0068852_1017387832 | 126 |
| 188 | 3300005616 | Ga0068852_102247188 | Ga0068852_1022471881 | 126 |
| 189 | 3300005617 | Ga0068859_100312936 | Ga0068859_1003129363 | 126 |
| 190 | 3300005617 | Ga0068859_100502409 | Ga0068859_1005024093 | 126 |
| 191 | 3300005617 | Ga0068859_102136374 | Ga0068859_1021363742 | 126 |
| 192 | 3300005618 | Ga0068864_101366082 | Ga0068864_1013660822 | 126 |
| 193 | 3300005718 | Ga0068866_10254797 | Ga0068866_102547972 | 126 |
| 194 | 3300005719 | Ga0068861_100100331 | Ga0068861_1001003313 | 126 |
| 195 | 3300005834 | Ga0068851_10165375 | Ga0068851_101653752 | 126 |
| 196 | 3300005834 | Ga0068851_10871071 | Ga0068851_108710711 | 126 |
| 197 | 3300005840 | Ga0068870_10306884 | Ga0068870_103068842 | 126 |
| 198 | 3300005840 | Ga0068870_11066879 | Ga0068870_110668792 | 126 |
| 199 | 3300005841 | Ga0068863_100147126 | Ga0068863_1001471263 | 126 |
| 200 | 3300005842 | Ga0068858_100018374 | Ga0068858_1000183743 | 126 |
| 201 | 3300005843 | Ga0068860_100013708 | Ga0068860_1000137082 | 126 |
| 202 | 3300005843 | Ga0068860_100020068 | Ga0068860_1000200683 | 126 |
| 203 | 3300005843 | Ga0068860_100107926 | Ga0068860_1001079263 | 126 |
| 204 | 3300005844 | Ga0068862_100001114 | Ga0068862_10000111413 | 126 |
| 205 | 3300005844 | Ga0068862_100346889 | Ga0068862_1003468892 | 126 |
| 206 | 3300005844 | Ga0068862_100406636 | Ga0068862_1004066362 | 126 |
| 207 | 3300005844 | Ga0068862_100424819 | Ga0068862_1004248192 | 126 |
| 208 | 3300005844 | Ga0068862_100425160 | Ga0068862_1004251602 | 126 |
| 209 | 3300006175 | Ga0070712_100226785 | Ga0070712_1002267852 | 126 |
| 210 | 3300006237 | Ga0097621_100082423 | Ga0097621_1000824233 | 126 |
| 211 | 3300006237 | Ga0097621_100199751 | Ga0097621_1001997512 | 126 |
| 212 | 3300006358 | Ga0068871_100039025 | Ga0068871_1000390252 | 126 |
| 213 | 3300006844 | Ga0075428_100100496 | Ga0075428_1001004962 | 126 |
| 214 | 3300006844 | Ga0075428_100926010 | Ga0075428_1009260101 | 126 |
| 215 | 3300006844 | Ga0075428_102128889 | Ga0075428_1021288891 | 126 |
| 216 | 3300006846 | Ga0075430_100044619 | Ga0075430_1000446195 | 126 |
| 217 | 3300006852 | Ga0075433_10003509 | Ga0075433_100035099 | 126 |
| 218 | 3300006880 | Ga0075429_101087604 | Ga0075429_1010876042 | 126 |
| 219 | 3300006880 | Ga0075429_101260124 | Ga0075429_1012601242 | 126 |
| 220 | 3300006881 | Ga0068865_100198134 | Ga0068865_1001981342 | 126 |
| 221 | 3300006881 | Ga0068865_100794570 | Ga0068865_1007945702 | 126 |
| 222 | 3300006881 | Ga0068865_100844297 | Ga0068865_1008442972 | 126 |
| 223 | 3300006881 | Ga0068865_101055227 | Ga0068865_1010552272 | 126 |
| 224 | 3300006931 | Ga0097620_100312951 | Ga0097620_1003129512 | 126 |
| 225 | 3300006931 | Ga0097620_100502390 | Ga0097620_1005023903 | 126 |
| 226 | 3300006931 | Ga0097620_102136113 | Ga0097620_1021361132 | 126 |
| 227 | 3300009092 | Ga0105250_10382911 | Ga0105250_103829111 | 126 |
| 228 | 3300009093 | Ga0105240_10000091 | Ga0105240_10000091168 | 126 |
| 229 | 3300009093 | Ga0105240_10063524 | Ga0105240_100635242 | 126 |
| 230 | 3300009093 | Ga0105240_10379092 | Ga0105240_103790923 | 126 |
| 231 | 3300009093 | Ga0105240_10401634 | Ga0105240_104016342 | 126 |
| 232 | 3300009098 | Ga0105245_10442388 | Ga0105245_104423882 | 126 |
| 233 | 3300009098 | Ga0105245_10648439 | Ga0105245_106484391 | 126 |
| 234 | 3300009101 | Ga0105247_10556048 | Ga0105247_105560481 | 126 |
| 235 | 3300009147 | Ga0114129_10028253 | Ga0114129_100282538 | 126 |
| 236 | 3300009147 | Ga0114129_10414454 | Ga0114129_104144543 | 126 |
| 237 | 3300009148 | Ga0105243_10317129 | Ga0105243_103171293 | 126 |
| 238 | 3300009174 | Ga0105241_10105023 | Ga0105241_101050233 | 126 |
| 239 | 3300009174 | Ga0105241_10157481 | Ga0105241_101574812 | 126 |
| 240 | 3300009174 | Ga0105241_10502351 | Ga0105241_105023512 | 126 |
| 241 | 3300009176 | Ga0105242_10096286 | Ga0105242_100962863 | 126 |
| 242 | 3300009177 | Ga0105248_10014420 | Ga0105248_100144208 | 126 |
| 243 | 3300009177 | Ga0105248_10074910 | Ga0105248_100749104 | 126 |
| 244 | 3300009177 | Ga0105248_10213759 | Ga0105248_102137592 | 126 |
| 245 | 3300009177 | Ga0105248_10264452 | Ga0105248_102644523 | 126 |
| 246 | 3300009177 | Ga0105248_10748728 | Ga0105248_107487282 | 126 |
| 247 | 3300009545 | Ga0105237_10117280 | Ga0105237_101172802 | 126 |
| 248 | 3300009545 | Ga0105237_10528314 | Ga0105237_105283142 | 126 |
| 249 | 3300009545 | Ga0105237_10586016 | Ga0105237_105860161 | 126 |
| 250 | 3300009545 | Ga0105237_12549982 | Ga0105237_125499821 | 126 |
| 251 | 3300009551 | Ga0105238_10007597 | Ga0105238_100075976 | 126 |
| 252 | 3300009551 | Ga0105238_10014453 | Ga0105238_100144532 | 126 |
| 253 | 3300009551 | Ga0105238_10078669 | Ga0105238_100786693 | 126 |
| 254 | 3300009551 | Ga0105238_12002746 | Ga0105238_120027462 | 126 |
| 255 | 3300009553 | Ga0105249_10118535 | Ga0105249_101185353 | 126 |
| 256 | 3300009553 | Ga0105249_10248885 | Ga0105249_102488852 | 126 |
| 257 | 3300009553 | Ga0105249_10848854 | Ga0105249_108488542 | 126 |
| 258 | 3300010375 | Ga0105239_10000376 | Ga0105239_1000037651 | 126 |
| 259 | 3300010375 | Ga0105239_10008832 | Ga0105239_100088325 | 126 |
| 260 | 3300010375 | Ga0105239_10415258 | Ga0105239_104152583 | 126 |
| 261 | 3300010375 | Ga0105239_10836534 | Ga0105239_108365342 | 126 |
| 262 | 3300013100 | Ga0157373_10008634 | Ga0157373_100086348 | 126 |
| 263 | 3300013100 | Ga0157373_10057439 | Ga0157373_100574393 | 126 |
| 264 | 3300013100 | Ga0157373_10071404 | Ga0157373_100714042 | 126 |
| 265 | 3300013100 | Ga0157373_10557127 | Ga0157373_105571272 | 126 |
| 266 | 3300013100 | Ga0157373_10873377 | Ga0157373_108733771 | 126 |
| 267 | 3300013100 | Ga0157373_10898740 | Ga0157373_108987402 | 126 |
| 268 | 3300013102 | Ga0157371_10018979 | Ga0157371_100189796 | 126 |
| 269 | 3300013102 | Ga0157371_10029534 | Ga0157371_100295342 | 126 |
| 270 | 3300013102 | Ga0157371_10044815 | Ga0157371_100448152 | 126 |
| 271 | 3300013102 | Ga0157371_10226217 | Ga0157371_102262172 | 126 |
| 272 | 3300013102 | Ga0157371_11282031 | Ga0157371_112820312 | 126 |
| 273 | 3300013104 | Ga0157370_10029403 | Ga0157370_100294037 | 126 |
| 274 | 3300013104 | Ga0157370_10033009 | Ga0157370_100330092 | 126 |
| 275 | 3300013104 | Ga0157370_10042598 | Ga0157370_100425982 | 126 |
| 276 | 3300013104 | Ga0157370_10336179 | Ga0157370_103361792 | 126 |
| 277 | 3300013104 | Ga0157370_11518941 | Ga0157370_115189411 | 126 |
| 278 | 3300013105 | Ga0157369_10010785 | Ga0157369_100107855 | 126 |
| 279 | 3300013105 | Ga0157369_10012071 | Ga0157369_100120712 | 126 |
| 280 | 3300013105 | Ga0157369_10059903 | Ga0157369_100599033 | 126 |
| 281 | 3300013105 | Ga0157369_10137856 | Ga0157369_101378564 | 126 |
| 282 | 3300013105 | Ga0157369_10173295 | Ga0157369_101732953 | 126 |
| 283 | 3300013105 | Ga0157369_10964278 | Ga0157369_109642782 | 126 |
| 284 | 3300013105 | Ga0157369_11013663 | Ga0157369_110136632 | 126 |
| 285 | 3300013296 | Ga0157374_10020068 | Ga0157374_100200688 | 126 |
| 286 | 3300013296 | Ga0157374_11151254 | Ga0157374_111512542 | 126 |
| 287 | 3300013297 | Ga0157378_10070470 | Ga0157378_100704706 | 126 |
| 288 | 3300013297 | Ga0157378_10516400 | Ga0157378_105164002 | 126 |
| 289 | 3300013297 | Ga0157378_12580559 | Ga0157378_125805591 | 126 |
| 290 | 3300013306 | Ga0163162_10115369 | Ga0163162_101153693 | 126 |
| 291 | 3300013306 | Ga0163162_10858705 | Ga0163162_108587052 | 126 |
| 292 | 3300013307 | Ga0157372_10001493 | Ga0157372_100014932 | 126 |
| 293 | 3300013307 | Ga0157372_10106338 | Ga0157372_101063382 | 126 |
| 294 | 3300013307 | Ga0157372_10212687 | Ga0157372_102126873 | 126 |
| 295 | 3300013307 | Ga0157372_11695258 | Ga0157372_116952581 | 126 |
| 296 | 3300013308 | Ga0157375_10033918 | Ga0157375_100339182 | 126 |
| 297 | 3300013308 | Ga0157375_10125711 | Ga0157375_101257113 | 126 |
| 298 | 3300013308 | Ga0157375_10229296 | Ga0157375_102292962 | 126 |
| 299 | 3300014325 | Ga0163163_10000714 | Ga0163163_1000071427 | 126 |
| 300 | 3300014325 | Ga0163163_10273607 | Ga0163163_102736072 | 126 |
| 301 | 3300014325 | Ga0163163_11195182 | Ga0163163_111951822 | 126 |
| 302 | 3300014497 | Ga0182008_10122667 | Ga0182008_101226672 | 126 |
| 303 | 3300014745 | Ga0157377_11082306 | Ga0157377_110823062 | 126 |
| 304 | 3300014968 | Ga0157379_10511762 | Ga0157379_105117622 | 126 |
| 305 | 3300017792 | Ga0163161_10080229 | Ga0163161_100802293 | 126 |
| 306 | 3300017792 | Ga0163161_10275018 | Ga0163161_102750183 | 126 |
| 307 | 3300020082 | Ga0206353_12059669 | Ga0206353_120596692 | 126 |
| 308 | 3300025315 | Ga0207697_10070463 | Ga0207697_100704632 | 126 |
| 309 | 3300025321 | Ga0207656_10088861 | Ga0207656_100888612 | 126 |
| 310 | 3300025321 | Ga0207656_10174304 | Ga0207656_101743042 | 126 |
| 311 | 3300025899 | Ga0207642_10145801 | Ga0207642_101458012 | 126 |
| 312 | 3300025901 | Ga0207688_10011568 | Ga0207688_100115682 | 126 |
| 313 | 3300025901 | Ga0207688_10146906 | Ga0207688_101469062 | 126 |
| 314 | 3300025903 | Ga0207680_10015740 | Ga0207680_100157406 | 126 |
| 315 | 3300025903 | Ga0207680_10027901 | Ga0207680_100279011 | 126 |
| 316 | 3300025903 | Ga0207680_10042520 | Ga0207680_100425204 | 126 |
| 317 | 3300025904 | Ga0207647_10000304 | Ga0207647_1000030421 | 126 |
| 318 | 3300025904 | Ga0207647_10001979 | Ga0207647_100019793 | 126 |
| 319 | 3300025904 | Ga0207647_10017375 | Ga0207647_100173752 | 126 |
| 320 | 3300025904 | Ga0207647_10088294 | Ga0207647_100882942 | 126 |
| 321 | 3300025906 | Ga0207699_10261558 | Ga0207699_102615582 | 126 |
| 322 | 3300025906 | Ga0207699_10965440 | Ga0207699_109654401 | 126 |
| 323 | 3300025907 | Ga0207645_10002830 | Ga0207645_100028303 | 126 |
| 324 | 3300025907 | Ga0207645_10306502 | Ga0207645_103065022 | 126 |
| 325 | 3300025908 | Ga0207643_10075082 | Ga0207643_100750822 | 126 |
| 326 | 3300025909 | Ga0207705_10000135 | Ga0207705_1000013573 | 126 |
| 327 | 3300025909 | Ga0207705_10006741 | Ga0207705_1000674111 | 126 |
| 328 | 3300025909 | Ga0207705_10042065 | Ga0207705_100420654 | 126 |
| 329 | 3300025909 | Ga0207705_10078959 | Ga0207705_100789593 | 126 |
| 330 | 3300025909 | Ga0207705_10181348 | Ga0207705_101813482 | 126 |
| 331 | 3300025909 | Ga0207705_10523936 | Ga0207705_105239362 | 126 |
| 332 | 3300025909 | Ga0207705_10748777 | Ga0207705_107487772 | 126 |
| 333 | 3300025909 | Ga0207705_10877659 | Ga0207705_108776592 | 126 |
| 334 | 3300025909 | Ga0207705_11033323 | Ga0207705_110333231 | 126 |
| 335 | 3300025911 | Ga0207654_10015255 | Ga0207654_100152553 | 126 |
| 336 | 3300025912 | Ga0207707_10914750 | Ga0207707_109147502 | 126 |
| 337 | 3300025913 | Ga0207695_10000018 | Ga0207695_10000018270 | 126 |
| 338 | 3300025913 | Ga0207695_10000182 | Ga0207695_10000182164 | 126 |
| 339 | 3300025913 | Ga0207695_10011980 | Ga0207695_100119806 | 126 |
| 340 | 3300025913 | Ga0207695_10268379 | Ga0207695_102683793 | 126 |
| 341 | 3300025914 | Ga0207671_10005975 | Ga0207671_1000597516 | 126 |
| 342 | 3300025914 | Ga0207671_10239481 | Ga0207671_102394812 | 126 |
| 343 | 3300025917 | Ga0207660_10023742 | Ga0207660_100237425 | 126 |
| 344 | 3300025919 | Ga0207657_10000218 | Ga0207657_1000021815 | 126 |
| 345 | 3300025919 | Ga0207657_10004622 | Ga0207657_100046223 | 126 |
| 346 | 3300025919 | Ga0207657_10015148 | Ga0207657_100151487 | 126 |
| 347 | 3300025919 | Ga0207657_10015997 | Ga0207657_100159979 | 126 |
| 348 | 3300025919 | Ga0207657_10095191 | Ga0207657_100951913 | 126 |
| 349 | 3300025919 | Ga0207657_10227527 | Ga0207657_102275273 | 126 |
| 350 | 3300025919 | Ga0207657_10499053 | Ga0207657_104990531 | 126 |
| 351 | 3300025919 | Ga0207657_10744505 | Ga0207657_107445051 | 126 |
| 352 | 3300025920 | Ga0207649_10001300 | Ga0207649_1000130013 | 126 |
| 353 | 3300025920 | Ga0207649_10063433 | Ga0207649_100634332 | 126 |
| 354 | 3300025920 | Ga0207649_10067134 | Ga0207649_100671344 | 126 |
| 355 | 3300025920 | Ga0207649_10165348 | Ga0207649_101653484 | 126 |
| 356 | 3300025920 | Ga0207649_10288029 | Ga0207649_102880292 | 126 |
| 357 | 3300025920 | Ga0207649_10844935 | Ga0207649_108449352 | 126 |
| 358 | 3300025920 | Ga0207649_11108614 | Ga0207649_111086142 | 126 |
| 359 | 3300025921 | Ga0207652_10187838 | Ga0207652_101878382 | 126 |
| 360 | 3300025921 | Ga0207652_11102425 | Ga0207652_111024252 | 126 |
| 361 | 3300025923 | Ga0207681_10002262 | Ga0207681_100022622 | 126 |
| 362 | 3300025923 | Ga0207681_10032831 | Ga0207681_100328313 | 126 |
| 363 | 3300025923 | Ga0207681_10155675 | Ga0207681_101556753 | 126 |
| 364 | 3300025923 | Ga0207681_10271946 | Ga0207681_102719462 | 126 |
| 365 | 3300025924 | Ga0207694_10000018 | Ga0207694_10000018269 | 126 |
| 366 | 3300025924 | Ga0207694_10006600 | Ga0207694_100066007 | 126 |
| 367 | 3300025924 | Ga0207694_10034661 | Ga0207694_100346613 | 126 |
| 368 | 3300025924 | Ga0207694_10260832 | Ga0207694_102608321 | 126 |
| 369 | 3300025925 | Ga0207650_10002617 | Ga0207650_1000261710 | 126 |
| 370 | 3300025925 | Ga0207650_10197756 | Ga0207650_101977562 | 126 |
| 371 | 3300025926 | Ga0207659_10008178 | Ga0207659_100081786 | 126 |
| 372 | 3300025926 | Ga0207659_10457188 | Ga0207659_104571882 | 126 |
| 373 | 3300025929 | Ga0207664_10477144 | Ga0207664_104771441 | 126 |
| 374 | 3300025929 | Ga0207664_10602573 | Ga0207664_106025731 | 126 |
| 375 | 3300025931 | Ga0207644_10006138 | Ga0207644_100061387 | 126 |
| 376 | 3300025931 | Ga0207644_10025184 | Ga0207644_100251843 | 126 |
| 377 | 3300025931 | Ga0207644_10399847 | Ga0207644_103998472 | 126 |
| 378 | 3300025931 | Ga0207644_10803307 | Ga0207644_108033072 | 126 |
| 379 | 3300025932 | Ga0207690_10002193 | Ga0207690_100021932 | 126 |
| 380 | 3300025932 | Ga0207690_10009646 | Ga0207690_100096466 | 126 |
| 381 | 3300025932 | Ga0207690_10046075 | Ga0207690_100460755 | 126 |
| 382 | 3300025932 | Ga0207690_10277460 | Ga0207690_102774602 | 126 |
| 383 | 3300025932 | Ga0207690_10829861 | Ga0207690_108298612 | 126 |
| 384 | 3300025932 | Ga0207690_11220959 | Ga0207690_112209591 | 126 |
| 385 | 3300025932 | Ga0207690_11678324 | Ga0207690_116783242 | 126 |
| 386 | 3300025933 | Ga0207706_10007550 | Ga0207706_100075502 | 126 |
| 387 | 3300025933 | Ga0207706_10009959 | Ga0207706_100099596 | 126 |
| 388 | 3300025933 | Ga0207706_10136165 | Ga0207706_101361653 | 126 |
| 389 | 3300025933 | Ga0207706_10223260 | Ga0207706_102232602 | 126 |
| 390 | 3300025933 | Ga0207706_10251426 | Ga0207706_102514262 | 126 |
| 391 | 3300025933 | Ga0207706_10682304 | Ga0207706_106823042 | 126 |
| 392 | 3300025933 | Ga0207706_10847014 | Ga0207706_108470141 | 126 |
| 393 | 3300025934 | Ga0207686_10644790 | Ga0207686_106447901 | 126 |
| 394 | 3300025935 | Ga0207709_10455537 | Ga0207709_104555372 | 126 |
| 395 | 3300025937 | Ga0207669_10237469 | Ga0207669_102374692 | 126 |
| 396 | 3300025937 | Ga0207669_10319264 | Ga0207669_103192642 | 126 |
| 397 | 3300025938 | Ga0207704_10136713 | Ga0207704_101367132 | 126 |
| 398 | 3300025938 | Ga0207704_11002057 | Ga0207704_110020572 | 126 |
| 399 | 3300025940 | Ga0207691_10003132 | Ga0207691_1000313210 | 126 |
| 400 | 3300025940 | Ga0207691_10023380 | Ga0207691_100233803 | 126 |
| 401 | 3300025940 | Ga0207691_10059576 | Ga0207691_100595763 | 126 |
| 402 | 3300025940 | Ga0207691_10060280 | Ga0207691_100602802 | 126 |
| 403 | 3300025940 | Ga0207691_10064573 | Ga0207691_100645733 | 126 |
| 404 | 3300025941 | Ga0207711_10056934 | Ga0207711_100569342 | 126 |
| 405 | 3300025941 | Ga0207711_10444335 | Ga0207711_104443352 | 126 |
| 406 | 3300025941 | Ga0207711_11596356 | Ga0207711_115963561 | 126 |
| 407 | 3300025941 | Ga0207711_12059541 | Ga0207711_120595411 | 126 |
| 408 | 3300025942 | Ga0207689_10024146 | Ga0207689_100241465 | 126 |
| 409 | 3300025942 | Ga0207689_10131983 | Ga0207689_101319833 | 126 |
| 410 | 3300025944 | Ga0207661_10019687 | Ga0207661_100196875 | 126 |
| 411 | 3300025944 | Ga0207661_10036199 | Ga0207661_100361992 | 126 |
| 412 | 3300025944 | Ga0207661_10074018 | Ga0207661_100740184 | 126 |
| 413 | 3300025944 | Ga0207661_11210291 | Ga0207661_112102911 | 126 |
| 414 | 3300025945 | Ga0207679_10003933 | Ga0207679_100039332 | 126 |
| 415 | 3300025945 | Ga0207679_10045226 | Ga0207679_100452263 | 126 |
| 416 | 3300025945 | Ga0207679_10072460 | Ga0207679_100724603 | 126 |
| 417 | 3300025945 | Ga0207679_10138512 | Ga0207679_101385122 | 126 |
| 418 | 3300025945 | Ga0207679_10220984 | Ga0207679_102209842 | 126 |
| 419 | 3300025949 | Ga0207667_10000052 | Ga0207667_1000005284 | 126 |
| 420 | 3300025949 | Ga0207667_10000122 | Ga0207667_1000012294 | 126 |
| 421 | 3300025949 | Ga0207667_10002731 | Ga0207667_100027315 | 126 |
| 422 | 3300025949 | Ga0207667_10024256 | Ga0207667_100242567 | 126 |
| 423 | 3300025949 | Ga0207667_10114384 | Ga0207667_101143842 | 126 |
| 424 | 3300025949 | Ga0207667_10145736 | Ga0207667_101457363 | 126 |
| 425 | 3300025949 | Ga0207667_11486505 | Ga0207667_114865052 | 126 |
| 426 | 3300025960 | Ga0207651_10036061 | Ga0207651_100360612 | 126 |
| 427 | 3300025960 | Ga0207651_10600119 | Ga0207651_106001191 | 126 |
| 428 | 3300025960 | Ga0207651_10799366 | Ga0207651_107993662 | 126 |
| 429 | 3300025960 | Ga0207651_11243576 | Ga0207651_112435761 | 126 |
| 430 | 3300025960 | Ga0207651_11288307 | Ga0207651_112883072 | 126 |
| 431 | 3300025961 | Ga0207712_10046019 | Ga0207712_100460192 | 126 |
| 432 | 3300025961 | Ga0207712_10085485 | Ga0207712_100854853 | 126 |
| 433 | 3300025961 | Ga0207712_10589072 | Ga0207712_105890721 | 126 |
| 434 | 3300025972 | Ga0207668_10000176 | Ga0207668_1000017627 | 126 |
| 435 | 3300025972 | Ga0207668_10316515 | Ga0207668_103165152 | 126 |
| 436 | 3300025972 | Ga0207668_10646649 | Ga0207668_106466492 | 126 |
| 437 | 3300025972 | Ga0207668_11646693 | Ga0207668_116466932 | 126 |
| 438 | 3300025981 | Ga0207640_10003064 | Ga0207640_1000306410 | 126 |
| 439 | 3300025981 | Ga0207640_10088899 | Ga0207640_100888992 | 126 |
| 440 | 3300025981 | Ga0207640_10099471 | Ga0207640_100994713 | 126 |
| 441 | 3300025981 | Ga0207640_10397049 | Ga0207640_103970492 | 126 |
| 442 | 3300025981 | Ga0207640_10788061 | Ga0207640_107880611 | 126 |
| 443 | 3300025986 | Ga0207658_10050488 | Ga0207658_100504884 | 126 |
| 444 | 3300025986 | Ga0207658_10110539 | Ga0207658_101105392 | 126 |
| 445 | 3300025986 | Ga0207658_10125147 | Ga0207658_101251473 | 126 |
| 446 | 3300025986 | Ga0207658_10182202 | Ga0207658_101822022 | 126 |
| 447 | 3300026023 | Ga0207677_10188122 | Ga0207677_101881222 | 126 |
| 448 | 3300026023 | Ga0207677_10755238 | Ga0207677_107552382 | 126 |
| 449 | 3300026035 | Ga0207703_10015939 | Ga0207703_100159395 | 126 |
| 450 | 3300026035 | Ga0207703_11029149 | Ga0207703_110291492 | 126 |
| 451 | 3300026041 | Ga0207639_10001293 | Ga0207639_1000129314 | 126 |
| 452 | 3300026041 | Ga0207639_10025287 | Ga0207639_100252875 | 126 |
| 453 | 3300026041 | Ga0207639_10123686 | Ga0207639_101236863 | 126 |
| 454 | 3300026041 | Ga0207639_11291569 | Ga0207639_112915692 | 126 |
| 455 | 3300026067 | Ga0207678_10006571 | Ga0207678_100065712 | 126 |
| 456 | 3300026067 | Ga0207678_10237657 | Ga0207678_102376573 | 126 |
| 457 | 3300026067 | Ga0207678_10614225 | Ga0207678_106142251 | 126 |
| 458 | 3300026078 | Ga0207702_10008605 | Ga0207702_100086055 | 126 |
| 459 | 3300026078 | Ga0207702_10029498 | Ga0207702_100294984 | 126 |
| 460 | 3300026078 | Ga0207702_10148145 | Ga0207702_101481453 | 126 |
| 461 | 3300026078 | Ga0207702_11911831 | Ga0207702_119118311 | 126 |
| 462 | 3300026088 | Ga0207641_11078794 | Ga0207641_110787942 | 126 |
| 463 | 3300026089 | Ga0207648_10001235 | Ga0207648_100012352 | 126 |
| 464 | 3300026089 | Ga0207648_10552020 | Ga0207648_105520202 | 126 |
| 465 | 3300026089 | Ga0207648_12146299 | Ga0207648_121462991 | 126 |
| 466 | 3300026095 | Ga0207676_10161763 | Ga0207676_101617633 | 126 |
| 467 | 3300026116 | Ga0207674_10003594 | Ga0207674_1000359416 | 126 |
| 468 | 3300026116 | Ga0207674_10005519 | Ga0207674_1000551919 | 126 |
| 469 | 3300026116 | Ga0207674_10027930 | Ga0207674_100279309 | 126 |
| 470 | 3300026116 | Ga0207674_10048179 | Ga0207674_100481793 | 126 |
| 471 | 3300026118 | Ga0207675_100078855 | Ga0207675_1000788553 | 126 |
| 472 | 3300026118 | Ga0207675_100336443 | Ga0207675_1003364432 | 126 |
| 473 | 3300026118 | Ga0207675_100544554 | Ga0207675_1005445542 | 126 |
| 474 | 3300026121 | Ga0207683_10375386 | Ga0207683_103753862 | 126 |
| 475 | 3300026121 | Ga0207683_10777150 | Ga0207683_107771502 | 126 |
| 476 | 3300026142 | Ga0207698_10002558 | Ga0207698_100025587 | 126 |
| 477 | 3300026142 | Ga0207698_10043642 | Ga0207698_100436424 | 126 |
| 478 | 3300026142 | Ga0207698_10094813 | Ga0207698_100948133 | 126 |
| 479 | 3300026142 | Ga0207698_10493426 | Ga0207698_104934262 | 126 |
| 480 | 3300026142 | Ga0207698_10744209 | Ga0207698_107442092 | 126 |
| 481 | 3300026142 | Ga0207698_11939163 | Ga0207698_119391632 | 126 |
| 482 | 3300028379 | Ga0268266_10014168 | Ga0268266_100141685 | 126 |
| 483 | 3300028379 | Ga0268266_10068863 | Ga0268266_100688631 | 126 |
| 484 | 3300028379 | Ga0268266_11498434 | Ga0268266_114984341 | 126 |
| 485 | 3300028380 | Ga0268265_10000904 | Ga0268265_1000090415 | 126 |
| 486 | 3300028380 | Ga0268265_10048556 | Ga0268265_100485563 | 126 |
| 487 | 3300028380 | Ga0268265_10156085 | Ga0268265_101560853 | 126 |
| 488 | 3300028380 | Ga0268265_10569408 | Ga0268265_105694082 | 126 |
| 489 | 3300028381 | Ga0268264_10001156 | Ga0268264_1000115625 | 126 |
| 490 | 3300028381 | Ga0268264_10016372 | Ga0268264_100163723 | 126 |
| 491 | 3300031548 | Ga0307408_100415632 | Ga0307408_1004156322 | 126 |
| 492 | 3300031730 | Ga0307516_10111367 | Ga0307516_101113672 | 126 |
| 493 | 3300031824 | Ga0307413_10135808 | Ga0307413_101358082 | 126 |
| 494 | 3300031824 | Ga0307413_10265371 | Ga0307413_102653713 | 126 |
| 495 | 3300031824 | Ga0307413_10458826 | Ga0307413_104588263 | 126 |
| 496 | 3300031852 | Ga0307410_11374137 | Ga0307410_113741372 | 126 |
| 497 | 3300031901 | Ga0307406_11667361 | Ga0307406_116673611 | 126 |
| 498 | 3300031903 | Ga0307407_10422154 | Ga0307407_104221542 | 126 |
| 499 | 3300031911 | Ga0307412_10157718 | Ga0307412_101577182 | 126 |
| 500 | 3300031911 | Ga0307412_10651269 | Ga0307412_106512692 | 126 |
| 501 | 3300031995 | Ga0307409_100348334 | Ga0307409_1003483343 | 126 |
| 502 | 3300031995 | Ga0307409_101055461 | Ga0307409_1010554611 | 126 |
| 503 | 3300032002 | Ga0307416_100071968 | Ga0307416_1000719682 | 126 |
| 504 | 3300032002 | Ga0307416_100181694 | Ga0307416_1001816942 | 126 |
| 505 | 3300032002 | Ga0307416_103027041 | Ga0307416_1030270412 | 126 |
| 506 | 3300032005 | Ga0307411_10014233 | Ga0307411_100142332 | 126 |
| 507 | 3300032005 | Ga0307411_10262106 | Ga0307411_102621062 | 126 |
| 508 | 3300032126 | Ga0307415_100122261 | Ga0307415_1001222612 | 126 |
| 509 | 3300032126 | Ga0307415_101287285 | Ga0307415_1012872852 | 126 |
| 510 | 3300035120 | Ga0373957_0161724 | Ga0373957_0161724_179_562 | 126 |
| 511 | 3300035171 | Ga0373946_0441453 | Ga0373946_0441453_196_576 | 126 |
| 512 | 3300037312 | Ga0395899_0008386 | Ga0395899_0008386_6444_6824 | 126 |
| 513 | 3300037312 | Ga0395899_0111018 | Ga0395899_0111018_543_923 | 126 |
| 514 | 3300037312 | Ga0395899_0129549 | Ga0395899_0129549_95_475 | 126 |
| 515 | 3300037312 | Ga0395899_0151857 | Ga0395899_0151857_70_450 | 126 |
| 516 | 3300037312 | Ga0395899_0199188 | Ga0395899_0199188_155_535 | 126 |
| 517 | 3300037312 | Ga0395899_0309678 | Ga0395899_0309678_598_978 | 126 |
| 518 | 3300037312 | Ga0395899_0656003 | Ga0395899_0656003_61_444 | 126 |
| 519 | 3300037312 | Ga0395899_0705927 | Ga0395899_0705927_109_489 | 126 |
| 520 | 3300037418 | Ga0395900_0009073 | Ga0395900_0009073_326_706 | 126 |
| 521 | 3300037418 | Ga0395900_0083382 | Ga0395900_0083382_1978_2358 | 126 |
| 522 | 3300037418 | Ga0395900_0087987 | Ga0395900_0087987_1475_1855 | 126 |
| 523 | 3300037418 | Ga0395900_0122334 | Ga0395900_0122334_815_1195 | 126 |
| 524 | 3300037418 | Ga0395900_0142309 | Ga0395900_0142309_1593_1973 | 126 |
| 525 | 3300037418 | Ga0395900_0172489 | Ga0395900_0172489_20_400 | 126 |
| 526 | 3300037418 | Ga0395900_0179898 | Ga0395900_0179898_1150_1530 | 126 |
| 527 | 3300037418 | Ga0395900_0463639 | Ga0395900_0463639_534_914 | 126 |
| 528 | 3300037418 | Ga0395900_0544104 | Ga0395900_0544104_183_566 | 126 |
| 529 | 3300037418 | Ga0395900_0577600 | Ga0395900_0577600_309_689 | 126 |
| 530 | 3300037418 | Ga0395900_0816722 | Ga0395900_0816722_375_755 | 126 |
| 531 | 3300037466 | Ga0395898_0174900 | Ga0395898_0174900_1269_1649 | 126 |
| 532 | 3300037466 | Ga0395898_0224343 | Ga0395898_0224343_598_978 | 126 |
| 533 | 3300037466 | Ga0395898_0239235 | Ga0395898_0239235_1038_1418 | 126 |
| 534 | 3300037466 | Ga0395898_0292965 | Ga0395898_0292965_815_1195 | 126 |
| 535 | 3300037466 | Ga0395898_0486032 | Ga0395898_0486032_227_607 | 126 |
| 536 | 3300037466 | Ga0395898_0606387 | Ga0395898_0606387_165_548 | 126 |
| 537 | 3300037466 | Ga0395898_0758196 | Ga0395898_0758196_348_728 | 126 |
| 538 | 3300037466 | Ga0395898_0997191 | Ga0395898_0997191_377_757 | 126 |
| 539 | 3300037466 | Ga0395898_1272127 | Ga0395898_1272127_135_515 | 126 |
| 540 | 3300037471 | Ga0395905_0001242 | Ga0395905_0001242_10693_11076 | 126 |
| 541 | 3300037471 | Ga0395905_0030728 | Ga0395905_0030728_2643_3023 | 126 |
| 542 | 3300037471 | Ga0395905_0069544 | Ga0395905_0069544_1767_2147 | 126 |
| 543 | 3300037471 | Ga0395905_0104679 | Ga0395905_0104679_620_1000 | 126 |
| 544 | 3300037471 | Ga0395905_0139308 | Ga0395905_0139308_593_973 | 126 |
| 545 | 3300037471 | Ga0395905_0143489 | Ga0395905_0143489_99_479 | 126 |
| 546 | 3300037471 | Ga0395905_0156886 | Ga0395905_0156886_1268_1648 | 126 |
| 547 | 3300037471 | Ga0395905_0235192 | Ga0395905_0235192_298_678 | 126 |
| 548 | 3300037471 | Ga0395905_0352337 | Ga0395905_0352337_590_970 | 126 |
| 549 | 3300037471 | Ga0395905_0353532 | Ga0395905_0353532_620_1000 | 126 |
| 550 | 3300037471 | Ga0395905_0363950 | Ga0395905_0363950_930_1310 | 126 |
| 551 | 3300037471 | Ga0395905_0391449 | Ga0395905_0391449_368_757 | 126 |
| 552 | 3300037471 | Ga0395905_0587324 | Ga0395905_0587324_477_860 | 126 |
| 553 | 3300037471 | Ga0395905_0662350 | Ga0395905_0662350_51_431 | 126 |
| 554 | 3300037471 | Ga0395905_0774781 | Ga0395905_0774781_144_527 | 126 |
| 555 | 3300037471 | Ga0395905_0819293 | Ga0395905_0819293_400_780 | 126 |
| 556 | 3300037471 | Ga0395905_1865644 | Ga0395905_1865644_108_488 | 126 |
| 557 | 3300038443 | Ga0395901_0039984 | Ga0395901_0039984_2609_2989 | 126 |
| 558 | 3300038443 | Ga0395901_0070766 | Ga0395901_0070766_827_1207 | 126 |
| 559 | 3300038443 | Ga0395901_0087694 | Ga0395901_0087694_2704_3084 | 126 |
| 560 | 3300038443 | Ga0395901_0091910 | Ga0395901_0091910_620_1000 | 126 |
| 561 | 3300038443 | Ga0395901_0351820 | Ga0395901_0351820_40_420 | 126 |
| 562 | 3300038443 | Ga0395901_0438251 | Ga0395901_0438251_211_594 | 126 |
| 563 | 3300038443 | Ga0395901_0450315 | Ga0395901_0450315_412_792 | 126 |
| 564 | 3300038443 | Ga0395901_0484106 | Ga0395901_0484106_781_1161 | 126 |
| 565 | 3300038443 | Ga0395901_0791437 | Ga0395901_0791437_33_413 | 126 |
| 566 | 3300038443 | Ga0395901_0804646 | Ga0395901_0804646_444_824 | 126 |
| 567 | 3300038443 | Ga0395901_0957150 | Ga0395901_0957150_328_711 | 126 |
| 568 | 3300038443 | Ga0395901_1399795 | Ga0395901_1399795_131_511 | 126 |
| 569 | 3300038443 | Ga0395901_1902151 | Ga0395901_1902151_88_468 | 126 |
| 570 | 3300038443 | Ga0395901_2118286 | Ga0395901_2118286_92_472 | 126 |
| 571 | 3300039437 | Ga0436365_1455190 | Ga0436365_1455190_79_459 | 126 |
| 572 | 3300039450 | Ga0436363_0286509 | Ga0436363_0286509_396_776 | 126 |
| 573 | 3300039453 | Ga0436362_0313465 | Ga0436362_0313465_43_423 | 126 |
| 574 | 3300044658 | Ga0466972_0043338 | Ga0466972_0043338_1355_1735 | 126 |
| 575 | 3300044658 | Ga0466972_0124719 | Ga0466972_0124719_452_832 | 126 |
| 576 | 3300044683 | Ga0466965_0155271 | Ga0466965_0155271_364_744 | 126 |
| 577 | 3300044683 | Ga0466965_0286873 | Ga0466965_0286873_498_878 | 126 |
| 578 | 3300044693 | Ga0466961_0245935 | Ga0466961_0245935_304_684 | 126 |
| 579 | 3300044694 | Ga0466963_0098926 | Ga0466963_0098926_1473_1853 | 126 |
| 580 | 3300044719 | Ga0466971_0133143 | Ga0466971_0133143_12_413 | 126 |
| 581 | 3300044735 | Ga0466968_0554556 | Ga0466968_0554556_134_514 | 126 |
| 582 | 3300044765 | Ga0466970_0157013 | Ga0466970_0157013_644_1024 | 126 |
| 583 | 3300044842 | Ga0466957_0155899 | Ga0466957_0155899_91_471 | 126 |
| 584 | 3300044842 | Ga0466957_0341220 | Ga0466957_0341220_336_716 | 126 |
| 585 | 3300045049 | Ga0466959_0143961 | Ga0466959_0143961_1148_1528 | 126 |
| 586 | 3300045836 | Ga0466958_0376259 | Ga0466958_0376259_307_687 | 126 |
| 587 | 3300045976 | Ga0466967_0025276 | Ga0466967_0025276_943_1323 | 126 |
| 588 | 3300045976 | Ga0466967_0047283 | Ga0466967_0047283_976_1356 | 126 |
| 589 | 3300045976 | Ga0466967_0182456 | Ga0466967_0182456_573_953 | 126 |
| 590 | 3300045976 | Ga0466967_0624932 | Ga0466967_0624932_66_446 | 126 |
| 591 | 3300045976 | Ga0466967_1396082 | Ga0466967_1396082_203_583 | 126 |
| 592 | 3300046513 | Ga0495616_0063485 | Ga0495616_0063485_400_780 | 126 |
| 593 | 3300046557 | Ga0495622_0287546 | Ga0495622_0287546_169_549 | 126 |
| 594 | 3300046616 | Ga0495668_0030068 | Ga0495668_0030068_1990_2370 | 126 |
| 595 | 3300046616 | Ga0495668_0328134 | Ga0495668_0328134_344_724 | 126 |
| 596 | 3300046684 | Ga0495669_0000549 | Ga0495669_0000549_342_722 | 126 |
| 597 | 3300046684 | Ga0495669_0011110 | Ga0495669_0011110_1386_1766 | 126 |
| 598 | 3300046684 | Ga0495669_0138276 | Ga0495669_0138276_369_749 | 126 |
| 599 | 3300046684 | Ga0495669_0293543 | Ga0495669_0293543_361_741 | 126 |
| 600 | 3300046684 | Ga0495669_0333553 | Ga0495669_0333553_277_657 | 126 |
| 601 | 3300047317 | Ga0495604_1019052 | Ga0495604_1019052_106_486 | 126 |
| 602 | 3300048903 | Ga0496100_0176715 | Ga0496100_0176715_89_469 | 126 |
| 603 | 3300048904 | Ga0496101_0463427 | Ga0496101_0463427_171_551 | 126 |
| 604 | 3300048904 | Ga0496101_0757758 | Ga0496101_0757758_328_708 | 126 |
| 605 | 3300048907 | Ga0496104_0973694 | Ga0496104_0973694_148_528 | 126 |
| 606 | 3300048909 | Ga0496106_0399771 | Ga0496106_0399771_425_805 | 126 |
| 607 | 3300048911 | Ga0496108_0131842 | Ga0496108_0131842_1747_2127 | 126 |
| 608 | 3300048911 | Ga0496108_0991350 | Ga0496108_0991350_13_393 | 126 |
| 609 | 3300048912 | Ga0496109_0061968 | Ga0496109_0061968_1442_1822 | 126 |
| 610 | 3300048912 | Ga0496109_1700530 | Ga0496109_1700530_40_420 | 126 |
| 611 | 3300048913 | Ga0496110_1262798 | Ga0496110_1262798_141_521 | 126 |
| 612 | 3300048914 | Ga0496111_0005000 | Ga0496111_0005000_2322_2702 | 126 |
| 613 | 3300048914 | Ga0496111_0275715 | Ga0496111_0275715_460_840 | 126 |
| 614 | 3300048914 | Ga0496111_0483005 | Ga0496111_0483005_336_716 | 126 |
| 615 | 3300048915 | Ga0496112_0010612 | Ga0496112_0010612_4209_4589 | 126 |
| 616 | 3300048915 | Ga0496112_0261489 | Ga0496112_0261489_817_1197 | 126 |
| 617 | 3300048915 | Ga0496112_0389025 | Ga0496112_0389025_150_530 | 126 |
| 618 | 3300048915 | Ga0496112_1156826 | Ga0496112_1156826_105_485 | 126 |
| 619 | 3300048916 | Ga0496113_1023633 | Ga0496113_1023633_175_555 | 126 |
| 620 | 3300048917 | Ga0496114_0053296 | Ga0496114_0053296_1475_1855 | 126 |
| 621 | 3300048917 | Ga0496114_0143355 | Ga0496114_0143355_871_1251 | 126 |
| 622 | 3300048918 | Ga0496115_0001963 | Ga0496115_0001963_11621_12001 | 126 |
| 623 | 3300049460 | Ga0495682_0001599 | Ga0495682_0001599_259_639 | 126 |
| 624 | 3300049581 | Ga0501047_0008272 | Ga0501047_0008272_4837_5217 | 126 |
| 625 | 3300049583 | Ga0501067_0001368 | Ga0501067_0001368_11385_11765 | 126 |
| 626 | 3300049583 | Ga0501067_0018749 | Ga0501067_0018749_2835_3218 | 126 |
| 627 | 3300049584 | Ga0501068_1134089 | Ga0501068_1134089_123_506 | 126 |
| 628 | 3300049585 | Ga0501069_0304112 | Ga0501069_0304112_533_919 | 126 |
| 629 | 3300049586 | Ga0501070_0058487 | Ga0501070_0058487_2056_2436 | 126 |
| 630 | 3300049586 | Ga0501070_0341610 | Ga0501070_0341610_438_824 | 126 |
| 631 | 3300049587 | Ga0501071_0530908 | Ga0501071_0530908_219_602 | 126 |
| 632 | 3300049587 | Ga0501071_1116940 | Ga0501071_1116940_15_401 | 126 |
| 633 | 3300049588 | Ga0501072_0019146 | Ga0501072_0019146_25_405 | 126 |
| 634 | 3300049589 | Ga0501073_0283728 | Ga0501073_0283728_482_862 | 126 |
| 635 | 3300049589 | Ga0501073_1000480 | Ga0501073_1000480_120_500 | 126 |
| 636 | 3300049590 | Ga0501074_0948379 | Ga0501074_0948379_146_526 | 126 |
| 637 | 3300049741 | Ga0501079_0196512 | Ga0501079_0196512_1170_1550 | 126 |
| 638 | 3300049742 | Ga0501080_0293458 | Ga0501080_0293458_157_543 | 126 |
| 639 | 3300049742 | Ga0501080_0355792 | Ga0501080_0355792_576_956 | 126 |
| 640 | 3300049744 | Ga0501083_0427276 | Ga0501083_0427276_41_421 | 126 |
| 641 | 3300050507 | nmdc:mga05p37_560584_c1 | nmdc:mga05p37_560584_c1_220_621 | 126 |
| 642 | 3300050508 | nmdc:mga09592_544277_c1 | nmdc:mga09592_544277_c1_283_663 | 126 |
| 643 | 3300050508 | nmdc:mga09592_990168_c1 | nmdc:mga09592_990168_c1_185_586 | 126 |
| 644 | 3300050509 | nmdc:mga0qj67_22674_c1 | nmdc:mga0qj67_22674_c1_955_1335 | 126 |
| 645 | 3300050510 | nmdc:mga06r32_23609_c1 | nmdc:mga06r32_23609_c1_1023_1403 | 126 |
| 646 | 3300050510 | nmdc:mga06r32_305613_c1 | nmdc:mga06r32_305613_c1_485_886 | 126 |
| 647 | 3300050511 | nmdc:mga08y16_544379_c1 | nmdc:mga08y16_544379_c1_599_979 | 126 |
| 648 | 3300050515 | nmdc:mga0a205_696_c1 | nmdc:mga0a205_696_c1_6288_6668 | 126 |
| 649 | 3300053133 | Ga0500655_015682 | Ga0500655_015682_609_989 | 126 |
| 650 | 3300053133 | Ga0500655_069298 | Ga0500655_069298_33_413 | 126 |
| 651 | 3300054114 | Ga0501084_0185405 | Ga0501084_0185405_931_1311 | 126 |
| 652 | 3300060353 | Ga0501082_1272647 | Ga0501082_1272647_81_467 | 126 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6z7t-assembly1.cif.gz_A | nucleotide-free myosin-ii motor domain | 0.9063 | 88 | 111 |
| 6z7t-assembly2.cif.gz_B | nucleotide-free myosin-ii motor domain | 0.8924 | 88 | 111 |
| 4lqb-assembly1.cif.gz_B | crystal structure of uncharacterized protein kfla3161 | 0.8576 | 1 | 126 |
| 7muw-assembly1.cif.gz_Cf | reconstruction of the legionella pneumophila dot/icm t4ss 3dva map 4 | 0.8529 | 88 | 111 |
| 4lqb-assembly1.cif.gz_B | crystal structure of uncharacterized protein kfla3161 | 0.8514 | 1 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54ZV3_691_741_2.30.30.60 | Mainly Beta;Roll;SH3 type barrels.; | 0.9251 | 88 | 111 | 2.30.30.60 |
| af_Q2G117_134_187_2.30.30.60 | Mainly Beta;Roll;SH3 type barrels.; | 0.8986 | 89 | 111 | 2.30.30.60 |
| af_Q09915_1043_1121_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8942 | 88 | 111 | 2.40.50.140 |
| af_A0A0R4IJY6_29_78_2.30.30.360 | Mainly Beta;Roll;SH3 type barrels.;Myosin S1 fragment, N-terminal | 0.887 | 88 | 111 | 2.30.30.360 |
| af_Q55A48_1158_1269_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8811 | 88 | 111 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A369ULU2-F1-model_v4 | VOC family protein | 0.9643 | 1 | 126 |
|
| AF-A0A534AGY9-F1-model_v4 | VOC family protein | 0.9455 | 70 | 126 |
|
| AF-A0A5C5TGV8-F1-model_v4 | VOC family protein | 0.9341 | 1 | 126 |
|
| AF-A0A839SSJ9-F1-model_v4 | VOC domain-containing protein | 0.9297 | 2 | 126 |
|
| AF-A0A5D0WGG5-F1-model_v4 | deleted | 0.929 | 1 | 126 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar