F472655
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 652 | 238 | 1304 | 124 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10871400|Ga0070658_108714001 |
| Length | 147 |
| Sequence | VVIPAAIRDELRAHAAAEAPNECCGLVLVKDGVAVRYIPGVNTLASPYRYELYIDPVVWSDIEDDVDQVIFHSHPETEPRPSRTDRELAGLWSGKPFLIYGLARDELRAWRVSRDEVIEIEIEARPKEVSDTKPVSDTPWRDAATKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 61 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 66 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 69 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 70 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 71 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 107 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 108 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 109 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 111 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 113 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 114 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 115 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 116 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 117 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 119 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 120 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 121 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 123 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 124 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 125 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 126 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 127 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 128 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 129 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 130 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 131 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 132 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 133 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 134 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 137 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 138 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 139 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 140 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 143 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 144 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 145 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 146 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 147 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 148 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 149 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 150 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 151 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 152 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 153 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 154 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 155 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 156 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 157 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 158 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 159 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 160 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 161 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 200 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 201 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 202 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 203 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 204 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 205 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 208 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 209 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 210 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 211 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 212 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 213 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 238 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.63 |
| Metatranscriptomes | 3.37 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.44 |
| Rhizosphere | 90.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10871400 | 3300005327 | Bacteria | 783 |
| 2 | Ga0070658_10006107 | 3300005327 | Bacteria | 9767 |
| 3 | Ga0070658_10017974 | 3300005327 | Bacteria | 5655 |
| 4 | Ga0070658_10184961 | 3300005327 | Bacteria | 1754 |
| 5 | Ga0070658_10270584 | 3300005327 | Bacteria | 1445 |
| 6 | Ga0070658_10420184 | 3300005327 | Bacteria | 1150 |
| 7 | Ga0070683_100008124 | 3300005329 | Bacteria | 8911 |
| 8 | Ga0070683_100055400 | 3300005329 | Bacteria | 3680 |
| 9 | Ga0070683_100110874 | 3300005329 | Bacteria | 2588 |
| 10 | Ga0070683_100114814 | 3300005329 | Bacteria | 2542 |
| 11 | Ga0070683_100268256 | 3300005329 | Bacteria | 1623 |
| 12 | Ga0070683_100359514 | 3300005329 | Bacteria | 1387 |
| 13 | Ga0070680_100013010 | 3300005336 | Bacteria | 6473 |
| 14 | Ga0070680_100027281 | 3300005336 | Bacteria | 4573 |
| 15 | Ga0070680_100091075 | 3300005336 | Bacteria | 2524 |
| 16 | Ga0070680_100108550 | 3300005336 | Bacteria | 2309 |
| 17 | Ga0070680_100247269 | 3300005336 | Bacteria | 1508 |
| 18 | Ga0070682_100408465 | 3300005337 | Bacteria | 1029 |
| 19 | Ga0070660_100001013 | 3300005339 | Bacteria | 18891 |
| 20 | Ga0070660_100002820 | 3300005339 | Bacteria | 11961 |
| 21 | Ga0070660_100008500 | 3300005339 | Bacteria | 7183 |
| 22 | Ga0070660_100088167 | 3300005339 | Bacteria | 2443 |
| 23 | Ga0070660_100105399 | 3300005339 | Bacteria | 2238 |
| 24 | Ga0070660_100112109 | 3300005339 | Bacteria | 2171 |
| 25 | Ga0070660_100560298 | 3300005339 | Bacteria | 954 |
| 26 | Ga0070660_100796608 | 3300005339 | Bacteria | 795 |
| 27 | Ga0070661_100150615 | 3300005344 | Bacteria | 1758 |
| 28 | Ga0070661_100515375 | 3300005344 | Bacteria | 959 |
| 29 | Ga0070661_100908584 | 3300005344 | Unclassified | 727 |
| 30 | Ga0070661_101188406 | 3300005344 | Bacteria | 638 |
| 31 | Ga0070673_101342150 | 3300005364 | Archaea | 672 |
| 32 | Ga0070659_100006516 | 3300005366 | Bacteria | 8429 |
| 33 | Ga0070659_100065520 | 3300005366 | Bacteria | 2877 |
| 34 | Ga0070659_100715631 | 3300005366 | Bacteria | 867 |
| 35 | Ga0070667_100036363 | 3300005367 | Bacteria | 4129 |
| 36 | Ga0070709_10682064 | 3300005434 | Bacteria | 798 |
| 37 | Ga0070714_100147741 | 3300005435 | Bacteria | 2115 |
| 38 | Ga0070714_100395085 | 3300005435 | Unclassified | 1306 |
| 39 | Ga0070713_100281127 | 3300005436 | Bacteria | 1527 |
| 40 | Ga0070713_100472744 | 3300005436 | Bacteria | 1180 |
| 41 | Ga0070713_100517840 | 3300005436 | Bacteria | 1127 |
| 42 | Ga0070713_101164615 | 3300005436 | Bacteria | 746 |
| 43 | Ga0070710_10429857 | 3300005437 | Archaea | 891 |
| 44 | Ga0070711_100025738 | 3300005439 | Bacteria | 3852 |
| 45 | Ga0070711_100058001 | 3300005439 | Bacteria | 2683 |
| 46 | Ga0070711_100323411 | 3300005439 | Bacteria | 1233 |
| 47 | Ga0070711_101213233 | 3300005439 | Bacteria | 653 |
| 48 | Ga0070694_100120755 | 3300005444 | Bacteria | 1880 |
| 49 | Ga0070678_102287801 | 3300005456 | Unclassified | 513 |
| 50 | Ga0070681_10002617 | 3300005458 | Bacteria | 16522 |
| 51 | Ga0070681_10032792 | 3300005458 | Bacteria | 5215 |
| 52 | Ga0070681_10039487 | 3300005458 | Bacteria | 4731 |
| 53 | Ga0070681_10088652 | 3300005458 | Bacteria | 3045 |
| 54 | Ga0070681_10093114 | 3300005458 | Bacteria | 2962 |
| 55 | Ga0070681_10178595 | 3300005458 | Bacteria | 2044 |
| 56 | Ga0070681_10263252 | 3300005458 | Bacteria | 1636 |
| 57 | Ga0070707_100159349 | 3300005468 | Bacteria | 2199 |
| 58 | Ga0070707_101081754 | 3300005468 | Bacteria | 768 |
| 59 | Ga0070707_101402839 | 3300005468 | Bacteria | 665 |
| 60 | Ga0070707_101961383 | 3300005468 | Unclassified | 553 |
| 61 | Ga0070698_101026151 | 3300005471 | Bacteria | 772 |
| 62 | Ga0070679_100020443 | 3300005530 | Bacteria | 6454 |
| 63 | Ga0070679_100021560 | 3300005530 | Bacteria | 6291 |
| 64 | Ga0070679_100085444 | 3300005530 | Bacteria | 3143 |
| 65 | Ga0070679_100095383 | 3300005530 | Bacteria | 2962 |
| 66 | Ga0070679_100134663 | 3300005530 | Bacteria | 2452 |
| 67 | Ga0070679_100161058 | 3300005530 | Bacteria | 2218 |
| 68 | Ga0070679_100217523 | 3300005530 | Bacteria | 1872 |
| 69 | Ga0070679_100222542 | 3300005530 | Bacteria | 1848 |
| 70 | Ga0070679_100222914 | 3300005530 | Bacteria | 1846 |
| 71 | Ga0070684_100017441 | 3300005535 | Bacteria | 5893 |
| 72 | Ga0070684_100053861 | 3300005535 | Bacteria | 3504 |
| 73 | Ga0070684_100124584 | 3300005535 | Bacteria | 2320 |
| 74 | Ga0070684_100141482 | 3300005535 | Bacteria | 2176 |
| 75 | Ga0070684_100254685 | 3300005535 | Bacteria | 1605 |
| 76 | Ga0070684_100547629 | 3300005535 | Bacteria | 1074 |
| 77 | Ga0068853_100236195 | 3300005539 | Bacteria | 1674 |
| 78 | Ga0068853_100397945 | 3300005539 | Bacteria | 1289 |
| 79 | Ga0068853_100841818 | 3300005539 | Unclassified | 880 |
| 80 | Ga0070686_100327699 | 3300005544 | Bacteria | 1144 |
| 81 | Ga0070696_100136587 | 3300005546 | Bacteria | 1788 |
| 82 | Ga0070693_100770247 | 3300005547 | Bacteria | 711 |
| 83 | Ga0070665_100012181 | 3300005548 | Bacteria | 8670 |
| 84 | Ga0068855_100016381 | 3300005563 | Bacteria | 8911 |
| 85 | Ga0068855_100021285 | 3300005563 | Bacteria | 7775 |
| 86 | Ga0068855_100022565 | 3300005563 | Bacteria | 7541 |
| 87 | Ga0068855_100052921 | 3300005563 | Bacteria | 4778 |
| 88 | Ga0068855_100116389 | 3300005563 | Bacteria | 3064 |
| 89 | Ga0068855_100308371 | 3300005563 | Bacteria | 1752 |
| 90 | Ga0068855_100755363 | 3300005563 | Bacteria | 1037 |
| 91 | Ga0068855_101235334 | 3300005563 | Bacteria | 776 |
| 92 | Ga0070664_101443254 | 3300005564 | Bacteria | 651 |
| 93 | Ga0068857_100023096 | 3300005577 | Bacteria | 5470 |
| 94 | Ga0068856_100025719 | 3300005614 | Bacteria | 5740 |
| 95 | Ga0068856_100431228 | 3300005614 | Bacteria | 1338 |
| 96 | Ga0068856_100799995 | 3300005614 | Unclassified | 962 |
| 97 | Ga0068852_100102984 | 3300005616 | Bacteria | 2581 |
| 98 | Ga0068852_100432569 | 3300005616 | Bacteria | 1300 |
| 99 | Ga0068864_101893204 | 3300005618 | Unclassified | 602 |
| 100 | Ga0068866_10153918 | 3300005718 | Bacteria | 1334 |
| 101 | Ga0068851_10146473 | 3300005834 | Bacteria | 1288 |
| 102 | Ga0068851_10833077 | 3300005834 | Bacteria | 575 |
| 103 | Ga0081455_10197006 | 3300005937 | Bacteria | 1512 |
| 104 | Ga0081539_10229088 | 3300005985 | Bacteria | 840 |
| 105 | Ga0070717_10374000 | 3300006028 | Bacteria | 1277 |
| 106 | Ga0070716_100271237 | 3300006173 | Bacteria | 1166 |
| 107 | Ga0070712_100016784 | 3300006175 | Bacteria | 4734 |
| 108 | Ga0070712_101125465 | 3300006175 | Unclassified | 682 |
| 109 | Ga0097621_100258783 | 3300006237 | Bacteria | 1526 |
| 110 | Ga0075428_101834311 | 3300006844 | Bacteria | 631 |
| 111 | Ga0075434_100149481 | 3300006871 | Bacteria | 2356 |
| 112 | Ga0075434_100711491 | 3300006871 | Bacteria | 1022 |
| 113 | Ga0105240_10088634 | 3300009093 | Bacteria | 3786 |
| 114 | Ga0105240_10192097 | 3300009093 | Bacteria | 2400 |
| 115 | Ga0105240_10557858 | 3300009093 | Bacteria | 1266 |
| 116 | Ga0105240_10877237 | 3300009093 | Bacteria | 967 |
| 117 | Ga0105240_10878507 | 3300009093 | Unclassified | 966 |
| 118 | Ga0105240_11733408 | 3300009093 | Unclassified | 652 |
| 119 | Ga0105245_10102311 | 3300009098 | Bacteria | 2653 |
| 120 | Ga0105245_10441208 | 3300009098 | Bacteria | 1308 |
| 121 | Ga0105245_11085794 | 3300009098 | Bacteria | 846 |
| 122 | Ga0105245_11399191 | 3300009098 | Bacteria | 749 |
| 123 | Ga0114129_11168972 | 3300009147 | Unclassified | 960 |
| 124 | Ga0114129_12296975 | 3300009147 | Archaea | 647 |
| 125 | Ga0114129_12520257 | 3300009147 | Unclassified | 615 |
| 126 | Ga0105243_10692202 | 3300009148 | Bacteria | 992 |
| 127 | Ga0105243_11724020 | 3300009148 | Bacteria | 656 |
| 128 | Ga0105243_12103760 | 3300009148 | Viruses | 600 |
| 129 | Ga0105241_11979045 | 3300009174 | Bacteria | 573 |
| 130 | Ga0105242_10179751 | 3300009176 | Bacteria | 1866 |
| 131 | Ga0105237_10134773 | 3300009545 | Bacteria | 2464 |
| 132 | Ga0105237_12522486 | 3300009545 | Unclassified | 524 |
| 133 | Ga0105238_10094540 | 3300009551 | Bacteria | 2977 |
| 134 | Ga0105238_10227561 | 3300009551 | Bacteria | 1841 |
| 135 | Ga0105238_10682024 | 3300009551 | Bacteria | 1039 |
| 136 | Ga0105238_11543092 | 3300009551 | Bacteria | 693 |
| 137 | Ga0105239_10234677 | 3300010375 | Bacteria | 2058 |
| 138 | Ga0105239_10770088 | 3300010375 | Bacteria | 1102 |
| 139 | Ga0105239_11500081 | 3300010375 | Bacteria | 779 |
| 140 | Ga0157373_10285481 | 3300013100 | Bacteria | 1170 |
| 141 | Ga0157373_10524971 | 3300013100 | Bacteria | 857 |
| 142 | Ga0157373_10582584 | 3300013100 | Bacteria | 813 |
| 143 | Ga0157371_10717758 | 3300013102 | Bacteria | 749 |
| 144 | Ga0157370_10029872 | 3300013104 | Bacteria | 5343 |
| 145 | Ga0157370_10068741 | 3300013104 | Bacteria | 3347 |
| 146 | Ga0157370_10095157 | 3300013104 | Bacteria | 2794 |
| 147 | Ga0157370_10267561 | 3300013104 | Bacteria | 1579 |
| 148 | Ga0157370_10560591 | 3300013104 | Bacteria | 1047 |
| 149 | Ga0157370_10690660 | 3300013104 | Unclassified | 932 |
| 150 | Ga0157369_10003269 | 3300013105 | Bacteria | 19304 |
| 151 | Ga0157369_10015282 | 3300013105 | Bacteria | 8656 |
| 152 | Ga0157369_10036906 | 3300013105 | Bacteria | 5352 |
| 153 | Ga0157369_10185486 | 3300013105 | Bacteria | 2188 |
| 154 | Ga0157369_10491432 | 3300013105 | Unclassified | 1270 |
| 155 | Ga0157369_10955072 | 3300013105 | Bacteria | 878 |
| 156 | Ga0157369_11239689 | 3300013105 | Bacteria | 761 |
| 157 | Ga0157369_11492890 | 3300013105 | Bacteria | 688 |
| 158 | Ga0157369_11800245 | 3300013105 | Bacteria | 622 |
| 159 | Ga0157374_10069091 | 3300013296 | Bacteria | 3326 |
| 160 | Ga0157374_10502691 | 3300013296 | Bacteria | 1217 |
| 161 | Ga0157374_11309931 | 3300013296 | Bacteria | 746 |
| 162 | Ga0157374_11575590 | 3300013296 | Bacteria | 681 |
| 163 | Ga0157378_10133693 | 3300013297 | Bacteria | 2298 |
| 164 | Ga0157372_10015716 | 3300013307 | Bacteria | 8117 |
| 165 | Ga0157372_10084579 | 3300013307 | Bacteria | 3596 |
| 166 | Ga0157372_10248703 | 3300013307 | Bacteria | 2063 |
| 167 | Ga0157372_10288472 | 3300013307 | Bacteria | 1908 |
| 168 | Ga0157372_10312612 | 3300013307 | Bacteria | 1829 |
| 169 | Ga0157372_10347247 | 3300013307 | Bacteria | 1729 |
| 170 | Ga0157372_11171796 | 3300013307 | Bacteria | 888 |
| 171 | Ga0157375_10372213 | 3300013308 | Bacteria | 1595 |
| 172 | Ga0182008_10309959 | 3300014497 | Bacteria | 828 |
| 173 | Ga0157377_10161190 | 3300014745 | Bacteria | 1395 |
| 174 | Ga0157376_10257903 | 3300014969 | Unclassified | 1632 |
| 175 | Ga0197907_10850878 | 3300020069 | Bacteria | 776 |
| 176 | Ga0197907_11243580 | 3300020069 | Bacteria | 2254 |
| 177 | Ga0197907_11426289 | 3300020069 | Bacteria | 3444 |
| 178 | Ga0206356_10015725 | 3300020070 | Bacteria | 3211 |
| 179 | Ga0206356_10221768 | 3300020070 | Unclassified | 930 |
| 180 | Ga0206356_10791098 | 3300020070 | Bacteria | 963 |
| 181 | Ga0206356_11699449 | 3300020070 | Bacteria | 1345 |
| 182 | Ga0206355_1622731 | 3300020076 | Bacteria | 867 |
| 183 | Ga0206354_10622774 | 3300020081 | Bacteria | 1120 |
| 184 | Ga0206354_10939136 | 3300020081 | Bacteria | 1380 |
| 185 | Ga0206354_11330100 | 3300020081 | Bacteria | 3119 |
| 186 | Ga0206354_11683482 | 3300020081 | Bacteria | 512 |
| 187 | Ga0206353_10708607 | 3300020082 | Unclassified | 767 |
| 188 | Ga0206353_10737399 | 3300020082 | Bacteria | 7021 |
| 189 | Ga0206353_10751377 | 3300020082 | Bacteria | 2531 |
| 190 | Ga0206353_10758017 | 3300020082 | Bacteria | 1269 |
| 191 | Ga0206353_11474681 | 3300020082 | Bacteria | 1246 |
| 192 | Ga0206353_11668888 | 3300020082 | Bacteria | 6699 |
| 193 | Ga0206353_11790786 | 3300020082 | Bacteria | 1177 |
| 194 | Ga0213874_10045343 | 3300021377 | Bacteria | 1331 |
| 195 | Ga0213876_10104569 | 3300021384 | Bacteria | 1502 |
| 196 | Ga0213871_10219483 | 3300021441 | Bacteria | 597 |
| 197 | Ga0224712_10016744 | 3300022467 | Bacteria | 2415 |
| 198 | Ga0224712_10171929 | 3300022467 | Bacteria | 972 |
| 199 | Ga0224712_10259679 | 3300022467 | Bacteria | 804 |
| 200 | Ga0207656_10041145 | 3300025321 | Bacteria | 1962 |
| 201 | Ga0207692_10418616 | 3300025898 | Archaea | 838 |
| 202 | Ga0207647_10172250 | 3300025904 | Bacteria | 1260 |
| 203 | Ga0207699_10120386 | 3300025906 | Bacteria | 1697 |
| 204 | Ga0207699_10338223 | 3300025906 | Bacteria | 1060 |
| 205 | Ga0207705_10012754 | 3300025909 | Bacteria | 6064 |
| 206 | Ga0207705_10034963 | 3300025909 | Bacteria | 3594 |
| 207 | Ga0207705_10118648 | 3300025909 | Bacteria | 1961 |
| 208 | Ga0207705_10198690 | 3300025909 | Bacteria | 1519 |
| 209 | Ga0207705_11134865 | 3300025909 | Bacteria | 601 |
| 210 | Ga0207684_11002457 | 3300025910 | Unclassified | 699 |
| 211 | Ga0207707_10020628 | 3300025912 | Bacteria | 5755 |
| 212 | Ga0207707_10063455 | 3300025912 | Bacteria | 3215 |
| 213 | Ga0207707_10086756 | 3300025912 | Bacteria | 2735 |
| 214 | Ga0207707_10239648 | 3300025912 | Bacteria | 1577 |
| 215 | Ga0207707_11168478 | 3300025912 | Bacteria | 624 |
| 216 | Ga0207707_11422586 | 3300025912 | Bacteria | 552 |
| 217 | Ga0207695_10333547 | 3300025913 | Bacteria | 1405 |
| 218 | Ga0207695_10585873 | 3300025913 | Bacteria | 997 |
| 219 | Ga0207695_10616930 | 3300025913 | Bacteria | 966 |
| 220 | Ga0207695_10908721 | 3300025913 | Bacteria | 760 |
| 221 | Ga0207695_11190912 | 3300025913 | Bacteria | 642 |
| 222 | Ga0207671_10056502 | 3300025914 | Bacteria | 2908 |
| 223 | Ga0207693_10046613 | 3300025915 | Bacteria | 3405 |
| 224 | Ga0207693_10047203 | 3300025915 | Bacteria | 3384 |
| 225 | Ga0207693_10101076 | 3300025915 | Bacteria | 2261 |
| 226 | Ga0207663_10023891 | 3300025916 | Bacteria | 3515 |
| 227 | Ga0207663_10105674 | 3300025916 | Bacteria | 1901 |
| 228 | Ga0207663_10258731 | 3300025916 | Bacteria | 1284 |
| 229 | Ga0207663_10843682 | 3300025916 | Bacteria | 731 |
| 230 | Ga0207663_11211813 | 3300025916 | Bacteria | 608 |
| 231 | Ga0207660_10021015 | 3300025917 | Bacteria | 4386 |
| 232 | Ga0207660_10063167 | 3300025917 | Bacteria | 2669 |
| 233 | Ga0207660_10129490 | 3300025917 | Bacteria | 1919 |
| 234 | Ga0207660_10238799 | 3300025917 | Bacteria | 1431 |
| 235 | Ga0207657_10000456 | 3300025919 | Bacteria | 43472 |
| 236 | Ga0207657_10002422 | 3300025919 | Bacteria | 20155 |
| 237 | Ga0207657_10007240 | 3300025919 | Bacteria | 11398 |
| 238 | Ga0207657_10040931 | 3300025919 | Bacteria | 4102 |
| 239 | Ga0207657_10128438 | 3300025919 | Bacteria | 2080 |
| 240 | Ga0207657_10177524 | 3300025919 | Bacteria | 1723 |
| 241 | Ga0207657_10231286 | 3300025919 | Unclassified | 1478 |
| 242 | Ga0207657_10676447 | 3300025919 | Bacteria | 802 |
| 243 | Ga0207657_10893545 | 3300025919 | Bacteria | 684 |
| 244 | Ga0207657_11292243 | 3300025919 | Unclassified | 551 |
| 245 | Ga0207649_10065721 | 3300025920 | Bacteria | 2297 |
| 246 | Ga0207649_10155963 | 3300025920 | Bacteria | 1577 |
| 247 | Ga0207649_10202498 | 3300025920 | Bacteria | 1403 |
| 248 | Ga0207649_10329828 | 3300025920 | Bacteria | 1124 |
| 249 | Ga0207652_10045483 | 3300025921 | Bacteria | 3743 |
| 250 | Ga0207652_10049366 | 3300025921 | Bacteria | 3602 |
| 251 | Ga0207652_10069911 | 3300025921 | Bacteria | 3048 |
| 252 | Ga0207652_10078462 | 3300025921 | Bacteria | 2883 |
| 253 | Ga0207652_10143937 | 3300025921 | Bacteria | 2132 |
| 254 | Ga0207652_10184794 | 3300025921 | Bacteria | 1874 |
| 255 | Ga0207652_10259199 | 3300025921 | Bacteria | 1568 |
| 256 | Ga0207652_10296054 | 3300025921 | Bacteria | 1460 |
| 257 | Ga0207652_10457399 | 3300025921 | Bacteria | 1150 |
| 258 | Ga0207652_10675008 | 3300025921 | Bacteria | 923 |
| 259 | Ga0207646_10181418 | 3300025922 | Bacteria | 1901 |
| 260 | Ga0207646_10219411 | 3300025922 | Bacteria | 1718 |
| 261 | Ga0207646_10944381 | 3300025922 | Bacteria | 764 |
| 262 | Ga0207646_11113437 | 3300025922 | Unclassified | 695 |
| 263 | Ga0207694_10084550 | 3300025924 | Bacteria | 2496 |
| 264 | Ga0207694_10118222 | 3300025924 | Bacteria | 2114 |
| 265 | Ga0207687_10102093 | 3300025927 | Bacteria | 2112 |
| 266 | Ga0207687_10303629 | 3300025927 | Bacteria | 1286 |
| 267 | Ga0207687_10308451 | 3300025927 | Bacteria | 1277 |
| 268 | Ga0207687_10445436 | 3300025927 | Unclassified | 1073 |
| 269 | Ga0207700_10090774 | 3300025928 | Bacteria | 2412 |
| 270 | Ga0207700_10404401 | 3300025928 | Bacteria | 1197 |
| 271 | Ga0207700_10564857 | 3300025928 | Bacteria | 1011 |
| 272 | Ga0207700_10752253 | 3300025928 | Bacteria | 871 |
| 273 | Ga0207700_10985172 | 3300025928 | Bacteria | 754 |
| 274 | Ga0207644_10319058 | 3300025931 | Bacteria | 1256 |
| 275 | Ga0207644_11521720 | 3300025931 | Unclassified | 561 |
| 276 | Ga0207690_10039673 | 3300025932 | Bacteria | 3073 |
| 277 | Ga0207690_10631790 | 3300025932 | Bacteria | 876 |
| 278 | Ga0207709_10556514 | 3300025935 | Unclassified | 903 |
| 279 | Ga0207665_10210908 | 3300025939 | Bacteria | 1419 |
| 280 | Ga0207665_10355028 | 3300025939 | Bacteria | 1107 |
| 281 | Ga0207665_11092828 | 3300025939 | Viruses | 636 |
| 282 | Ga0207661_10063785 | 3300025944 | Bacteria | 2985 |
| 283 | Ga0207661_10114240 | 3300025944 | Bacteria | 2289 |
| 284 | Ga0207661_10135308 | 3300025944 | Bacteria | 2116 |
| 285 | Ga0207661_10287324 | 3300025944 | Bacteria | 1471 |
| 286 | Ga0207661_10323183 | 3300025944 | Bacteria | 1387 |
| 287 | Ga0207679_10858863 | 3300025945 | Bacteria | 829 |
| 288 | Ga0207667_10047752 | 3300025949 | Bacteria | 4530 |
| 289 | Ga0207667_10063050 | 3300025949 | Bacteria | 3873 |
| 290 | Ga0207667_10080779 | 3300025949 | Bacteria | 3368 |
| 291 | Ga0207667_10403825 | 3300025949 | Bacteria | 1391 |
| 292 | Ga0207667_10790148 | 3300025949 | Bacteria | 946 |
| 293 | Ga0207640_10415239 | 3300025981 | Bacteria | 1100 |
| 294 | Ga0207640_11266877 | 3300025981 | Bacteria | 657 |
| 295 | Ga0207658_10037355 | 3300025986 | Bacteria | 3489 |
| 296 | Ga0207639_10183890 | 3300026041 | Bacteria | 1780 |
| 297 | Ga0207639_10722320 | 3300026041 | Bacteria | 925 |
| 298 | Ga0207639_11344114 | 3300026041 | Bacteria | 671 |
| 299 | Ga0207678_10238026 | 3300026067 | Bacteria | 1559 |
| 300 | Ga0207702_10036781 | 3300026078 | Bacteria | 4096 |
| 301 | Ga0207702_10147959 | 3300026078 | Bacteria | 2134 |
| 302 | Ga0207702_10351656 | 3300026078 | Bacteria | 1410 |
| 303 | Ga0207674_10029100 | 3300026116 | Bacteria | 5822 |
| 304 | Ga0207674_10101752 | 3300026116 | Bacteria | 2854 |
| 305 | Ga0207698_10108156 | 3300026142 | Bacteria | 2323 |
| 306 | Ga0207698_11523008 | 3300026142 | Bacteria | 684 |
| 307 | Ga0268266_10032791 | 3300028379 | Bacteria | 4414 |
| 308 | Ga0268266_12049864 | 3300028379 | Unclassified | 545 |
| 309 | Ga0265334_10028405 | 3300028573 | Bacteria | 2247 |
| 310 | Ga0265318_10007409 | 3300028577 | Bacteria | 4963 |
| 311 | Ga0265318_10061662 | 3300028577 | Bacteria | 1397 |
| 312 | Ga0265322_10006899 | 3300028654 | Bacteria | 3327 |
| 313 | Ga0265338_10003937 | 3300028800 | Bacteria | 20455 |
| 314 | Ga0265338_10346892 | 3300028800 | Bacteria | 1068 |
| 315 | Ga0265338_10637656 | 3300028800 | Bacteria | 739 |
| 316 | Ga0265330_10029920 | 3300031235 | Bacteria | 2447 |
| 317 | Ga0265332_10059603 | 3300031238 | Bacteria | 1634 |
| 318 | Ga0265328_10104157 | 3300031239 | Bacteria | 1052 |
| 319 | Ga0265320_10176918 | 3300031240 | Bacteria | 957 |
| 320 | Ga0265325_10007416 | 3300031241 | Bacteria | 6567 |
| 321 | Ga0265329_10030344 | 3300031242 | Bacteria | 1762 |
| 322 | Ga0265339_10017919 | 3300031249 | Bacteria | 4185 |
| 323 | Ga0265331_10074165 | 3300031250 | Bacteria | 1588 |
| 324 | Ga0265327_10017126 | 3300031251 | Bacteria | 4561 |
| 325 | Ga0265316_10011587 | 3300031344 | Bacteria | 7941 |
| 326 | Ga0265316_10201953 | 3300031344 | Bacteria | 1473 |
| 327 | Ga0265313_10003112 | 3300031595 | Bacteria | 13716 |
| 328 | Ga0265313_10069648 | 3300031595 | Bacteria | 1623 |
| 329 | Ga0265314_10005428 | 3300031711 | Bacteria | 11511 |
| 330 | Ga0265314_10056180 | 3300031711 | Bacteria | 2711 |
| 331 | Ga0265314_10368547 | 3300031711 | Bacteria | 785 |
| 332 | Ga0265342_10122652 | 3300031712 | Bacteria | 1462 |
| 333 | Ga0307412_10165139 | 3300031911 | Bacteria | 1650 |
| 334 | Ga0307415_100154354 | 3300032126 | Bacteria | 1771 |
| 335 | Ga0373944_0030739 | 3300035089 | Bacteria | 1612 |
| 336 | Ga0373936_0042232 | 3300035113 | Bacteria | 1830 |
| 337 | Ga0373945_0016020 | 3300035116 | Bacteria | 2526 |
| 338 | Ga0373957_0270722 | 3300035120 | Unclassified | 717 |
| 339 | Ga0373943_0081023 | 3300035170 | Bacteria | 1664 |
| 340 | Ga0373943_0484744 | 3300035170 | Bacteria | 721 |
| 341 | Ga0373946_0028507 | 3300035171 | Bacteria | 2215 |
| 342 | Ga0373946_0370884 | 3300035171 | Bacteria | 719 |
| 343 | Ga0373955_0008476 | 3300035172 | Bacteria | 4777 |
| 344 | Ga0373955_0563478 | 3300035172 | Bacteria | 697 |
| 345 | Ga0373935_0099605 | 3300035692 | Bacteria | 1914 |
| 346 | Ga0373947_0005521 | 3300035725 | Bacteria | 7380 |
| 347 | Ga0373947_0942608 | 3300035725 | Bacteria | 589 |
| 348 | Ga0373937_0872885 | 3300036401 | Bacteria | 848 |
| 349 | Ga0373925_0021948 | 3300037068 | Bacteria | 4654 |
| 350 | Ga0373925_0823962 | 3300037068 | Bacteria | 765 |
| 351 | Ga0395899_0077051 | 3300037312 | Bacteria | 2433 |
| 352 | Ga0395899_0130188 | 3300037312 | Bacteria | 1797 |
| 353 | Ga0395899_0233445 | 3300037312 | Unclassified | 1269 |
| 354 | Ga0395899_0385786 | 3300037312 | Bacteria | 930 |
| 355 | Ga0395899_0394753 | 3300037312 | Bacteria | 917 |
| 356 | Ga0395900_0056281 | 3300037418 | Bacteria | 4048 |
| 357 | Ga0395900_0072273 | 3300037418 | Bacteria | 3547 |
| 358 | Ga0395900_0092996 | 3300037418 | Bacteria | 3098 |
| 359 | Ga0395900_0135159 | 3300037418 | Bacteria | 2526 |
| 360 | Ga0395900_0160907 | 3300037418 | Bacteria | 2290 |
| 361 | Ga0395900_0163384 | 3300037418 | Bacteria | 2270 |
| 362 | Ga0395900_0247582 | 3300037418 | Bacteria | 1785 |
| 363 | Ga0395900_0570115 | 3300037418 | Bacteria | 1075 |
| 364 | Ga0395900_0993867 | 3300037418 | Archaea | 759 |
| 365 | Ga0395900_1153200 | 3300037418 | Bacteria | 691 |
| 366 | Ga0395900_1867359 | 3300037418 | Bacteria | 511 |
| 367 | Ga0395898_0008189 | 3300037466 | Bacteria | 11061 |
| 368 | Ga0395898_0017657 | 3300037466 | Bacteria | 7284 |
| 369 | Ga0395898_0046665 | 3300037466 | Bacteria | 4254 |
| 370 | Ga0395898_0059706 | 3300037466 | Bacteria | 3709 |
| 371 | Ga0395898_0061887 | 3300037466 | Bacteria | 3636 |
| 372 | Ga0395898_0315267 | 3300037466 | Bacteria | 1492 |
| 373 | Ga0395898_0337588 | 3300037466 | Unclassified | 1437 |
| 374 | Ga0395898_0874526 | 3300037466 | Bacteria | 837 |
| 375 | Ga0395898_1206813 | 3300037466 | Bacteria | 688 |
| 376 | Ga0395905_0070735 | 3300037471 | Bacteria | 3270 |
| 377 | Ga0395905_0529155 | 3300037471 | Bacteria | 1079 |
| 378 | Ga0395905_0841783 | 3300037471 | Unclassified | 820 |
| 379 | Ga0395905_0975081 | 3300037471 | Bacteria | 751 |
| 380 | Ga0395905_1877046 | 3300037471 | Bacteria | 505 |
| 381 | Ga0436364_0555216 | 3300037853 | Bacteria | 630 |
| 382 | Ga0436364_1355776 | 3300037853 | Bacteria | 2330 |
| 383 | Ga0395901_0011941 | 3300038443 | Bacteria | 8807 |
| 384 | Ga0395901_0014495 | 3300038443 | Bacteria | 8018 |
| 385 | Ga0395901_0016076 | 3300038443 | Bacteria | 7624 |
| 386 | Ga0395901_0016426 | 3300038443 | Bacteria | 7538 |
| 387 | Ga0395901_0135823 | 3300038443 | Bacteria | 2585 |
| 388 | Ga0395901_0747573 | 3300038443 | Bacteria | 971 |
| 389 | Ga0395901_0913927 | 3300038443 | Bacteria | 859 |
| 390 | Ga0395901_1383612 | 3300038443 | Unclassified | 663 |
| 391 | Ga0436365_0347346 | 3300039437 | Unclassified | 928 |
| 392 | Ga0436365_0489553 | 3300039437 | Bacteria | 2872 |
| 393 | Ga0436365_0970424 | 3300039437 | Unclassified | 503 |
| 394 | Ga0436365_1103566 | 3300039437 | Bacteria | 1918 |
| 395 | Ga0436365_1425538 | 3300039437 | Bacteria | 1122 |
| 396 | Ga0436360_0584751 | 3300039438 | Bacteria | 8285 |
| 397 | Ga0436363_1016123 | 3300039450 | Bacteria | 1358 |
| 398 | Ga0439453_0048825 | 3300041408 | Bacteria | 850 |
| 399 | Ga0451793_0603161 | 3300041452 | Bacteria | 535 |
| 400 | Ga0466969_0041941 | 3300044656 | Bacteria | 2287 |
| 401 | Ga0466969_0281626 | 3300044656 | Bacteria | 753 |
| 402 | Ga0466965_0073128 | 3300044683 | Bacteria | 1726 |
| 403 | Ga0466965_0166871 | 3300044683 | Bacteria | 1156 |
| 404 | Ga0466966_0007650 | 3300044684 | Bacteria | 7162 |
| 405 | Ga0466966_0020994 | 3300044684 | Bacteria | 4291 |
| 406 | Ga0466966_0093422 | 3300044684 | Bacteria | 1865 |
| 407 | Ga0466966_0527814 | 3300044684 | Bacteria | 710 |
| 408 | Ga0466961_0007494 | 3300044693 | Bacteria | 6941 |
| 409 | Ga0466961_0010770 | 3300044693 | Bacteria | 5841 |
| 410 | Ga0466961_0046781 | 3300044693 | Bacteria | 2766 |
| 411 | Ga0466961_0232855 | 3300044693 | Bacteria | 1133 |
| 412 | Ga0466961_0414656 | 3300044693 | Bacteria | 816 |
| 413 | Ga0466963_0007242 | 3300044694 | Bacteria | 6617 |
| 414 | Ga0466963_0027801 | 3300044694 | Bacteria | 3626 |
| 415 | Ga0466963_0106724 | 3300044694 | Unclassified | 1920 |
| 416 | Ga0466963_0241505 | 3300044694 | Bacteria | 1267 |
| 417 | Ga0466963_0276197 | 3300044694 | Bacteria | 1181 |
| 418 | Ga0466963_0319921 | 3300044694 | Bacteria | 1092 |
| 419 | Ga0466963_0522678 | 3300044694 | Bacteria | 838 |
| 420 | Ga0466964_0006942 | 3300044706 | Bacteria | 4231 |
| 421 | Ga0466964_0032444 | 3300044706 | Bacteria | 2075 |
| 422 | Ga0466964_0101443 | 3300044706 | Bacteria | 1269 |
| 423 | Ga0466964_0109269 | 3300044706 | Bacteria | 1231 |
| 424 | Ga0466971_0000454 | 3300044719 | Bacteria | 16016 |
| 425 | Ga0466971_0120700 | 3300044719 | Unclassified | 1213 |
| 426 | Ga0466971_0201023 | 3300044719 | Bacteria | 941 |
| 427 | Ga0466968_0050204 | 3300044735 | Bacteria | 1779 |
| 428 | Ga0466968_0216765 | 3300044735 | Bacteria | 900 |
| 429 | Ga0466968_0237635 | 3300044735 | Bacteria | 862 |
| 430 | Ga0466968_0389305 | 3300044735 | Bacteria | 682 |
| 431 | Ga0466957_0002470 | 3300044842 | Bacteria | 9932 |
| 432 | Ga0466957_0021207 | 3300044842 | Bacteria | 3827 |
| 433 | Ga0466957_0389155 | 3300044842 | Bacteria | 952 |
| 434 | Ga0466957_0498459 | 3300044842 | Bacteria | 844 |
| 435 | Ga0466960_0153436 | 3300044901 | Bacteria | 1232 |
| 436 | Ga0466960_0936076 | 3300044901 | Unclassified | 530 |
| 437 | Ga0466959_0034468 | 3300045049 | Bacteria | 3744 |
| 438 | Ga0466959_0046254 | 3300045049 | Bacteria | 3203 |
| 439 | Ga0466959_0047916 | 3300045049 | Bacteria | 3143 |
| 440 | Ga0466959_0133970 | 3300045049 | Bacteria | 1755 |
| 441 | Ga0466959_0295830 | 3300045049 | Unclassified | 1109 |
| 442 | Ga0466959_0855055 | 3300045049 | Bacteria | 607 |
| 443 | Ga0466959_0977713 | 3300045049 | Bacteria | 564 |
| 444 | Ga0451576_0214543 | 3300045051 | Bacteria | 2010 |
| 445 | Ga0466958_0000899 | 3300045836 | Bacteria | 13347 |
| 446 | Ga0466958_0008540 | 3300045836 | Bacteria | 5687 |
| 447 | Ga0466958_0215054 | 3300045836 | Bacteria | 1225 |
| 448 | Ga0466958_0587377 | 3300045836 | Bacteria | 724 |
| 449 | Ga0466967_0055859 | 3300045976 | Bacteria | 3479 |
| 450 | Ga0466967_0072855 | 3300045976 | Bacteria | 3080 |
| 451 | Ga0466967_0083305 | 3300045976 | Bacteria | 2892 |
| 452 | Ga0466967_0086980 | 3300045976 | Unclassified | 2832 |
| 453 | Ga0466967_0175226 | 3300045976 | Bacteria | 2020 |
| 454 | Ga0466967_0222616 | 3300045976 | Bacteria | 1794 |
| 455 | Ga0466967_0264740 | 3300045976 | Bacteria | 1645 |
| 456 | Ga0466967_0372671 | 3300045976 | Bacteria | 1385 |
| 457 | Ga0466967_0425663 | 3300045976 | Bacteria | 1294 |
| 458 | Ga0466967_0430547 | 3300045976 | Bacteria | 1287 |
| 459 | Ga0466967_0433158 | 3300045976 | Bacteria | 1283 |
| 460 | Ga0466967_0532055 | 3300045976 | Unclassified | 1156 |
| 461 | Ga0466967_0574310 | 3300045976 | Unclassified | 1111 |
| 462 | Ga0466967_0772411 | 3300045976 | Bacteria | 953 |
| 463 | Ga0466967_0839782 | 3300045976 | Bacteria | 912 |
| 464 | Ga0466967_0969510 | 3300045976 | Bacteria | 846 |
| 465 | Ga0466967_1116881 | 3300045976 | Bacteria | 785 |
| 466 | Ga0466967_1737771 | 3300045976 | Unclassified | 621 |
| 467 | Ga0495592_0042082 | 3300046454 | Bacteria | 3422 |
| 468 | Ga0495592_0149009 | 3300046454 | Bacteria | 1620 |
| 469 | Ga0495603_0349887 | 3300046455 | Bacteria | 848 |
| 470 | Ga0495641_0143588 | 3300046461 | Bacteria | 1066 |
| 471 | Ga0495641_0149590 | 3300046461 | Bacteria | 1043 |
| 472 | Ga0495651_0002815 | 3300046462 | Bacteria | 13476 |
| 473 | Ga0495651_0026482 | 3300046462 | Bacteria | 4517 |
| 474 | Ga0495651_0062008 | 3300046462 | Bacteria | 2861 |
| 475 | Ga0495651_0584393 | 3300046462 | Bacteria | 706 |
| 476 | Ga0495653_0871195 | 3300046463 | Bacteria | 538 |
| 477 | Ga0495664_0015976 | 3300046477 | Bacteria | 4274 |
| 478 | Ga0495664_0142288 | 3300046477 | Bacteria | 1454 |
| 479 | Ga0495594_0450891 | 3300046499 | Bacteria | 731 |
| 480 | Ga0495608_0010024 | 3300046511 | Bacteria | 6611 |
| 481 | Ga0495608_0042379 | 3300046511 | Bacteria | 3044 |
| 482 | Ga0495608_0044940 | 3300046511 | Bacteria | 2946 |
| 483 | Ga0495608_0547133 | 3300046511 | Unclassified | 698 |
| 484 | Ga0495628_0117287 | 3300046516 | Bacteria | 2044 |
| 485 | Ga0495628_0490667 | 3300046516 | Bacteria | 888 |
| 486 | Ga0495630_0011359 | 3300046517 | Bacteria | 6446 |
| 487 | Ga0495630_0156066 | 3300046517 | Bacteria | 1737 |
| 488 | Ga0495630_0622039 | 3300046517 | Bacteria | 827 |
| 489 | Ga0495630_0780772 | 3300046517 | Unclassified | 729 |
| 490 | Ga0495666_0042500 | 3300046526 | Bacteria | 2198 |
| 491 | Ga0495652_0019938 | 3300046529 | Bacteria | 5963 |
| 492 | Ga0495652_0093932 | 3300046529 | Bacteria | 2448 |
| 493 | Ga0495652_0232152 | 3300046529 | Bacteria | 1379 |
| 494 | Ga0495652_0317246 | 3300046529 | Bacteria | 1127 |
| 495 | Ga0495652_0905753 | 3300046529 | Unclassified | 581 |
| 496 | Ga0495640_0014634 | 3300046533 | Bacteria | 5926 |
| 497 | Ga0495640_0071099 | 3300046533 | Bacteria | 2335 |
| 498 | Ga0495640_0800075 | 3300046533 | Bacteria | 562 |
| 499 | Ga0495586_0216044 | 3300046535 | Bacteria | 1089 |
| 500 | Ga0495587_0005481 | 3300046536 | Bacteria | 8275 |
| 501 | Ga0495587_0025911 | 3300046536 | Bacteria | 3579 |
| 502 | Ga0495587_0033272 | 3300046536 | Bacteria | 3113 |
| 503 | Ga0495645_0010768 | 3300046543 | Bacteria | 6425 |
| 504 | Ga0495645_0162440 | 3300046543 | Bacteria | 1543 |
| 505 | Ga0495667_0003543 | 3300046559 | Bacteria | 10483 |
| 506 | Ga0495667_0011409 | 3300046559 | Bacteria | 6014 |
| 507 | Ga0495656_0657371 | 3300046615 | Bacteria | 563 |
| 508 | Ga0495634_0567676 | 3300046642 | Unclassified | 661 |
| 509 | Ga0495634_0745838 | 3300046642 | Bacteria | 561 |
| 510 | Ga0495657_0017020 | 3300046675 | Bacteria | 5283 |
| 511 | Ga0495599_0047205 | 3300046678 | Bacteria | 2699 |
| 512 | Ga0495599_0139940 | 3300046678 | Bacteria | 1501 |
| 513 | Ga0495623_0080150 | 3300046679 | Bacteria | 2021 |
| 514 | Ga0495646_0571309 | 3300046680 | Bacteria | 576 |
| 515 | Ga0495658_0005327 | 3300046683 | Bacteria | 6330 |
| 516 | Ga0495658_0273411 | 3300046683 | Bacteria | 1065 |
| 517 | Ga0495613_0578554 | 3300046689 | Bacteria | 749 |
| 518 | Ga0495613_0741349 | 3300046689 | Bacteria | 644 |
| 519 | Ga0495624_0139923 | 3300046690 | Bacteria | 1483 |
| 520 | Ga0495600_0209232 | 3300046809 | Unclassified | 1250 |
| 521 | Ga0495581_0081406 | 3300047315 | Bacteria | 1875 |
| 522 | Ga0495581_0589704 | 3300047315 | Unclassified | 644 |
| 523 | Ga0495604_0028136 | 3300047317 | Bacteria | 4471 |
| 524 | Ga0495604_0080692 | 3300047317 | Bacteria | 2437 |
| 525 | Ga0495604_0714486 | 3300047317 | Unclassified | 635 |
| 526 | Ga0495674_0002535 | 3300047319 | Bacteria | 17780 |
| 527 | Ga0495674_0125978 | 3300047319 | Bacteria | 2161 |
| 528 | Ga0495674_0317701 | 3300047319 | Unclassified | 1269 |
| 529 | Ga0495674_1315230 | 3300047319 | Bacteria | 542 |
| 530 | Ga0495676_0152483 | 3300047321 | Bacteria | 1643 |
| 531 | Ga0495676_0179234 | 3300047321 | Bacteria | 1486 |
| 532 | Ga0495680_0003018 | 3300047322 | Bacteria | 16782 |
| 533 | Ga0495680_0014698 | 3300047322 | Bacteria | 6771 |
| 534 | Ga0495675_0072523 | 3300047444 | Bacteria | 2172 |
| 535 | Ga0495675_0094319 | 3300047444 | Bacteria | 1877 |
| 536 | Ga0495684_0022030 | 3300047471 | Bacteria | 4905 |
| 537 | Ga0495684_0069106 | 3300047471 | Bacteria | 2686 |
| 538 | Ga0495602_0143996 | 3300048088 | Bacteria | 1883 |
| 539 | Ga0495602_0654349 | 3300048088 | Unclassified | 717 |
| 540 | Ga0495614_0175011 | 3300048089 | Unclassified | 964 |
| 541 | Ga0495614_0189011 | 3300048089 | Bacteria | 929 |
| 542 | Ga0496100_0002583 | 3300048903 | Bacteria | 9228 |
| 543 | Ga0496100_0007193 | 3300048903 | Bacteria | 6119 |
| 544 | Ga0496100_0024667 | 3300048903 | Bacteria | 3670 |
| 545 | Ga0496100_0844485 | 3300048903 | Bacteria | 718 |
| 546 | Ga0496101_0015758 | 3300048904 | Bacteria | 5102 |
| 547 | Ga0496101_0520057 | 3300048904 | Bacteria | 940 |
| 548 | Ga0496101_0636605 | 3300048904 | Bacteria | 843 |
| 549 | Ga0496102_0015958 | 3300048905 | Bacteria | 6554 |
| 550 | Ga0496102_1632359 | 3300048905 | Bacteria | 563 |
| 551 | Ga0496103_0059603 | 3300048906 | Bacteria | 2371 |
| 552 | Ga0496103_0291584 | 3300048906 | Bacteria | 1050 |
| 553 | Ga0496103_0872435 | 3300048906 | Unclassified | 565 |
| 554 | Ga0496104_0094487 | 3300048907 | Bacteria | 2860 |
| 555 | Ga0496104_0319448 | 3300048907 | Bacteria | 1466 |
| 556 | Ga0496104_0599968 | 3300048907 | Bacteria | 1011 |
| 557 | Ga0496105_0010119 | 3300048908 | Bacteria | 7407 |
| 558 | Ga0496105_0064922 | 3300048908 | Bacteria | 3013 |
| 559 | Ga0496105_0115754 | 3300048908 | Bacteria | 2211 |
| 560 | Ga0496105_0413277 | 3300048908 | Unclassified | 1069 |
| 561 | Ga0496106_0003840 | 3300048909 | Bacteria | 11198 |
| 562 | Ga0496106_0057339 | 3300048909 | Bacteria | 2945 |
| 563 | Ga0496106_0076867 | 3300048909 | Bacteria | 2559 |
| 564 | Ga0496106_0414337 | 3300048909 | Bacteria | 1083 |
| 565 | Ga0496107_0075625 | 3300048910 | Bacteria | 2451 |
| 566 | Ga0496107_0083347 | 3300048910 | Bacteria | 2331 |
| 567 | Ga0496108_0018646 | 3300048911 | Bacteria | 5685 |
| 568 | Ga0496108_0145561 | 3300048911 | Bacteria | 2043 |
| 569 | Ga0496108_0307637 | 3300048911 | Bacteria | 1381 |
| 570 | Ga0496109_0009360 | 3300048912 | Bacteria | 8345 |
| 571 | Ga0496109_0121941 | 3300048912 | Bacteria | 2429 |
| 572 | Ga0496109_0210334 | 3300048912 | Unclassified | 1829 |
| 573 | Ga0496110_0014097 | 3300048913 | Bacteria | 6627 |
| 574 | Ga0496110_0098225 | 3300048913 | Bacteria | 2624 |
| 575 | Ga0496111_0105960 | 3300048914 | Bacteria | 2069 |
| 576 | Ga0496111_0299188 | 3300048914 | Bacteria | 1193 |
| 577 | Ga0496112_0005066 | 3300048915 | Bacteria | 11320 |
| 578 | Ga0496112_0017202 | 3300048915 | Bacteria | 6790 |
| 579 | Ga0496112_0152931 | 3300048915 | Bacteria | 2275 |
| 580 | Ga0496112_0529094 | 3300048915 | Bacteria | 1113 |
| 581 | Ga0496112_0651878 | 3300048915 | Bacteria | 982 |
| 582 | Ga0496112_0784452 | 3300048915 | Bacteria | 878 |
| 583 | Ga0496112_1133866 | 3300048915 | Bacteria | 700 |
| 584 | Ga0496112_1232134 | 3300048915 | Bacteria | 665 |
| 585 | Ga0496113_0093246 | 3300048916 | Bacteria | 2324 |
| 586 | Ga0496113_0415219 | 3300048916 | Bacteria | 1081 |
| 587 | Ga0496114_0004883 | 3300048917 | Bacteria | 10442 |
| 588 | Ga0496114_0009539 | 3300048917 | Bacteria | 7702 |
| 589 | Ga0496114_0044252 | 3300048917 | Bacteria | 3693 |
| 590 | Ga0496114_0067169 | 3300048917 | Bacteria | 3007 |
| 591 | Ga0496114_0151326 | 3300048917 | Bacteria | 2013 |
| 592 | Ga0496114_0277444 | 3300048917 | Bacteria | 1477 |
| 593 | Ga0496115_0000502 | 3300048918 | Bacteria | 30706 |
| 594 | Ga0496115_0004828 | 3300048918 | Bacteria | 9781 |
| 595 | Ga0496115_0041672 | 3300048918 | Bacteria | 3655 |
| 596 | Ga0501040_0947778 | 3300049576 | Bacteria | 624 |
| 597 | Ga0501046_0160226 | 3300049580 | Bacteria | 1693 |
| 598 | Ga0501046_0796745 | 3300049580 | Bacteria | 662 |
| 599 | Ga0501047_0028478 | 3300049581 | Bacteria | 5387 |
| 600 | Ga0501047_0123190 | 3300049581 | Bacteria | 2473 |
| 601 | Ga0501047_1038734 | 3300049581 | Unclassified | 633 |
| 602 | Ga0501067_0056627 | 3300049583 | Bacteria | 2171 |
| 603 | Ga0501067_0737173 | 3300049583 | Bacteria | 554 |
| 604 | Ga0501069_0030135 | 3300049585 | Bacteria | 2979 |
| 605 | Ga0501069_0071824 | 3300049585 | Bacteria | 1940 |
| 606 | Ga0501069_0137158 | 3300049585 | Bacteria | 1402 |
| 607 | Ga0501069_0189144 | 3300049585 | Bacteria | 1191 |
| 608 | Ga0501069_0460132 | 3300049585 | Bacteria | 757 |
| 609 | Ga0501070_0000778 | 3300049586 | Bacteria | 28986 |
| 610 | Ga0501070_0055955 | 3300049586 | Bacteria | 3270 |
| 611 | Ga0501070_0187619 | 3300049586 | Bacteria | 1700 |
| 612 | Ga0501070_0362518 | 3300049586 | Bacteria | 1175 |
| 613 | Ga0501070_0685382 | 3300049586 | Unclassified | 811 |
| 614 | Ga0501070_0971941 | 3300049586 | Unclassified | 660 |
| 615 | Ga0501072_0516511 | 3300049588 | Bacteria | 944 |
| 616 | Ga0501073_0173055 | 3300049589 | Bacteria | 1495 |
| 617 | Ga0501074_0008039 | 3300049590 | Bacteria | 7640 |
| 618 | Ga0501074_0308035 | 3300049590 | Bacteria | 1125 |
| 619 | Ga0501074_0322846 | 3300049590 | Bacteria | 1096 |
| 620 | Ga0501074_0397900 | 3300049590 | Bacteria | 977 |
| 621 | Ga0501074_0404425 | 3300049590 | Bacteria | 968 |
| 622 | Ga0501074_0718120 | 3300049590 | Bacteria | 705 |
| 623 | Ga0501076_0517188 | 3300049592 | Bacteria | 984 |
| 624 | Ga0501077_0013315 | 3300049593 | Bacteria | 5159 |
| 625 | Ga0501080_0014693 | 3300049742 | Bacteria | 7209 |
| 626 | Ga0501080_0178555 | 3300049742 | Bacteria | 1955 |
| 627 | Ga0501035_0391537 | 3300049822 | Unclassified | 1157 |
| 628 | Ga0501044_0214896 | 3300049823 | Bacteria | 1876 |
| 629 | Ga0501044_0541028 | 3300049823 | Bacteria | 1063 |
| 630 | Ga0501044_0964801 | 3300049823 | Bacteria | 725 |
| 631 | Ga0501044_1069116 | 3300049823 | Unclassified | 677 |
| 632 | nmdc:mga0n895_290341_c1 | 3300050512 | Bacteria | 1658 |
| 633 | nmdc:mga0rr50_417492_c1 | 3300050513 | Unclassified | 1135 |
| 634 | nmdc:mga08x19_1043486_c1 | 3300050514 | Unclassified | 580 |
| 635 | nmdc:mga0a205_281819_c1 | 3300050515 | Bacteria | 1537 |
| 636 | Ga0495601_0016113 | 3300053077 | Bacteria | 4525 |
| 637 | Ga0495601_0100449 | 3300053077 | Bacteria | 1868 |
| 638 | Ga0495601_0751579 | 3300053077 | Bacteria | 620 |
| 639 | Ga0495612_0012442 | 3300053078 | Bacteria | 3431 |
| 640 | Ga0495612_0305215 | 3300053078 | Bacteria | 714 |
| 641 | Ga0495612_0336818 | 3300053078 | Bacteria | 680 |
| 642 | Ga0495595_0709353 | 3300053084 | Bacteria | 516 |
| 643 | Ga0495619_0017337 | 3300053085 | Bacteria | 4560 |
| 644 | Ga0495619_0102286 | 3300053085 | Bacteria | 1951 |
| 645 | Ga0495619_0986677 | 3300053085 | Unclassified | 564 |
| 646 | Ga0501084_0115029 | 3300054114 | Bacteria | 2261 |
| 647 | Ga0501084_1095206 | 3300054114 | Bacteria | 669 |
| 648 | Ga0501082_0026625 | 3300060353 | Bacteria | 4985 |
| 649 | Ga0466962_0000821 | 3300061719 | Bacteria | 13986 |
| 650 | Ga0466962_0748760 | 3300061719 | Bacteria | 503 |
| 651 | Ga0530510_0864256 | 3300061734 | Bacteria | 691 |
| 652 | Ga0530510_1107188 | 3300061734 | Bacteria | 607 |
| 653 | Ga0070658_10871400 | |||
| 654 | Ga0070658_10006107 | |||
| 655 | Ga0070658_10017974 | |||
| 656 | Ga0070658_10184961 | |||
| 657 | Ga0070658_10270584 | |||
| 658 | Ga0070658_10420184 | |||
| 659 | Ga0070683_100008124 | |||
| 660 | Ga0070683_100055400 | |||
| 661 | Ga0070683_100110874 | |||
| 662 | Ga0070683_100114814 | |||
| 663 | Ga0070683_100268256 | |||
| 664 | Ga0070683_100359514 | |||
| 665 | Ga0070680_100013010 | |||
| 666 | Ga0070680_100027281 | |||
| 667 | Ga0070680_100091075 | |||
| 668 | Ga0070680_100108550 | |||
| 669 | Ga0070680_100247269 | |||
| 670 | Ga0070682_100408465 | |||
| 671 | Ga0070660_100001013 | |||
| 672 | Ga0070660_100002820 | |||
| 673 | Ga0070660_100008500 | |||
| 674 | Ga0070660_100088167 | |||
| 675 | Ga0070660_100105399 | |||
| 676 | Ga0070660_100112109 | |||
| 677 | Ga0070660_100560298 | |||
| 678 | Ga0070660_100796608 | |||
| 679 | Ga0070661_100150615 | |||
| 680 | Ga0070661_100515375 | |||
| 681 | Ga0070661_100908584 | |||
| 682 | Ga0070661_101188406 | |||
| 683 | Ga0070673_101342150 | |||
| 684 | Ga0070659_100006516 | |||
| 685 | Ga0070659_100065520 | |||
| 686 | Ga0070659_100715631 | |||
| 687 | Ga0070667_100036363 | |||
| 688 | Ga0070709_10682064 | |||
| 689 | Ga0070714_100147741 | |||
| 690 | Ga0070714_100395085 | |||
| 691 | Ga0070713_100281127 | |||
| 692 | Ga0070713_100472744 | |||
| 693 | Ga0070713_100517840 | |||
| 694 | Ga0070713_101164615 | |||
| 695 | Ga0070710_10429857 | |||
| 696 | Ga0070711_100025738 | |||
| 697 | Ga0070711_100058001 | |||
| 698 | Ga0070711_100323411 | |||
| 699 | Ga0070711_101213233 | |||
| 700 | Ga0070694_100120755 | |||
| 701 | Ga0070678_102287801 | |||
| 702 | Ga0070681_10002617 | |||
| 703 | Ga0070681_10032792 | |||
| 704 | Ga0070681_10039487 | |||
| 705 | Ga0070681_10088652 | |||
| 706 | Ga0070681_10093114 | |||
| 707 | Ga0070681_10178595 | |||
| 708 | Ga0070681_10263252 | |||
| 709 | Ga0070707_100159349 | |||
| 710 | Ga0070707_101081754 | |||
| 711 | Ga0070707_101402839 | |||
| 712 | Ga0070707_101961383 | |||
| 713 | Ga0070698_101026151 | |||
| 714 | Ga0070679_100020443 | |||
| 715 | Ga0070679_100021560 | |||
| 716 | Ga0070679_100085444 | |||
| 717 | Ga0070679_100095383 | |||
| 718 | Ga0070679_100134663 | |||
| 719 | Ga0070679_100161058 | |||
| 720 | Ga0070679_100217523 | |||
| 721 | Ga0070679_100222542 | |||
| 722 | Ga0070679_100222914 | |||
| 723 | Ga0070684_100017441 | |||
| 724 | Ga0070684_100053861 | |||
| 725 | Ga0070684_100124584 | |||
| 726 | Ga0070684_100141482 | |||
| 727 | Ga0070684_100254685 | |||
| 728 | Ga0070684_100547629 | |||
| 729 | Ga0068853_100236195 | |||
| 730 | Ga0068853_100397945 | |||
| 731 | Ga0068853_100841818 | |||
| 732 | Ga0070686_100327699 | |||
| 733 | Ga0070696_100136587 | |||
| 734 | Ga0070693_100770247 | |||
| 735 | Ga0070665_100012181 | |||
| 736 | Ga0068855_100016381 | |||
| 737 | Ga0068855_100021285 | |||
| 738 | Ga0068855_100022565 | |||
| 739 | Ga0068855_100052921 | |||
| 740 | Ga0068855_100116389 | |||
| 741 | Ga0068855_100308371 | |||
| 742 | Ga0068855_100755363 | |||
| 743 | Ga0068855_101235334 | |||
| 744 | Ga0070664_101443254 | |||
| 745 | Ga0068857_100023096 | |||
| 746 | Ga0068856_100025719 | |||
| 747 | Ga0068856_100431228 | |||
| 748 | Ga0068856_100799995 | |||
| 749 | Ga0068852_100102984 | |||
| 750 | Ga0068852_100432569 | |||
| 751 | Ga0068864_101893204 | |||
| 752 | Ga0068866_10153918 | |||
| 753 | Ga0068851_10146473 | |||
| 754 | Ga0068851_10833077 | |||
| 755 | Ga0081455_10197006 | |||
| 756 | Ga0081539_10229088 | |||
| 757 | Ga0070717_10374000 | |||
| 758 | Ga0070716_100271237 | |||
| 759 | Ga0070712_100016784 | |||
| 760 | Ga0070712_101125465 | |||
| 761 | Ga0097621_100258783 | |||
| 762 | Ga0075428_101834311 | |||
| 763 | Ga0075434_100149481 | |||
| 764 | Ga0075434_100711491 | |||
| 765 | Ga0105240_10088634 | |||
| 766 | Ga0105240_10192097 | |||
| 767 | Ga0105240_10557858 | |||
| 768 | Ga0105240_10877237 | |||
| 769 | Ga0105240_10878507 | |||
| 770 | Ga0105240_11733408 | |||
| 771 | Ga0105245_10102311 | |||
| 772 | Ga0105245_10441208 | |||
| 773 | Ga0105245_11085794 | |||
| 774 | Ga0105245_11399191 | |||
| 775 | Ga0114129_11168972 | |||
| 776 | Ga0114129_12296975 | |||
| 777 | Ga0114129_12520257 | |||
| 778 | Ga0105243_10692202 | |||
| 779 | Ga0105243_11724020 | |||
| 780 | Ga0105243_12103760 | |||
| 781 | Ga0105241_11979045 | |||
| 782 | Ga0105242_10179751 | |||
| 783 | Ga0105237_10134773 | |||
| 784 | Ga0105237_12522486 | |||
| 785 | Ga0105238_10094540 | |||
| 786 | Ga0105238_10227561 | |||
| 787 | Ga0105238_10682024 | |||
| 788 | Ga0105238_11543092 | |||
| 789 | Ga0105239_10234677 | |||
| 790 | Ga0105239_10770088 | |||
| 791 | Ga0105239_11500081 | |||
| 792 | Ga0157373_10285481 | |||
| 793 | Ga0157373_10524971 | |||
| 794 | Ga0157373_10582584 | |||
| 795 | Ga0157371_10717758 | |||
| 796 | Ga0157370_10029872 | |||
| 797 | Ga0157370_10068741 | |||
| 798 | Ga0157370_10095157 | |||
| 799 | Ga0157370_10267561 | |||
| 800 | Ga0157370_10560591 | |||
| 801 | Ga0157370_10690660 | |||
| 802 | Ga0157369_10003269 | |||
| 803 | Ga0157369_10015282 | |||
| 804 | Ga0157369_10036906 | |||
| 805 | Ga0157369_10185486 | |||
| 806 | Ga0157369_10491432 | |||
| 807 | Ga0157369_10955072 | |||
| 808 | Ga0157369_11239689 | |||
| 809 | Ga0157369_11492890 | |||
| 810 | Ga0157369_11800245 | |||
| 811 | Ga0157374_10069091 | |||
| 812 | Ga0157374_10502691 | |||
| 813 | Ga0157374_11309931 | |||
| 814 | Ga0157374_11575590 | |||
| 815 | Ga0157378_10133693 | |||
| 816 | Ga0157372_10015716 | |||
| 817 | Ga0157372_10084579 | |||
| 818 | Ga0157372_10248703 | |||
| 819 | Ga0157372_10288472 | |||
| 820 | Ga0157372_10312612 | |||
| 821 | Ga0157372_10347247 | |||
| 822 | Ga0157372_11171796 | |||
| 823 | Ga0157375_10372213 | |||
| 824 | Ga0182008_10309959 | |||
| 825 | Ga0157377_10161190 | |||
| 826 | Ga0157376_10257903 | |||
| 827 | Ga0197907_10850878 | |||
| 828 | Ga0197907_11243580 | |||
| 829 | Ga0197907_11426289 | |||
| 830 | Ga0206356_10015725 | |||
| 831 | Ga0206356_10221768 | |||
| 832 | Ga0206356_10791098 | |||
| 833 | Ga0206356_11699449 | |||
| 834 | Ga0206355_1622731 | |||
| 835 | Ga0206354_10622774 | |||
| 836 | Ga0206354_10939136 | |||
| 837 | Ga0206354_11330100 | |||
| 838 | Ga0206354_11683482 | |||
| 839 | Ga0206353_10708607 | |||
| 840 | Ga0206353_10737399 | |||
| 841 | Ga0206353_10751377 | |||
| 842 | Ga0206353_10758017 | |||
| 843 | Ga0206353_11474681 | |||
| 844 | Ga0206353_11668888 | |||
| 845 | Ga0206353_11790786 | |||
| 846 | Ga0213874_10045343 | |||
| 847 | Ga0213876_10104569 | |||
| 848 | Ga0213871_10219483 | |||
| 849 | Ga0224712_10016744 | |||
| 850 | Ga0224712_10171929 | |||
| 851 | Ga0224712_10259679 | |||
| 852 | Ga0207656_10041145 | |||
| 853 | Ga0207692_10418616 | |||
| 854 | Ga0207647_10172250 | |||
| 855 | Ga0207699_10120386 | |||
| 856 | Ga0207699_10338223 | |||
| 857 | Ga0207705_10012754 | |||
| 858 | Ga0207705_10034963 | |||
| 859 | Ga0207705_10118648 | |||
| 860 | Ga0207705_10198690 | |||
| 861 | Ga0207705_11134865 | |||
| 862 | Ga0207684_11002457 | |||
| 863 | Ga0207707_10020628 | |||
| 864 | Ga0207707_10063455 | |||
| 865 | Ga0207707_10086756 | |||
| 866 | Ga0207707_10239648 | |||
| 867 | Ga0207707_11168478 | |||
| 868 | Ga0207707_11422586 | |||
| 869 | Ga0207695_10333547 | |||
| 870 | Ga0207695_10585873 | |||
| 871 | Ga0207695_10616930 | |||
| 872 | Ga0207695_10908721 | |||
| 873 | Ga0207695_11190912 | |||
| 874 | Ga0207671_10056502 | |||
| 875 | Ga0207693_10046613 | |||
| 876 | Ga0207693_10047203 | |||
| 877 | Ga0207693_10101076 | |||
| 878 | Ga0207663_10023891 | |||
| 879 | Ga0207663_10105674 | |||
| 880 | Ga0207663_10258731 | |||
| 881 | Ga0207663_10843682 | |||
| 882 | Ga0207663_11211813 | |||
| 883 | Ga0207660_10021015 | |||
| 884 | Ga0207660_10063167 | |||
| 885 | Ga0207660_10129490 | |||
| 886 | Ga0207660_10238799 | |||
| 887 | Ga0207657_10000456 | |||
| 888 | Ga0207657_10002422 | |||
| 889 | Ga0207657_10007240 | |||
| 890 | Ga0207657_10040931 | |||
| 891 | Ga0207657_10128438 | |||
| 892 | Ga0207657_10177524 | |||
| 893 | Ga0207657_10231286 | |||
| 894 | Ga0207657_10676447 | |||
| 895 | Ga0207657_10893545 | |||
| 896 | Ga0207657_11292243 | |||
| 897 | Ga0207649_10065721 | |||
| 898 | Ga0207649_10155963 | |||
| 899 | Ga0207649_10202498 | |||
| 900 | Ga0207649_10329828 | |||
| 901 | Ga0207652_10045483 | |||
| 902 | Ga0207652_10049366 | |||
| 903 | Ga0207652_10069911 | |||
| 904 | Ga0207652_10078462 | |||
| 905 | Ga0207652_10143937 | |||
| 906 | Ga0207652_10184794 | |||
| 907 | Ga0207652_10259199 | |||
| 908 | Ga0207652_10296054 | |||
| 909 | Ga0207652_10457399 | |||
| 910 | Ga0207652_10675008 | |||
| 911 | Ga0207646_10181418 | |||
| 912 | Ga0207646_10219411 | |||
| 913 | Ga0207646_10944381 | |||
| 914 | Ga0207646_11113437 | |||
| 915 | Ga0207694_10084550 | |||
| 916 | Ga0207694_10118222 | |||
| 917 | Ga0207687_10102093 | |||
| 918 | Ga0207687_10303629 | |||
| 919 | Ga0207687_10308451 | |||
| 920 | Ga0207687_10445436 | |||
| 921 | Ga0207700_10090774 | |||
| 922 | Ga0207700_10404401 | |||
| 923 | Ga0207700_10564857 | |||
| 924 | Ga0207700_10752253 | |||
| 925 | Ga0207700_10985172 | |||
| 926 | Ga0207644_10319058 | |||
| 927 | Ga0207644_11521720 | |||
| 928 | Ga0207690_10039673 | |||
| 929 | Ga0207690_10631790 | |||
| 930 | Ga0207709_10556514 | |||
| 931 | Ga0207665_10210908 | |||
| 932 | Ga0207665_10355028 | |||
| 933 | Ga0207665_11092828 | |||
| 934 | Ga0207661_10063785 | |||
| 935 | Ga0207661_10114240 | |||
| 936 | Ga0207661_10135308 | |||
| 937 | Ga0207661_10287324 | |||
| 938 | Ga0207661_10323183 | |||
| 939 | Ga0207679_10858863 | |||
| 940 | Ga0207667_10047752 | |||
| 941 | Ga0207667_10063050 | |||
| 942 | Ga0207667_10080779 | |||
| 943 | Ga0207667_10403825 | |||
| 944 | Ga0207667_10790148 | |||
| 945 | Ga0207640_10415239 | |||
| 946 | Ga0207640_11266877 | |||
| 947 | Ga0207658_10037355 | |||
| 948 | Ga0207639_10183890 | |||
| 949 | Ga0207639_10722320 | |||
| 950 | Ga0207639_11344114 | |||
| 951 | Ga0207678_10238026 | |||
| 952 | Ga0207702_10036781 | |||
| 953 | Ga0207702_10147959 | |||
| 954 | Ga0207702_10351656 | |||
| 955 | Ga0207674_10029100 | |||
| 956 | Ga0207674_10101752 | |||
| 957 | Ga0207698_10108156 | |||
| 958 | Ga0207698_11523008 | |||
| 959 | Ga0268266_10032791 | |||
| 960 | Ga0268266_12049864 | |||
| 961 | Ga0265334_10028405 | |||
| 962 | Ga0265318_10007409 | |||
| 963 | Ga0265318_10061662 | |||
| 964 | Ga0265322_10006899 | |||
| 965 | Ga0265338_10003937 | |||
| 966 | Ga0265338_10346892 | |||
| 967 | Ga0265338_10637656 | |||
| 968 | Ga0265330_10029920 | |||
| 969 | Ga0265332_10059603 | |||
| 970 | Ga0265328_10104157 | |||
| 971 | Ga0265320_10176918 | |||
| 972 | Ga0265325_10007416 | |||
| 973 | Ga0265329_10030344 | |||
| 974 | Ga0265339_10017919 | |||
| 975 | Ga0265331_10074165 | |||
| 976 | Ga0265327_10017126 | |||
| 977 | Ga0265316_10011587 | |||
| 978 | Ga0265316_10201953 | |||
| 979 | Ga0265313_10003112 | |||
| 980 | Ga0265313_10069648 | |||
| 981 | Ga0265314_10005428 | |||
| 982 | Ga0265314_10056180 | |||
| 983 | Ga0265314_10368547 | |||
| 984 | Ga0265342_10122652 | |||
| 985 | Ga0307412_10165139 | |||
| 986 | Ga0307415_100154354 | |||
| 987 | Ga0373944_0030739 | |||
| 988 | Ga0373936_0042232 | |||
| 989 | Ga0373945_0016020 | |||
| 990 | Ga0373957_0270722 | |||
| 991 | Ga0373943_0081023 | |||
| 992 | Ga0373943_0484744 | |||
| 993 | Ga0373946_0028507 | |||
| 994 | Ga0373946_0370884 | |||
| 995 | Ga0373955_0008476 | |||
| 996 | Ga0373955_0563478 | |||
| 997 | Ga0373935_0099605 | |||
| 998 | Ga0373947_0005521 | |||
| 999 | Ga0373947_0942608 | |||
| 1000 | Ga0373937_0872885 | |||
| 1001 | Ga0373925_0021948 | |||
| 1002 | Ga0373925_0823962 | |||
| 1003 | Ga0395899_0077051 | |||
| 1004 | Ga0395899_0130188 | |||
| 1005 | Ga0395899_0233445 | |||
| 1006 | Ga0395899_0385786 | |||
| 1007 | Ga0395899_0394753 | |||
| 1008 | Ga0395900_0056281 | |||
| 1009 | Ga0395900_0072273 | |||
| 1010 | Ga0395900_0092996 | |||
| 1011 | Ga0395900_0135159 | |||
| 1012 | Ga0395900_0160907 | |||
| 1013 | Ga0395900_0163384 | |||
| 1014 | Ga0395900_0247582 | |||
| 1015 | Ga0395900_0570115 | |||
| 1016 | Ga0395900_0993867 | |||
| 1017 | Ga0395900_1153200 | |||
| 1018 | Ga0395900_1867359 | |||
| 1019 | Ga0395898_0008189 | |||
| 1020 | Ga0395898_0017657 | |||
| 1021 | Ga0395898_0046665 | |||
| 1022 | Ga0395898_0059706 | |||
| 1023 | Ga0395898_0061887 | |||
| 1024 | Ga0395898_0315267 | |||
| 1025 | Ga0395898_0337588 | |||
| 1026 | Ga0395898_0874526 | |||
| 1027 | Ga0395898_1206813 | |||
| 1028 | Ga0395905_0070735 | |||
| 1029 | Ga0395905_0529155 | |||
| 1030 | Ga0395905_0841783 | |||
| 1031 | Ga0395905_0975081 | |||
| 1032 | Ga0395905_1877046 | |||
| 1033 | Ga0436364_0555216 | |||
| 1034 | Ga0436364_1355776 | |||
| 1035 | Ga0395901_0011941 | |||
| 1036 | Ga0395901_0014495 | |||
| 1037 | Ga0395901_0016076 | |||
| 1038 | Ga0395901_0016426 | |||
| 1039 | Ga0395901_0135823 | |||
| 1040 | Ga0395901_0747573 | |||
| 1041 | Ga0395901_0913927 | |||
| 1042 | Ga0395901_1383612 | |||
| 1043 | Ga0436365_0347346 | |||
| 1044 | Ga0436365_0489553 | |||
| 1045 | Ga0436365_0970424 | |||
| 1046 | Ga0436365_1103566 | |||
| 1047 | Ga0436365_1425538 | |||
| 1048 | Ga0436360_0584751 | |||
| 1049 | Ga0436363_1016123 | |||
| 1050 | Ga0439453_0048825 | |||
| 1051 | Ga0451793_0603161 | |||
| 1052 | Ga0466969_0041941 | |||
| 1053 | Ga0466969_0281626 | |||
| 1054 | Ga0466965_0073128 | |||
| 1055 | Ga0466965_0166871 | |||
| 1056 | Ga0466966_0007650 | |||
| 1057 | Ga0466966_0020994 | |||
| 1058 | Ga0466966_0093422 | |||
| 1059 | Ga0466966_0527814 | |||
| 1060 | Ga0466961_0007494 | |||
| 1061 | Ga0466961_0010770 | |||
| 1062 | Ga0466961_0046781 | |||
| 1063 | Ga0466961_0232855 | |||
| 1064 | Ga0466961_0414656 | |||
| 1065 | Ga0466963_0007242 | |||
| 1066 | Ga0466963_0027801 | |||
| 1067 | Ga0466963_0106724 | |||
| 1068 | Ga0466963_0241505 | |||
| 1069 | Ga0466963_0276197 | |||
| 1070 | Ga0466963_0319921 | |||
| 1071 | Ga0466963_0522678 | |||
| 1072 | Ga0466964_0006942 | |||
| 1073 | Ga0466964_0032444 | |||
| 1074 | Ga0466964_0101443 | |||
| 1075 | Ga0466964_0109269 | |||
| 1076 | Ga0466971_0000454 | |||
| 1077 | Ga0466971_0120700 | |||
| 1078 | Ga0466971_0201023 | |||
| 1079 | Ga0466968_0050204 | |||
| 1080 | Ga0466968_0216765 | |||
| 1081 | Ga0466968_0237635 | |||
| 1082 | Ga0466968_0389305 | |||
| 1083 | Ga0466957_0002470 | |||
| 1084 | Ga0466957_0021207 | |||
| 1085 | Ga0466957_0389155 | |||
| 1086 | Ga0466957_0498459 | |||
| 1087 | Ga0466960_0153436 | |||
| 1088 | Ga0466960_0936076 | |||
| 1089 | Ga0466959_0034468 | |||
| 1090 | Ga0466959_0046254 | |||
| 1091 | Ga0466959_0047916 | |||
| 1092 | Ga0466959_0133970 | |||
| 1093 | Ga0466959_0295830 | |||
| 1094 | Ga0466959_0855055 | |||
| 1095 | Ga0466959_0977713 | |||
| 1096 | Ga0451576_0214543 | |||
| 1097 | Ga0466958_0000899 | |||
| 1098 | Ga0466958_0008540 | |||
| 1099 | Ga0466958_0215054 | |||
| 1100 | Ga0466958_0587377 | |||
| 1101 | Ga0466967_0055859 | |||
| 1102 | Ga0466967_0072855 | |||
| 1103 | Ga0466967_0083305 | |||
| 1104 | Ga0466967_0086980 | |||
| 1105 | Ga0466967_0175226 | |||
| 1106 | Ga0466967_0222616 | |||
| 1107 | Ga0466967_0264740 | |||
| 1108 | Ga0466967_0372671 | |||
| 1109 | Ga0466967_0425663 | |||
| 1110 | Ga0466967_0430547 | |||
| 1111 | Ga0466967_0433158 | |||
| 1112 | Ga0466967_0532055 | |||
| 1113 | Ga0466967_0574310 | |||
| 1114 | Ga0466967_0772411 | |||
| 1115 | Ga0466967_0839782 | |||
| 1116 | Ga0466967_0969510 | |||
| 1117 | Ga0466967_1116881 | |||
| 1118 | Ga0466967_1737771 | |||
| 1119 | Ga0495592_0042082 | |||
| 1120 | Ga0495592_0149009 | |||
| 1121 | Ga0495603_0349887 | |||
| 1122 | Ga0495641_0143588 | |||
| 1123 | Ga0495641_0149590 | |||
| 1124 | Ga0495651_0002815 | |||
| 1125 | Ga0495651_0026482 | |||
| 1126 | Ga0495651_0062008 | |||
| 1127 | Ga0495651_0584393 | |||
| 1128 | Ga0495653_0871195 | |||
| 1129 | Ga0495664_0015976 | |||
| 1130 | Ga0495664_0142288 | |||
| 1131 | Ga0495594_0450891 | |||
| 1132 | Ga0495608_0010024 | |||
| 1133 | Ga0495608_0042379 | |||
| 1134 | Ga0495608_0044940 | |||
| 1135 | Ga0495608_0547133 | |||
| 1136 | Ga0495628_0117287 | |||
| 1137 | Ga0495628_0490667 | |||
| 1138 | Ga0495630_0011359 | |||
| 1139 | Ga0495630_0156066 | |||
| 1140 | Ga0495630_0622039 | |||
| 1141 | Ga0495630_0780772 | |||
| 1142 | Ga0495666_0042500 | |||
| 1143 | Ga0495652_0019938 | |||
| 1144 | Ga0495652_0093932 | |||
| 1145 | Ga0495652_0232152 | |||
| 1146 | Ga0495652_0317246 | |||
| 1147 | Ga0495652_0905753 | |||
| 1148 | Ga0495640_0014634 | |||
| 1149 | Ga0495640_0071099 | |||
| 1150 | Ga0495640_0800075 | |||
| 1151 | Ga0495586_0216044 | |||
| 1152 | Ga0495587_0005481 | |||
| 1153 | Ga0495587_0025911 | |||
| 1154 | Ga0495587_0033272 | |||
| 1155 | Ga0495645_0010768 | |||
| 1156 | Ga0495645_0162440 | |||
| 1157 | Ga0495667_0003543 | |||
| 1158 | Ga0495667_0011409 | |||
| 1159 | Ga0495656_0657371 | |||
| 1160 | Ga0495634_0567676 | |||
| 1161 | Ga0495634_0745838 | |||
| 1162 | Ga0495657_0017020 | |||
| 1163 | Ga0495599_0047205 | |||
| 1164 | Ga0495599_0139940 | |||
| 1165 | Ga0495623_0080150 | |||
| 1166 | Ga0495646_0571309 | |||
| 1167 | Ga0495658_0005327 | |||
| 1168 | Ga0495658_0273411 | |||
| 1169 | Ga0495613_0578554 | |||
| 1170 | Ga0495613_0741349 | |||
| 1171 | Ga0495624_0139923 | |||
| 1172 | Ga0495600_0209232 | |||
| 1173 | Ga0495581_0081406 | |||
| 1174 | Ga0495581_0589704 | |||
| 1175 | Ga0495604_0028136 | |||
| 1176 | Ga0495604_0080692 | |||
| 1177 | Ga0495604_0714486 | |||
| 1178 | Ga0495674_0002535 | |||
| 1179 | Ga0495674_0125978 | |||
| 1180 | Ga0495674_0317701 | |||
| 1181 | Ga0495674_1315230 | |||
| 1182 | Ga0495676_0152483 | |||
| 1183 | Ga0495676_0179234 | |||
| 1184 | Ga0495680_0003018 | |||
| 1185 | Ga0495680_0014698 | |||
| 1186 | Ga0495675_0072523 | |||
| 1187 | Ga0495675_0094319 | |||
| 1188 | Ga0495684_0022030 | |||
| 1189 | Ga0495684_0069106 | |||
| 1190 | Ga0495602_0143996 | |||
| 1191 | Ga0495602_0654349 | |||
| 1192 | Ga0495614_0175011 | |||
| 1193 | Ga0495614_0189011 | |||
| 1194 | Ga0496100_0002583 | |||
| 1195 | Ga0496100_0007193 | |||
| 1196 | Ga0496100_0024667 | |||
| 1197 | Ga0496100_0844485 | |||
| 1198 | Ga0496101_0015758 | |||
| 1199 | Ga0496101_0520057 | |||
| 1200 | Ga0496101_0636605 | |||
| 1201 | Ga0496102_0015958 | |||
| 1202 | Ga0496102_1632359 | |||
| 1203 | Ga0496103_0059603 | |||
| 1204 | Ga0496103_0291584 | |||
| 1205 | Ga0496103_0872435 | |||
| 1206 | Ga0496104_0094487 | |||
| 1207 | Ga0496104_0319448 | |||
| 1208 | Ga0496104_0599968 | |||
| 1209 | Ga0496105_0010119 | |||
| 1210 | Ga0496105_0064922 | |||
| 1211 | Ga0496105_0115754 | |||
| 1212 | Ga0496105_0413277 | |||
| 1213 | Ga0496106_0003840 | |||
| 1214 | Ga0496106_0057339 | |||
| 1215 | Ga0496106_0076867 | |||
| 1216 | Ga0496106_0414337 | |||
| 1217 | Ga0496107_0075625 | |||
| 1218 | Ga0496107_0083347 | |||
| 1219 | Ga0496108_0018646 | |||
| 1220 | Ga0496108_0145561 | |||
| 1221 | Ga0496108_0307637 | |||
| 1222 | Ga0496109_0009360 | |||
| 1223 | Ga0496109_0121941 | |||
| 1224 | Ga0496109_0210334 | |||
| 1225 | Ga0496110_0014097 | |||
| 1226 | Ga0496110_0098225 | |||
| 1227 | Ga0496111_0105960 | |||
| 1228 | Ga0496111_0299188 | |||
| 1229 | Ga0496112_0005066 | |||
| 1230 | Ga0496112_0017202 | |||
| 1231 | Ga0496112_0152931 | |||
| 1232 | Ga0496112_0529094 | |||
| 1233 | Ga0496112_0651878 | |||
| 1234 | Ga0496112_0784452 | |||
| 1235 | Ga0496112_1133866 | |||
| 1236 | Ga0496112_1232134 | |||
| 1237 | Ga0496113_0093246 | |||
| 1238 | Ga0496113_0415219 | |||
| 1239 | Ga0496114_0004883 | |||
| 1240 | Ga0496114_0009539 | |||
| 1241 | Ga0496114_0044252 | |||
| 1242 | Ga0496114_0067169 | |||
| 1243 | Ga0496114_0151326 | |||
| 1244 | Ga0496114_0277444 | |||
| 1245 | Ga0496115_0000502 | |||
| 1246 | Ga0496115_0004828 | |||
| 1247 | Ga0496115_0041672 | |||
| 1248 | Ga0501040_0947778 | |||
| 1249 | Ga0501046_0160226 | |||
| 1250 | Ga0501046_0796745 | |||
| 1251 | Ga0501047_0028478 | |||
| 1252 | Ga0501047_0123190 | |||
| 1253 | Ga0501047_1038734 | |||
| 1254 | Ga0501067_0056627 | |||
| 1255 | Ga0501067_0737173 | |||
| 1256 | Ga0501069_0030135 | |||
| 1257 | Ga0501069_0071824 | |||
| 1258 | Ga0501069_0137158 | |||
| 1259 | Ga0501069_0189144 | |||
| 1260 | Ga0501069_0460132 | |||
| 1261 | Ga0501070_0000778 | |||
| 1262 | Ga0501070_0055955 | |||
| 1263 | Ga0501070_0187619 | |||
| 1264 | Ga0501070_0362518 | |||
| 1265 | Ga0501070_0685382 | |||
| 1266 | Ga0501070_0971941 | |||
| 1267 | Ga0501072_0516511 | |||
| 1268 | Ga0501073_0173055 | |||
| 1269 | Ga0501074_0008039 | |||
| 1270 | Ga0501074_0308035 | |||
| 1271 | Ga0501074_0322846 | |||
| 1272 | Ga0501074_0397900 | |||
| 1273 | Ga0501074_0404425 | |||
| 1274 | Ga0501074_0718120 | |||
| 1275 | Ga0501076_0517188 | |||
| 1276 | Ga0501077_0013315 | |||
| 1277 | Ga0501080_0014693 | |||
| 1278 | Ga0501080_0178555 | |||
| 1279 | Ga0501035_0391537 | |||
| 1280 | Ga0501044_0214896 | |||
| 1281 | Ga0501044_0541028 | |||
| 1282 | Ga0501044_0964801 | |||
| 1283 | Ga0501044_1069116 | |||
| 1284 | nmdc:mga0n895_290341_c1 | |||
| 1285 | nmdc:mga0rr50_417492_c1 | |||
| 1286 | nmdc:mga08x19_1043486_c1 | |||
| 1287 | nmdc:mga0a205_281819_c1 | |||
| 1288 | Ga0495601_0016113 | |||
| 1289 | Ga0495601_0100449 | |||
| 1290 | Ga0495601_0751579 | |||
| 1291 | Ga0495612_0012442 | |||
| 1292 | Ga0495612_0305215 | |||
| 1293 | Ga0495612_0336818 | |||
| 1294 | Ga0495595_0709353 | |||
| 1295 | Ga0495619_0017337 | |||
| 1296 | Ga0495619_0102286 | |||
| 1297 | Ga0495619_0986677 | |||
| 1298 | Ga0501084_0115029 | |||
| 1299 | Ga0501084_1095206 | |||
| 1300 | Ga0501082_0026625 | |||
| 1301 | Ga0466962_0000821 | |||
| 1302 | Ga0466962_0748760 | |||
| 1303 | Ga0530510_0864256 | |||
| 1304 | Ga0530510_1107188 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2kks-assembly1.cif.gz_A | solution structure of protein dsy2949 from desulfitobacterium hafniense. northeast structural genomics consortium target dhr27 | 0.815 | 2 | 123 |
| 5ld9-assembly1.cif.gz_A | structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. | 0.8118 | 1 | 123 |
| 5ld9-assembly1.cif.gz_B | structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. | 0.8087 | 1 | 123 |
| 5ld9-assembly1.cif.gz_A | structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. | 0.8059 | 1 | 123 |
| 2kks-assembly1.cif.gz_A | solution structure of protein dsy2949 from desulfitobacterium hafniense. northeast structural genomics consortium target dhr27 | 0.8031 | 2 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHS1_10_146_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8398 | 2 | 123 | 3.40.140.10 |
| af_P9WHS1_10_146_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8275 | 2 | 123 | 3.40.140.10 |
| 2kksA00 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.815 | 2 | 123 | 3.40.140.10 |
| 2kksA00 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8031 | 2 | 123 | 3.40.140.10 |
| af_K7K687_37_183_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.7793 | 2 | 113 | 3.40.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I3BST9-F1-model_v4 | JAB domain-containing protein | 0.9708 | 1 | 122 |
GO:0006508
GO:0008235 GO:0008270 |
| AF-A0A1Q6XH45-F1-model_v4 | JAB domain-containing protein | 0.9703 | 1 | 123 |
GO:0006508
GO:0008235 GO:0008270 |
| AF-A0A538KZH5-F1-model_v4 | M67 family metallopeptidase | 0.968 | 1 | 123 |
GO:0006508
GO:0008235 GO:0008270 |
| AF-A0A7W0UQF9-F1-model_v4 | Mov34/MPN/PAD-1 family protein | 0.9673 | 1 | 107 |
GO:0006508
GO:0008235 GO:0008270 |
| AF-A0A7W0ZG26-F1-model_v4 | JAB domain-containing protein | 0.9647 | 59 | 123 |
|