F472538
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 650 | 320 | 650 | 333 |
Family's Representative Sequence
| Representative Sequence | 3300041512|Ga0451853_4000083|Ga0451853_4000083_479_1540 |
| Length | 329 |
| Sequence | MTTMPADAGIEGRDVAVPAPDRNLALDLVRVTEAAAMAAGRWVGRGEKNGADQAAVDAMRAMIGTLPIDGTVIIGEGEKDAAPMLYNGERVGDGSGPACDVAVRGSMFDPSAVFYMDKLVTGPAAADAVDIRAPVLDNVRAVAKAKDCAVEDITVCILERPRHKELAEQVRRAGARIKFISDGDVAGAIAAARDNTGVDLLLGIGGTPEGIIAACAIKCLGGVLQGRLWPRDDTERRLALEAGHDLDQVLTVEDLIASEDAFFVATGITDGELLRGVRYGPERAATESLVMRARSGTVRFMHSEHRLDRLGAYSAVDYRQHEGSAEDPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 56 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 95 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 96 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 152 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 153 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 154 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 156 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 159 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 160 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 161 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 164 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 167 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 172 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 176 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 181 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 184 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 185 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 187 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 188 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 189 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 190 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 191 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 192 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 193 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 194 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 195 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 196 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 197 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 198 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 256 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 259 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 260 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 265 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 266 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 267 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 268 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 269 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 270 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 271 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 272 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 273 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 274 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 275 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 276 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 277 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 314 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 315 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 316 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 317 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 318 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.38 |
| Metatranscriptomes | 0.62 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.92 |
| Nodule | 0 |
| Rhizoplane | 10.62 |
| Rhizosphere | 83.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1003811 | 3300000549 | Bacteria | 1996 |
| 2 | JGI24746J21847_1000347 | 3300001977 | Bacteria | 6689 |
| 3 | JGI24740J21852_10000416 | 3300001979 | Bacteria | 18213 |
| 4 | JGI24034J26672_10000247 | 3300002239 | Bacteria | 7101 |
| 5 | JGI24742J22300_10005798 | 3300002244 | Bacteria | 2033 |
| 6 | Ga0070683_100002179 | 3300005329 | Bacteria | 15491 |
| 7 | Ga0070683_100024848 | 3300005329 | Bacteria | 5372 |
| 8 | Ga0070683_100032004 | 3300005329 | Bacteria | 4786 |
| 9 | Ga0070683_100037511 | 3300005329 | Bacteria | 4437 |
| 10 | Ga0070677_10000001 | 3300005333 | Bacteria | 118426 |
| 11 | Ga0070666_10029130 | 3300005335 | Bacteria | 3628 |
| 12 | Ga0070680_100002015 | 3300005336 | Bacteria | 14970 |
| 13 | Ga0070682_100000028 | 3300005337 | Bacteria | 185177 |
| 14 | Ga0070682_100000080 | 3300005337 | Bacteria | 85683 |
| 15 | Ga0070682_100072821 | 3300005337 | Bacteria | 2203 |
| 16 | Ga0068868_100000508 | 3300005338 | Bacteria | 25991 |
| 17 | Ga0068868_100001902 | 3300005338 | Bacteria | 14340 |
| 18 | Ga0070660_100054293 | 3300005339 | Bacteria | 3094 |
| 19 | Ga0070660_100070178 | 3300005339 | Bacteria | 2734 |
| 20 | Ga0070689_100058975 | 3300005340 | Bacteria | 2982 |
| 21 | Ga0070689_100136377 | 3300005340 | Bacteria | 1971 |
| 22 | Ga0070691_10000054 | 3300005341 | Bacteria | 32149 |
| 23 | Ga0070691_10003684 | 3300005341 | Bacteria | 6922 |
| 24 | Ga0070687_100014608 | 3300005343 | Bacteria | 3531 |
| 25 | Ga0070661_100060369 | 3300005344 | Bacteria | 2783 |
| 26 | Ga0070675_100000192 | 3300005354 | Bacteria | 38351 |
| 27 | Ga0070674_100000025 | 3300005356 | Bacteria | 78679 |
| 28 | Ga0070674_100000072 | 3300005356 | Bacteria | 46741 |
| 29 | Ga0070674_100048655 | 3300005356 | Bacteria | 2911 |
| 30 | Ga0070673_100026099 | 3300005364 | Bacteria | 4309 |
| 31 | Ga0070688_100000012 | 3300005365 | Bacteria | 79406 |
| 32 | Ga0070659_100005685 | 3300005366 | Bacteria | 8971 |
| 33 | Ga0070659_100010273 | 3300005366 | Bacteria | 6886 |
| 34 | Ga0070659_100024609 | 3300005366 | Bacteria | 4616 |
| 35 | Ga0070713_100000933 | 3300005436 | Bacteria | 18678 |
| 36 | Ga0070700_100073273 | 3300005441 | Bacteria | 2192 |
| 37 | Ga0070678_100010186 | 3300005456 | Bacteria | 5730 |
| 38 | Ga0070662_100000007 | 3300005457 | Bacteria | 168761 |
| 39 | Ga0070662_100186049 | 3300005457 | Bacteria | 1640 |
| 40 | Ga0070681_10003446 | 3300005458 | Bacteria | 14812 |
| 41 | Ga0070681_10006943 | 3300005458 | Bacteria | 11021 |
| 42 | Ga0070681_10119236 | 3300005458 | Bacteria | 2575 |
| 43 | Ga0070685_10000018 | 3300005466 | Bacteria | 110132 |
| 44 | Ga0070685_10004378 | 3300005466 | Bacteria | 7129 |
| 45 | Ga0070679_100001155 | 3300005530 | Bacteria | 23125 |
| 46 | Ga0070679_100003123 | 3300005530 | Bacteria | 15146 |
| 47 | Ga0070679_100005368 | 3300005530 | Bacteria | 11864 |
| 48 | Ga0070679_100065841 | 3300005530 | Bacteria | 3611 |
| 49 | Ga0070684_100007381 | 3300005535 | Bacteria | 8548 |
| 50 | Ga0070684_100013372 | 3300005535 | Bacteria | 6615 |
| 51 | Ga0070684_100037690 | 3300005535 | Bacteria | 4149 |
| 52 | Ga0070684_100038974 | 3300005535 | Bacteria | 4086 |
| 53 | Ga0070684_100066635 | 3300005535 | Bacteria | 3161 |
| 54 | Ga0070684_100087546 | 3300005535 | Bacteria | 2766 |
| 55 | Ga0070684_100434378 | 3300005535 | Bacteria | 1213 |
| 56 | Ga0068853_100042227 | 3300005539 | Bacteria | 3898 |
| 57 | Ga0068853_100183188 | 3300005539 | Bacteria | 1900 |
| 58 | Ga0070672_100000004 | 3300005543 | Bacteria | 129970 |
| 59 | Ga0070695_100083214 | 3300005545 | Bacteria | 2120 |
| 60 | Ga0070693_100012538 | 3300005547 | Bacteria | 4291 |
| 61 | Ga0070665_100000202 | 3300005548 | Bacteria | 104773 |
| 62 | Ga0070665_100005634 | 3300005548 | Bacteria | 12874 |
| 63 | Ga0070665_100077446 | 3300005548 | Bacteria | 3332 |
| 64 | Ga0070665_100119390 | 3300005548 | Bacteria | 2639 |
| 65 | Ga0068855_100194342 | 3300005563 | Bacteria | 2287 |
| 66 | Ga0070664_100042743 | 3300005564 | Bacteria | 3825 |
| 67 | Ga0070664_100128393 | 3300005564 | Bacteria | 2225 |
| 68 | Ga0068854_100001007 | 3300005578 | Bacteria | 16940 |
| 69 | Ga0068854_100168562 | 3300005578 | Bacteria | 1702 |
| 70 | Ga0068856_100002319 | 3300005614 | Bacteria | 19601 |
| 71 | Ga0068856_100073970 | 3300005614 | Bacteria | 3373 |
| 72 | Ga0068856_100115439 | 3300005614 | Bacteria | 2684 |
| 73 | Ga0068856_100118457 | 3300005614 | Bacteria | 2649 |
| 74 | Ga0070702_100065930 | 3300005615 | Bacteria | 2122 |
| 75 | Ga0070702_100118625 | 3300005615 | Bacteria | 1653 |
| 76 | Ga0070702_100134770 | 3300005615 | Bacteria | 1565 |
| 77 | Ga0068852_100000012 | 3300005616 | Bacteria | 140734 |
| 78 | Ga0068852_100083820 | 3300005616 | Bacteria | 2835 |
| 79 | Ga0068859_100094199 | 3300005617 | Bacteria | 3047 |
| 80 | Ga0068859_100302192 | 3300005617 | Bacteria | 1694 |
| 81 | Ga0068864_100000024 | 3300005618 | Bacteria | 252632 |
| 82 | Ga0068866_10000001 | 3300005718 | Bacteria | 519680 |
| 83 | Ga0068866_10000734 | 3300005718 | Bacteria | 14856 |
| 84 | Ga0068861_100130836 | 3300005719 | Bacteria | 2037 |
| 85 | Ga0068851_10005932 | 3300005834 | Bacteria | 5560 |
| 86 | Ga0068863_100000004 | 3300005841 | Bacteria | 272478 |
| 87 | Ga0068863_100008698 | 3300005841 | Bacteria | 9918 |
| 88 | Ga0068863_100108343 | 3300005841 | Bacteria | 2644 |
| 89 | Ga0068858_100000017 | 3300005842 | Bacteria | 186913 |
| 90 | Ga0068858_100201790 | 3300005842 | Bacteria | 1881 |
| 91 | Ga0068858_100269912 | 3300005842 | Bacteria | 1619 |
| 92 | Ga0068860_100008044 | 3300005843 | Bacteria | 10515 |
| 93 | Ga0068860_100246579 | 3300005843 | Bacteria | 1738 |
| 94 | Ga0068862_100007085 | 3300005844 | Bacteria | 9312 |
| 95 | Ga0081455_10013362 | 3300005937 | Bacteria | 8121 |
| 96 | Ga0081455_10155826 | 3300005937 | Bacteria | 1756 |
| 97 | Ga0081538_10009934 | 3300005981 | Bacteria | 7865 |
| 98 | Ga0081540_1000006 | 3300005983 | Bacteria | 208724 |
| 99 | Ga0081539_10001003 | 3300005985 | Bacteria | 52435 |
| 100 | Ga0070717_10000006 | 3300006028 | Bacteria | 353403 |
| 101 | Ga0070717_10049389 | 3300006028 | Bacteria | 3453 |
| 102 | Ga0075363_100003580 | 3300006048 | Bacteria | 6645 |
| 103 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 104 | Ga0070716_100214027 | 3300006173 | Bacteria | 1290 |
| 105 | Ga0070712_100002610 | 3300006175 | Bacteria | 11127 |
| 106 | Ga0070712_100003065 | 3300006175 | Bacteria | 10338 |
| 107 | Ga0097621_100442234 | 3300006237 | Bacteria | 1170 |
| 108 | Ga0068871_100094416 | 3300006358 | Bacteria | 2497 |
| 109 | Ga0075428_100207514 | 3300006844 | Bacteria | 2117 |
| 110 | Ga0075431_100037610 | 3300006847 | Bacteria | 4984 |
| 111 | Ga0075433_10000101 | 3300006852 | Bacteria | 41420 |
| 112 | Ga0075433_10008780 | 3300006852 | Bacteria | 8064 |
| 113 | Ga0075434_100081845 | 3300006871 | Bacteria | 3225 |
| 114 | Ga0068865_100000101 | 3300006881 | Bacteria | 44302 |
| 115 | Ga0097620_100094205 | 3300006931 | Bacteria | 3047 |
| 116 | Ga0097620_100302205 | 3300006931 | Bacteria | 1694 |
| 117 | Ga0105240_10033121 | 3300009093 | Bacteria | 6679 |
| 118 | Ga0111539_10042787 | 3300009094 | Bacteria | 5435 |
| 119 | Ga0111539_10463583 | 3300009094 | Bacteria | 1475 |
| 120 | Ga0105245_10000098 | 3300009098 | Bacteria | 84100 |
| 121 | Ga0105245_10000283 | 3300009098 | Bacteria | 48302 |
| 122 | Ga0105245_10000969 | 3300009098 | Bacteria | 26182 |
| 123 | Ga0105245_10013269 | 3300009098 | Bacteria | 7179 |
| 124 | Ga0105247_10004151 | 3300009101 | Bacteria | 9298 |
| 125 | Ga0105247_10058118 | 3300009101 | Bacteria | 2392 |
| 126 | Ga0114129_10067032 | 3300009147 | Bacteria | 5006 |
| 127 | Ga0105243_10026965 | 3300009148 | Bacteria | 4400 |
| 128 | Ga0105243_10069228 | 3300009148 | Bacteria | 2846 |
| 129 | Ga0105243_10413709 | 3300009148 | Bacteria | 1256 |
| 130 | Ga0105242_10000357 | 3300009176 | Bacteria | 36537 |
| 131 | Ga0105242_10000959 | 3300009176 | Bacteria | 22497 |
| 132 | Ga0105242_10096417 | 3300009176 | Bacteria | 2499 |
| 133 | Ga0105242_10141838 | 3300009176 | Bacteria | 2086 |
| 134 | Ga0105248_10000032 | 3300009177 | Bacteria | 201114 |
| 135 | Ga0105237_10048234 | 3300009545 | Bacteria | 4281 |
| 136 | Ga0105238_10018276 | 3300009551 | Bacteria | 7132 |
| 137 | Ga0105249_10000074 | 3300009553 | Bacteria | 145235 |
| 138 | Ga0105249_10008161 | 3300009553 | Bacteria | 9128 |
| 139 | Ga0105249_10058194 | 3300009553 | Bacteria | 3542 |
| 140 | Ga0105249_10225495 | 3300009553 | Bacteria | 1846 |
| 141 | Ga0105239_10153103 | 3300010375 | Bacteria | 2574 |
| 142 | Ga0105239_10547380 | 3300010375 | Bacteria | 1318 |
| 143 | Ga0105246_10048671 | 3300011119 | Bacteria | 2899 |
| 144 | Ga0105246_10122004 | 3300011119 | Bacteria | 1933 |
| 145 | Ga0157371_10003923 | 3300013102 | Bacteria | 13232 |
| 146 | Ga0157370_10019335 | 3300013104 | Bacteria | 6836 |
| 147 | Ga0157370_10019970 | 3300013104 | Bacteria | 6702 |
| 148 | Ga0157370_10059308 | 3300013104 | Bacteria | 3636 |
| 149 | Ga0157369_10000142 | 3300013105 | Bacteria | 101760 |
| 150 | Ga0157374_10216794 | 3300013296 | Bacteria | 1877 |
| 151 | Ga0157378_10003055 | 3300013297 | Bacteria | 14877 |
| 152 | Ga0157378_10131586 | 3300013297 | Bacteria | 2316 |
| 153 | Ga0157372_10002742 | 3300013307 | Bacteria | 19035 |
| 154 | Ga0157372_10078118 | 3300013307 | Bacteria | 3740 |
| 155 | Ga0157372_10152997 | 3300013307 | Bacteria | 2663 |
| 156 | Ga0157375_10000194 | 3300013308 | Bacteria | 56860 |
| 157 | Ga0157375_10002378 | 3300013308 | Bacteria | 16278 |
| 158 | Ga0157375_10071669 | 3300013308 | Bacteria | 3479 |
| 159 | Ga0157375_10590022 | 3300013308 | Bacteria | 1271 |
| 160 | Ga0163163_10214330 | 3300014325 | Bacteria | 1975 |
| 161 | Ga0157380_10000138 | 3300014326 | Bacteria | 40711 |
| 162 | Ga0157380_10008530 | 3300014326 | Bacteria | 7324 |
| 163 | Ga0157380_10034374 | 3300014326 | Bacteria | 3910 |
| 164 | Ga0157380_10336822 | 3300014326 | Bacteria | 1405 |
| 165 | Ga0157379_10006911 | 3300014968 | Bacteria | 9815 |
| 166 | Ga0157379_10027103 | 3300014968 | Bacteria | 5101 |
| 167 | Ga0157376_10005648 | 3300014969 | Bacteria | 8756 |
| 168 | Ga0157376_10288785 | 3300014969 | Bacteria | 1548 |
| 169 | Ga0157376_10418534 | 3300014969 | Bacteria | 1300 |
| 170 | Ga0163161_10000032 | 3300017792 | Bacteria | 165511 |
| 171 | Ga0163161_10381362 | 3300017792 | Bacteria | 1127 |
| 172 | Ga0163161_10401625 | 3300017792 | Bacteria | 1099 |
| 173 | Ga0206356_10658233 | 3300020070 | Bacteria | 1641 |
| 174 | Ga0206353_10830263 | 3300020082 | Bacteria | 5131 |
| 175 | Ga0206353_11869196 | 3300020082 | Bacteria | 2387 |
| 176 | Ga0213874_10006302 | 3300021377 | Bacteria | 2806 |
| 177 | Ga0213876_10021062 | 3300021384 | Bacteria | 3448 |
| 178 | Ga0224712_10054332 | 3300022467 | Bacteria | 1571 |
| 179 | Ga0207656_10003397 | 3300025321 | Bacteria | 5467 |
| 180 | Ga0207682_10000053 | 3300025893 | Bacteria | 49064 |
| 181 | Ga0207642_10000006 | 3300025899 | Bacteria | 230268 |
| 182 | Ga0207642_10000007 | 3300025899 | Bacteria | 226017 |
| 183 | Ga0207642_10000068 | 3300025899 | Bacteria | 28335 |
| 184 | Ga0207642_10028650 | 3300025899 | Bacteria | 2296 |
| 185 | Ga0207710_10000580 | 3300025900 | Bacteria | 21659 |
| 186 | Ga0207688_10037725 | 3300025901 | Bacteria | 2681 |
| 187 | Ga0207680_10002472 | 3300025903 | Bacteria | 8628 |
| 188 | Ga0207685_10000011 | 3300025905 | Bacteria | 213430 |
| 189 | Ga0207685_10019862 | 3300025905 | Bacteria | 2221 |
| 190 | Ga0207645_10117181 | 3300025907 | Bacteria | 1727 |
| 191 | Ga0207705_10236379 | 3300025909 | Bacteria | 1391 |
| 192 | Ga0207707_10004923 | 3300025912 | Bacteria | 11744 |
| 193 | Ga0207707_10022186 | 3300025912 | Bacteria | 5550 |
| 194 | Ga0207707_10024956 | 3300025912 | Bacteria | 5230 |
| 195 | Ga0207671_10035293 | 3300025914 | Bacteria | 3712 |
| 196 | Ga0207693_10000234 | 3300025915 | Bacteria | 51024 |
| 197 | Ga0207693_10040592 | 3300025915 | Bacteria | 3665 |
| 198 | Ga0207663_10343825 | 3300025916 | Bacteria | 1127 |
| 199 | Ga0207660_10010713 | 3300025917 | Bacteria | 5959 |
| 200 | Ga0207660_10068939 | 3300025917 | Bacteria | 2567 |
| 201 | Ga0207662_10031594 | 3300025918 | Bacteria | 3077 |
| 202 | Ga0207662_10065932 | 3300025918 | Bacteria | 2181 |
| 203 | Ga0207662_10114478 | 3300025918 | Bacteria | 1685 |
| 204 | Ga0207657_10065933 | 3300025919 | Bacteria | 3084 |
| 205 | Ga0207649_10000640 | 3300025920 | Bacteria | 23374 |
| 206 | Ga0207649_10043307 | 3300025920 | Bacteria | 2751 |
| 207 | Ga0207652_10000549 | 3300025921 | Bacteria | 38051 |
| 208 | Ga0207652_10002646 | 3300025921 | Bacteria | 15031 |
| 209 | Ga0207652_10003833 | 3300025921 | Bacteria | 12335 |
| 210 | Ga0207652_10038430 | 3300025921 | Bacteria | 4058 |
| 211 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 212 | Ga0207659_10000020 | 3300025926 | Bacteria | 151552 |
| 213 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 214 | Ga0207687_10000055 | 3300025927 | Bacteria | 88382 |
| 215 | Ga0207687_10000822 | 3300025927 | Bacteria | 20971 |
| 216 | Ga0207687_10135770 | 3300025927 | Bacteria | 1860 |
| 217 | Ga0207700_10000070 | 3300025928 | Bacteria | 62833 |
| 218 | Ga0207700_10323531 | 3300025928 | Bacteria | 1337 |
| 219 | Ga0207690_10005424 | 3300025932 | Bacteria | 7513 |
| 220 | Ga0207690_10075144 | 3300025932 | Bacteria | 2342 |
| 221 | Ga0207706_10000018 | 3300025933 | Bacteria | 168729 |
| 222 | Ga0207706_10083342 | 3300025933 | Bacteria | 2811 |
| 223 | Ga0207706_10206341 | 3300025933 | Bacteria | 1723 |
| 224 | Ga0207686_10000156 | 3300025934 | Bacteria | 51745 |
| 225 | Ga0207686_10001286 | 3300025934 | Bacteria | 14405 |
| 226 | Ga0207686_10023583 | 3300025934 | Bacteria | 3556 |
| 227 | Ga0207709_10012655 | 3300025935 | Bacteria | 4650 |
| 228 | Ga0207709_10095975 | 3300025935 | Bacteria | 1949 |
| 229 | Ga0207670_10044767 | 3300025936 | Bacteria | 2930 |
| 230 | Ga0207670_10093790 | 3300025936 | Bacteria | 2128 |
| 231 | Ga0207669_10000009 | 3300025937 | Bacteria | 168012 |
| 232 | Ga0207669_10000087 | 3300025937 | Bacteria | 46794 |
| 233 | Ga0207669_10075110 | 3300025937 | Bacteria | 2140 |
| 234 | Ga0207704_10000025 | 3300025938 | Bacteria | 135523 |
| 235 | Ga0207665_10007612 | 3300025939 | Bacteria | 7152 |
| 236 | Ga0207691_10000020 | 3300025940 | Bacteria | 133465 |
| 237 | Ga0207711_10000020 | 3300025941 | Bacteria | 363325 |
| 238 | Ga0207711_10277549 | 3300025941 | Bacteria | 1543 |
| 239 | Ga0207661_10002561 | 3300025944 | Bacteria | 12511 |
| 240 | Ga0207661_10003274 | 3300025944 | Bacteria | 11238 |
| 241 | Ga0207661_10010893 | 3300025944 | Bacteria | 6563 |
| 242 | Ga0207661_10021523 | 3300025944 | Bacteria | 4832 |
| 243 | Ga0207661_10023075 | 3300025944 | Bacteria | 4698 |
| 244 | Ga0207661_10033670 | 3300025944 | Bacteria | 3978 |
| 245 | Ga0207661_10041366 | 3300025944 | Bacteria | 3628 |
| 246 | Ga0207661_10090944 | 3300025944 | Bacteria | 2542 |
| 247 | Ga0207679_10015156 | 3300025945 | Bacteria | 5085 |
| 248 | Ga0207679_10085354 | 3300025945 | Bacteria | 2425 |
| 249 | Ga0207667_10163489 | 3300025949 | Bacteria | 2289 |
| 250 | Ga0207667_10165896 | 3300025949 | Bacteria | 2271 |
| 251 | Ga0207651_10014509 | 3300025960 | Bacteria | 4553 |
| 252 | Ga0207712_10000007 | 3300025961 | Bacteria | 539589 |
| 253 | Ga0207640_10000285 | 3300025981 | Bacteria | 33957 |
| 254 | Ga0207640_10156843 | 3300025981 | Bacteria | 1679 |
| 255 | Ga0207658_10009883 | 3300025986 | Bacteria | 6482 |
| 256 | Ga0207677_10003454 | 3300026023 | Bacteria | 8372 |
| 257 | Ga0207677_10067862 | 3300026023 | Bacteria | 2500 |
| 258 | Ga0207677_10071795 | 3300026023 | Bacteria | 2444 |
| 259 | Ga0207677_10113112 | 3300026023 | Bacteria | 2026 |
| 260 | Ga0207703_10000030 | 3300026035 | Bacteria | 199014 |
| 261 | Ga0207703_10003621 | 3300026035 | Bacteria | 12890 |
| 262 | Ga0207703_10068420 | 3300026035 | Bacteria | 2926 |
| 263 | Ga0207703_10107480 | 3300026035 | Bacteria | 2375 |
| 264 | Ga0207639_10034550 | 3300026041 | Bacteria | 3737 |
| 265 | Ga0207639_10044598 | 3300026041 | Bacteria | 3335 |
| 266 | Ga0207639_10108666 | 3300026041 | Bacteria | 2256 |
| 267 | Ga0207639_10197639 | 3300026041 | Bacteria | 1722 |
| 268 | Ga0207678_10003121 | 3300026067 | Bacteria | 14999 |
| 269 | Ga0207678_10066757 | 3300026067 | Bacteria | 3088 |
| 270 | Ga0207708_10032427 | 3300026075 | Bacteria | 3967 |
| 271 | Ga0207708_10063340 | 3300026075 | Bacteria | 2825 |
| 272 | Ga0207702_10000016 | 3300026078 | Bacteria | 226633 |
| 273 | Ga0207702_10002500 | 3300026078 | Bacteria | 17354 |
| 274 | Ga0207702_10096026 | 3300026078 | Bacteria | 2606 |
| 275 | Ga0207702_10217840 | 3300026078 | Bacteria | 1778 |
| 276 | Ga0207702_10333035 | 3300026078 | Bacteria | 1448 |
| 277 | Ga0207641_10000094 | 3300026088 | Bacteria | 124545 |
| 278 | Ga0207641_10040062 | 3300026088 | Bacteria | 3920 |
| 279 | Ga0207641_10041339 | 3300026088 | Bacteria | 3863 |
| 280 | Ga0207641_10114453 | 3300026088 | Bacteria | 2397 |
| 281 | Ga0207641_10451023 | 3300026088 | Bacteria | 1243 |
| 282 | Ga0207648_10000931 | 3300026089 | Bacteria | 32948 |
| 283 | Ga0207648_10059624 | 3300026089 | Bacteria | 3329 |
| 284 | Ga0207676_10000048 | 3300026095 | Bacteria | 147853 |
| 285 | Ga0207675_100037724 | 3300026118 | Bacteria | 4508 |
| 286 | Ga0207675_100085534 | 3300026118 | Bacteria | 2960 |
| 287 | Ga0207675_100143311 | 3300026118 | Bacteria | 2271 |
| 288 | Ga0207683_10006441 | 3300026121 | Bacteria | 10056 |
| 289 | Ga0207698_10000012 | 3300026142 | Bacteria | 260061 |
| 290 | Ga0207698_10004988 | 3300026142 | Bacteria | 8138 |
| 291 | Ga0207698_10037889 | 3300026142 | Bacteria | 3556 |
| 292 | Ga0268266_10000020 | 3300028379 | Bacteria | 527065 |
| 293 | Ga0268266_10002478 | 3300028379 | Bacteria | 19728 |
| 294 | Ga0268266_10005194 | 3300028379 | Bacteria | 12259 |
| 295 | Ga0268266_10066807 | 3300028379 | Bacteria | 3111 |
| 296 | Ga0268266_10143261 | 3300028379 | Bacteria | 2146 |
| 297 | Ga0268266_10272544 | 3300028379 | Bacteria | 1571 |
| 298 | Ga0268265_10037565 | 3300028380 | Bacteria | 3555 |
| 299 | Ga0268265_10065259 | 3300028380 | Bacteria | 2809 |
| 300 | Ga0268264_10005469 | 3300028381 | Bacteria | 10768 |
| 301 | Ga0268264_10269689 | 3300028381 | Bacteria | 1589 |
| 302 | Ga0265337_1000002 | 3300028556 | Bacteria | 139247 |
| 303 | Ga0265326_10000007 | 3300028558 | Bacteria | 223057 |
| 304 | Ga0265326_10000017 | 3300028558 | Bacteria | 152436 |
| 305 | Ga0265319_1000015 | 3300028563 | Bacteria | 176382 |
| 306 | Ga0265319_1000028 | 3300028563 | Bacteria | 135557 |
| 307 | Ga0265334_10000029 | 3300028573 | Bacteria | 114485 |
| 308 | Ga0265322_10000001 | 3300028654 | Bacteria | 543854 |
| 309 | Ga0265336_10005833 | 3300028666 | Bacteria | 4501 |
| 310 | Ga0265338_10000230 | 3300028800 | Bacteria | 103891 |
| 311 | Ga0265338_10002565 | 3300028800 | Bacteria | 26857 |
| 312 | Ga0265324_10000263 | 3300029957 | Bacteria | 39080 |
| 313 | Ga0265328_10005534 | 3300031239 | Bacteria | 5406 |
| 314 | Ga0265320_10000002 | 3300031240 | Bacteria | 542875 |
| 315 | Ga0265339_10010618 | 3300031249 | Bacteria | 5711 |
| 316 | Ga0265331_10002898 | 3300031250 | Bacteria | 11337 |
| 317 | Ga0265327_10000011 | 3300031251 | Bacteria | 543807 |
| 318 | Ga0265316_10012769 | 3300031344 | Bacteria | 7505 |
| 319 | Ga0265314_10000058 | 3300031711 | Bacteria | 167476 |
| 320 | Ga0307410_10192078 | 3300031852 | Bacteria | 1553 |
| 321 | Ga0307412_10198725 | 3300031911 | Bacteria | 1521 |
| 322 | Ga0307409_100114427 | 3300031995 | Bacteria | 2269 |
| 323 | Ga0307416_100585422 | 3300032002 | Bacteria | 1194 |
| 324 | Ga0307415_100011277 | 3300032126 | Bacteria | 5108 |
| 325 | Ga0307415_100019407 | 3300032126 | Bacteria | 4127 |
| 326 | Ga0373926_0000179 | 3300035083 | Bacteria | 14297 |
| 327 | Ga0373944_0000082 | 3300035089 | Bacteria | 16346 |
| 328 | Ga0373923_0001923 | 3300035111 | Bacteria | 6215 |
| 329 | Ga0373936_0007224 | 3300035113 | Bacteria | 4180 |
| 330 | Ga0373945_0036661 | 3300035116 | Bacteria | 1757 |
| 331 | Ga0373943_0004661 | 3300035170 | Bacteria | 6202 |
| 332 | Ga0373946_0003466 | 3300035171 | Bacteria | 5601 |
| 333 | Ga0373955_0013807 | 3300035172 | Bacteria | 3918 |
| 334 | Ga0373935_0001338 | 3300035692 | Bacteria | 13637 |
| 335 | Ga0373927_0002208 | 3300035695 | Bacteria | 14305 |
| 336 | Ga0373947_0019065 | 3300035725 | Bacteria | 3953 |
| 337 | Ga0373937_0024973 | 3300036401 | Bacteria | 5394 |
| 338 | Ga0373937_0121515 | 3300036401 | Bacteria | 2434 |
| 339 | Ga0373937_0136811 | 3300036401 | Bacteria | 2291 |
| 340 | Ga0436364_0472332 | 3300037853 | Bacteria | 14490 |
| 341 | Ga0436364_0532051 | 3300037853 | Bacteria | 5136 |
| 342 | Ga0436364_0727059 | 3300037853 | Bacteria | 6478 |
| 343 | Ga0436364_0863469 | 3300037853 | Bacteria | 2343 |
| 344 | Ga0436364_1207140 | 3300037853 | Bacteria | 3662 |
| 345 | Ga0436364_1299511 | 3300037853 | Bacteria | 2724 |
| 346 | Ga0436365_0595886 | 3300039437 | Bacteria | 4447 |
| 347 | Ga0436365_0720424 | 3300039437 | Bacteria | 5881 |
| 348 | Ga0436365_1906577 | 3300039437 | Bacteria | 5634 |
| 349 | Ga0451807_1000803 | 3300041486 | Bacteria | 2721 |
| 350 | Ga0451833_0131667 | 3300041491 | Bacteria | 2030 |
| 351 | Ga0451837_0223618 | 3300041494 | Bacteria | 1045 |
| 352 | Ga0451853_3002922 | 3300041512 | Bacteria | 2923 |
| 353 | Ga0451853_4000083 | 3300041512 | Bacteria | 1923 |
| 354 | Ga0466969_0027736 | 3300044656 | Bacteria | 2899 |
| 355 | Ga0466961_0064016 | 3300044693 | Bacteria | 2337 |
| 356 | Ga0466963_0000192 | 3300044694 | Bacteria | 25723 |
| 357 | Ga0466963_0013010 | 3300044694 | Bacteria | 5101 |
| 358 | Ga0466963_0104967 | 3300044694 | Bacteria | 1936 |
| 359 | Ga0466963_0244239 | 3300044694 | Bacteria | 1259 |
| 360 | Ga0466971_0054676 | 3300044719 | Bacteria | 1799 |
| 361 | Ga0466957_0003132 | 3300044842 | Bacteria | 9006 |
| 362 | Ga0466957_0079885 | 3300044842 | Bacteria | 2036 |
| 363 | Ga0466960_0000026 | 3300044901 | Bacteria | 52770 |
| 364 | Ga0466959_0009827 | 3300045049 | Bacteria | 6817 |
| 365 | Ga0466959_0043638 | 3300045049 | Bacteria | 3305 |
| 366 | Ga0466958_0189258 | 3300045836 | Bacteria | 1308 |
| 367 | Ga0466958_0201777 | 3300045836 | Bacteria | 1266 |
| 368 | Ga0466967_0000046 | 3300045976 | Bacteria | 43911 |
| 369 | Ga0466967_0076184 | 3300045976 | Bacteria | 3017 |
| 370 | Ga0466967_0170884 | 3300045976 | Bacteria | 2045 |
| 371 | Ga0466967_0262355 | 3300045976 | Bacteria | 1653 |
| 372 | Ga0495592_0000109 | 3300046454 | Bacteria | 72116 |
| 373 | Ga0495603_0000023 | 3300046455 | Bacteria | 63559 |
| 374 | Ga0495603_0000428 | 3300046455 | Bacteria | 23287 |
| 375 | Ga0495603_0001106 | 3300046455 | Bacteria | 15657 |
| 376 | Ga0495603_0005405 | 3300046455 | Bacteria | 7625 |
| 377 | Ga0495591_013816 | 3300046458 | Bacteria | 2934 |
| 378 | Ga0495629_0000218 | 3300046459 | Bacteria | 51219 |
| 379 | Ga0495629_0004724 | 3300046459 | Bacteria | 10209 |
| 380 | Ga0495629_0010791 | 3300046459 | Bacteria | 6645 |
| 381 | Ga0495638_0077288 | 3300046460 | Bacteria | 2027 |
| 382 | Ga0495641_0000003 | 3300046461 | Bacteria | 242879 |
| 383 | Ga0495641_0002698 | 3300046461 | Bacteria | 13797 |
| 384 | Ga0495651_0324921 | 3300046462 | Bacteria | 1024 |
| 385 | Ga0495653_0100162 | 3300046463 | Bacteria | 2101 |
| 386 | Ga0495580_0006076 | 3300046472 | Bacteria | 9881 |
| 387 | Ga0495582_0000027 | 3300046473 | Bacteria | 79970 |
| 388 | Ga0495582_0008275 | 3300046473 | Bacteria | 5742 |
| 389 | Ga0495639_0001804 | 3300046475 | Bacteria | 9491 |
| 390 | Ga0495662_0000131 | 3300046476 | Bacteria | 28301 |
| 391 | Ga0495662_0004612 | 3300046476 | Bacteria | 6909 |
| 392 | Ga0495662_0005633 | 3300046476 | Bacteria | 6265 |
| 393 | Ga0495594_0000013 | 3300046499 | Bacteria | 103201 |
| 394 | Ga0495606_0000211 | 3300046507 | Bacteria | 103386 |
| 395 | Ga0495608_0000031 | 3300046511 | Bacteria | 145255 |
| 396 | Ga0495608_0005837 | 3300046511 | Bacteria | 8765 |
| 397 | Ga0495608_0009896 | 3300046511 | Bacteria | 6655 |
| 398 | Ga0495608_0091558 | 3300046511 | Bacteria | 1966 |
| 399 | Ga0495618_0000004 | 3300046514 | Bacteria | 245690 |
| 400 | Ga0495620_0007472 | 3300046515 | Bacteria | 5927 |
| 401 | Ga0495628_0000323 | 3300046516 | Bacteria | 43212 |
| 402 | Ga0495628_0062707 | 3300046516 | Bacteria | 2913 |
| 403 | Ga0495628_0087318 | 3300046516 | Bacteria | 2418 |
| 404 | Ga0495628_0200678 | 3300046516 | Bacteria | 1503 |
| 405 | Ga0495630_0000018 | 3300046517 | Bacteria | 186064 |
| 406 | Ga0495630_0000219 | 3300046517 | Bacteria | 45366 |
| 407 | Ga0495630_0001411 | 3300046517 | Bacteria | 16609 |
| 408 | Ga0495630_0001847 | 3300046517 | Bacteria | 14783 |
| 409 | Ga0495630_0138859 | 3300046517 | Bacteria | 1847 |
| 410 | Ga0495644_0000532 | 3300046523 | Bacteria | 16166 |
| 411 | Ga0495666_0007744 | 3300046526 | Bacteria | 5375 |
| 412 | Ga0495652_0000003 | 3300046529 | Bacteria | 597094 |
| 413 | Ga0495652_0054038 | 3300046529 | Bacteria | 3421 |
| 414 | Ga0495665_0001243 | 3300046531 | Bacteria | 13587 |
| 415 | Ga0495640_0002638 | 3300046533 | Bacteria | 14399 |
| 416 | Ga0495640_0112114 | 3300046533 | Bacteria | 1781 |
| 417 | Ga0495586_0000606 | 3300046535 | Bacteria | 20790 |
| 418 | Ga0495586_0007859 | 3300046535 | Bacteria | 5689 |
| 419 | Ga0495586_0025731 | 3300046535 | Bacteria | 3149 |
| 420 | Ga0495587_0017319 | 3300046536 | Bacteria | 4477 |
| 421 | Ga0495621_0000542 | 3300046539 | Bacteria | 9388 |
| 422 | Ga0495645_0002138 | 3300046543 | Bacteria | 13409 |
| 423 | Ga0495645_0044560 | 3300046543 | Bacteria | 3235 |
| 424 | Ga0495622_0000014 | 3300046557 | Bacteria | 182142 |
| 425 | Ga0495667_0000075 | 3300046559 | Bacteria | 73540 |
| 426 | Ga0495634_0000556 | 3300046642 | Bacteria | 36540 |
| 427 | Ga0495634_0000944 | 3300046642 | Bacteria | 27495 |
| 428 | Ga0495634_0002651 | 3300046642 | Bacteria | 14702 |
| 429 | Ga0495634_0003687 | 3300046642 | Bacteria | 12221 |
| 430 | Ga0495634_0071688 | 3300046642 | Bacteria | 2280 |
| 431 | Ga0495625_0000122 | 3300046660 | Bacteria | 121146 |
| 432 | Ga0495635_0000042 | 3300046663 | Bacteria | 84550 |
| 433 | Ga0495635_0003860 | 3300046663 | Bacteria | 10415 |
| 434 | Ga0495635_0011459 | 3300046663 | Bacteria | 6217 |
| 435 | Ga0495588_0000198 | 3300046674 | Bacteria | 60956 |
| 436 | Ga0495588_0004283 | 3300046674 | Bacteria | 6292 |
| 437 | Ga0495657_0000011 | 3300046675 | Bacteria | 207360 |
| 438 | Ga0495657_0000024 | 3300046675 | Bacteria | 145255 |
| 439 | Ga0495657_0009789 | 3300046675 | Bacteria | 7235 |
| 440 | Ga0495599_0019054 | 3300046678 | Bacteria | 4278 |
| 441 | Ga0495647_0000007 | 3300046681 | Bacteria | 103790 |
| 442 | Ga0495647_0000437 | 3300046681 | Bacteria | 11967 |
| 443 | Ga0495647_0083834 | 3300046681 | Bacteria | 1296 |
| 444 | Ga0495658_0000025 | 3300046683 | Bacteria | 79910 |
| 445 | Ga0495658_0000323 | 3300046683 | Bacteria | 26804 |
| 446 | Ga0495669_0000307 | 3300046684 | Bacteria | 26997 |
| 447 | Ga0495669_0026771 | 3300046684 | Bacteria | 2520 |
| 448 | Ga0495613_0000042 | 3300046689 | Bacteria | 130403 |
| 449 | Ga0495613_0000352 | 3300046689 | Bacteria | 40662 |
| 450 | Ga0495613_0002559 | 3300046689 | Bacteria | 13689 |
| 451 | Ga0495624_0000009 | 3300046690 | Bacteria | 145026 |
| 452 | Ga0495624_0000037 | 3300046690 | Bacteria | 83796 |
| 453 | Ga0495624_0002323 | 3300046690 | Bacteria | 14475 |
| 454 | Ga0495624_0005245 | 3300046690 | Bacteria | 9360 |
| 455 | Ga0495670_0074756 | 3300046691 | Bacteria | 1719 |
| 456 | Ga0495649_0005916 | 3300046694 | Bacteria | 7669 |
| 457 | Ga0495600_0000407 | 3300046809 | Bacteria | 22240 |
| 458 | Ga0495581_0016160 | 3300047315 | Bacteria | 4338 |
| 459 | Ga0495604_0000038 | 3300047317 | Bacteria | 123703 |
| 460 | Ga0495604_0000073 | 3300047317 | Bacteria | 86844 |
| 461 | Ga0495674_0000042 | 3300047319 | Bacteria | 94820 |
| 462 | Ga0495674_0001737 | 3300047319 | Bacteria | 21413 |
| 463 | Ga0495676_0000980 | 3300047321 | Bacteria | 23939 |
| 464 | Ga0495676_0004769 | 3300047321 | Bacteria | 12419 |
| 465 | Ga0495676_0111289 | 3300047321 | Bacteria | 2008 |
| 466 | Ga0495680_0000196 | 3300047322 | Bacteria | 65437 |
| 467 | Ga0495680_0002982 | 3300047322 | Bacteria | 16907 |
| 468 | Ga0495680_0003091 | 3300047322 | Bacteria | 16592 |
| 469 | Ga0495680_0003586 | 3300047322 | Bacteria | 15202 |
| 470 | Ga0495680_0067723 | 3300047322 | Bacteria | 2729 |
| 471 | Ga0495680_0068766 | 3300047322 | Bacteria | 2704 |
| 472 | Ga0495680_0243843 | 3300047322 | Bacteria | 1275 |
| 473 | Ga0495675_0000209 | 3300047444 | Bacteria | 42691 |
| 474 | Ga0495675_0141478 | 3300047444 | Bacteria | 1491 |
| 475 | Ga0495684_0075062 | 3300047471 | Bacteria | 2569 |
| 476 | Ga0495684_0075193 | 3300047471 | Bacteria | 2566 |
| 477 | Ga0495686_0072578 | 3300047472 | Bacteria | 2116 |
| 478 | Ga0495593_0008941 | 3300047673 | Bacteria | 5815 |
| 479 | Ga0495593_0078733 | 3300047673 | Bacteria | 1707 |
| 480 | Ga0495602_0000021 | 3300048088 | Bacteria | 168585 |
| 481 | Ga0495602_0007041 | 3300048088 | Bacteria | 11805 |
| 482 | Ga0495614_0005735 | 3300048089 | Bacteria | 5591 |
| 483 | Ga0496100_0000002 | 3300048903 | Bacteria | 489057 |
| 484 | Ga0496100_0000038 | 3300048903 | Bacteria | 94110 |
| 485 | Ga0496101_0000001 | 3300048904 | Bacteria | 489057 |
| 486 | Ga0496101_0000153 | 3300048904 | Bacteria | 59317 |
| 487 | Ga0496101_0109634 | 3300048904 | Bacteria | 2077 |
| 488 | Ga0496101_0122630 | 3300048904 | Bacteria | 1966 |
| 489 | Ga0496102_0000584 | 3300048905 | Bacteria | 38605 |
| 490 | Ga0496102_0030907 | 3300048905 | Bacteria | 4797 |
| 491 | Ga0496102_0323343 | 3300048905 | Bacteria | 1453 |
| 492 | Ga0496102_0464012 | 3300048905 | Bacteria | 1187 |
| 493 | Ga0496103_0000043 | 3300048906 | Bacteria | 167983 |
| 494 | Ga0496103_0094999 | 3300048906 | Bacteria | 1884 |
| 495 | Ga0496103_0177571 | 3300048906 | Bacteria | 1368 |
| 496 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 497 | Ga0496104_0000013 | 3300048907 | Bacteria | 397163 |
| 498 | Ga0496104_0000727 | 3300048907 | Bacteria | 28357 |
| 499 | Ga0496104_0031192 | 3300048907 | Bacteria | 4956 |
| 500 | Ga0496104_0082417 | 3300048907 | Bacteria | 3067 |
| 501 | Ga0496104_0098288 | 3300048907 | Bacteria | 2802 |
| 502 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 503 | Ga0496105_0000006 | 3300048908 | Bacteria | 393578 |
| 504 | Ga0496105_0015196 | 3300048908 | Bacteria | 6130 |
| 505 | Ga0496105_0041611 | 3300048908 | Bacteria | 3787 |
| 506 | Ga0496105_0076170 | 3300048908 | Bacteria | 2770 |
| 507 | Ga0496106_0000018 | 3300048909 | Bacteria | 175028 |
| 508 | Ga0496106_0000022 | 3300048909 | Bacteria | 166339 |
| 509 | Ga0496106_0000138 | 3300048909 | Bacteria | 54275 |
| 510 | Ga0496106_0048658 | 3300048909 | Bacteria | 3193 |
| 511 | Ga0496107_0000006 | 3300048910 | Bacteria | 258746 |
| 512 | Ga0496107_0000016 | 3300048910 | Bacteria | 172319 |
| 513 | Ga0496107_0013416 | 3300048910 | Bacteria | 5727 |
| 514 | Ga0496107_0021983 | 3300048910 | Bacteria | 4506 |
| 515 | Ga0496107_0065767 | 3300048910 | Bacteria | 2628 |
| 516 | Ga0496108_0000150 | 3300048911 | Bacteria | 67068 |
| 517 | Ga0496108_0043488 | 3300048911 | Bacteria | 3752 |
| 518 | Ga0496108_0091681 | 3300048911 | Bacteria | 2583 |
| 519 | Ga0496108_0309835 | 3300048911 | Bacteria | 1376 |
| 520 | Ga0496109_0000007 | 3300048912 | Bacteria | 247554 |
| 521 | Ga0496109_0000028 | 3300048912 | Bacteria | 168138 |
| 522 | Ga0496109_0000369 | 3300048912 | Bacteria | 41635 |
| 523 | Ga0496109_0043682 | 3300048912 | Bacteria | 4063 |
| 524 | Ga0496109_0097659 | 3300048912 | Bacteria | 2723 |
| 525 | Ga0496109_0110113 | 3300048912 | Bacteria | 2560 |
| 526 | Ga0496109_0185105 | 3300048912 | Bacteria | 1957 |
| 527 | Ga0496110_0000033 | 3300048913 | Bacteria | 65539 |
| 528 | Ga0496110_0000653 | 3300048913 | Bacteria | 23661 |
| 529 | Ga0496110_0068583 | 3300048913 | Bacteria | 3139 |
| 530 | Ga0496110_0547254 | 3300048913 | Bacteria | 1052 |
| 531 | Ga0496111_0000125 | 3300048914 | Bacteria | 33642 |
| 532 | Ga0496111_0000444 | 3300048914 | Bacteria | 21023 |
| 533 | Ga0496111_0050344 | 3300048914 | Bacteria | 3005 |
| 534 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 535 | Ga0496112_0006769 | 3300048915 | Bacteria | 10100 |
| 536 | Ga0496112_0043399 | 3300048915 | Bacteria | 4402 |
| 537 | Ga0496112_0066655 | 3300048915 | Bacteria | 3553 |
| 538 | Ga0496112_0156243 | 3300048915 | Bacteria | 2248 |
| 539 | Ga0496112_0226607 | 3300048915 | Bacteria | 1824 |
| 540 | Ga0496112_0338909 | 3300048915 | Bacteria | 1447 |
| 541 | Ga0496113_0005783 | 3300048916 | Bacteria | 7753 |
| 542 | Ga0496113_0010806 | 3300048916 | Bacteria | 6057 |
| 543 | Ga0496113_0049681 | 3300048916 | Bacteria | 3124 |
| 544 | Ga0496113_0124379 | 3300048916 | Bacteria | 2019 |
| 545 | Ga0496114_0000014 | 3300048917 | Bacteria | 297902 |
| 546 | Ga0496114_0029717 | 3300048917 | Bacteria | 4493 |
| 547 | Ga0496114_0315721 | 3300048917 | Bacteria | 1380 |
| 548 | Ga0496115_0000020 | 3300048918 | Bacteria | 171995 |
| 549 | Ga0496115_0000255 | 3300048918 | Bacteria | 47200 |
| 550 | Ga0496115_0131296 | 3300048918 | Bacteria | 2065 |
| 551 | Ga0496116_0000819 | 3300048919 | Bacteria | 39388 |
| 552 | Ga0496117_0001154 | 3300048920 | Bacteria | 39767 |
| 553 | Ga0496118_0002138 | 3300048921 | Bacteria | 27578 |
| 554 | Ga0496119_0005629 | 3300048922 | Bacteria | 11911 |
| 555 | Ga0496119_0007031 | 3300048922 | Bacteria | 10243 |
| 556 | Ga0496119_0010882 | 3300048922 | Bacteria | 7603 |
| 557 | Ga0496119_0035108 | 3300048922 | Bacteria | 3290 |
| 558 | Ga0496120_0001229 | 3300048923 | Bacteria | 32395 |
| 559 | Ga0496120_0011279 | 3300048923 | Bacteria | 6156 |
| 560 | Ga0496121_0004246 | 3300048924 | Bacteria | 19486 |
| 561 | Ga0496121_0017908 | 3300048924 | Bacteria | 7188 |
| 562 | Ga0496121_0026538 | 3300048924 | Bacteria | 5453 |
| 563 | Ga0496125_0045145 | 3300048928 | Bacteria | 3714 |
| 564 | Ga0496125_0162817 | 3300048928 | Bacteria | 1512 |
| 565 | Ga0496126_0009557 | 3300048929 | Bacteria | 10288 |
| 566 | Ga0501031_0069173 | 3300049568 | Bacteria | 2299 |
| 567 | Ga0501032_0000377 | 3300049569 | Bacteria | 36745 |
| 568 | Ga0501032_0161499 | 3300049569 | Bacteria | 1471 |
| 569 | Ga0501033_0000303 | 3300049570 | Bacteria | 46665 |
| 570 | Ga0501036_0000446 | 3300049572 | Bacteria | 29468 |
| 571 | Ga0501036_0004810 | 3300049572 | Bacteria | 10917 |
| 572 | Ga0501036_0311431 | 3300049572 | Bacteria | 1316 |
| 573 | Ga0501038_0000245 | 3300049574 | Bacteria | 46017 |
| 574 | Ga0501038_0077775 | 3300049574 | Bacteria | 2800 |
| 575 | Ga0501039_0005821 | 3300049575 | Bacteria | 9335 |
| 576 | Ga0501040_0001151 | 3300049576 | Bacteria | 16823 |
| 577 | Ga0501040_0195107 | 3300049576 | Bacteria | 1437 |
| 578 | Ga0501042_0032199 | 3300049578 | Bacteria | 3712 |
| 579 | Ga0501042_0051615 | 3300049578 | Bacteria | 2933 |
| 580 | Ga0501042_0093445 | 3300049578 | Bacteria | 2160 |
| 581 | Ga0501043_0362925 | 3300049579 | Bacteria | 1099 |
| 582 | Ga0501046_0038885 | 3300049580 | Bacteria | 3815 |
| 583 | Ga0501046_0093827 | 3300049580 | Bacteria | 2306 |
| 584 | Ga0501047_0000263 | 3300049581 | Bacteria | 61685 |
| 585 | Ga0501047_0009009 | 3300049581 | Bacteria | 9424 |
| 586 | Ga0501048_0028246 | 3300049582 | Bacteria | 4072 |
| 587 | Ga0501048_0059339 | 3300049582 | Bacteria | 2711 |
| 588 | Ga0501068_0098376 | 3300049584 | Bacteria | 1811 |
| 589 | Ga0501070_0000710 | 3300049586 | Bacteria | 30498 |
| 590 | Ga0501070_0004256 | 3300049586 | Bacteria | 12307 |
| 591 | Ga0501070_0074025 | 3300049586 | Bacteria | 2819 |
| 592 | Ga0501070_0239100 | 3300049586 | Bacteria | 1487 |
| 593 | Ga0501071_0000883 | 3300049587 | Bacteria | 16220 |
| 594 | Ga0501072_0003041 | 3300049588 | Bacteria | 12653 |
| 595 | Ga0501072_0035607 | 3300049588 | Bacteria | 3900 |
| 596 | Ga0501072_0280482 | 3300049588 | Bacteria | 1325 |
| 597 | Ga0501073_0002082 | 3300049589 | Bacteria | 14972 |
| 598 | Ga0501074_0050754 | 3300049590 | Bacteria | 2994 |
| 599 | Ga0501074_0117989 | 3300049590 | Bacteria | 1898 |
| 600 | Ga0501075_0007364 | 3300049591 | Bacteria | 7636 |
| 601 | Ga0501075_0013017 | 3300049591 | Bacteria | 5929 |
| 602 | Ga0501076_0016149 | 3300049592 | Bacteria | 5652 |
| 603 | Ga0501077_0019637 | 3300049593 | Bacteria | 4274 |
| 604 | Ga0501079_0018586 | 3300049741 | Bacteria | 5309 |
| 605 | Ga0501080_0057304 | 3300049742 | Bacteria | 3628 |
| 606 | Ga0501080_0100266 | 3300049742 | Bacteria | 2687 |
| 607 | Ga0501080_0256107 | 3300049742 | Bacteria | 1595 |
| 608 | Ga0501080_0302747 | 3300049742 | Bacteria | 1450 |
| 609 | Ga0501081_0005886 | 3300049743 | Bacteria | 7937 |
| 610 | Ga0501083_0028225 | 3300049744 | Bacteria | 3870 |
| 611 | Ga0501035_0000391 | 3300049822 | Bacteria | 50329 |
| 612 | Ga0501044_0137123 | 3300049823 | Bacteria | 2437 |
| 613 | Ga0501044_0227640 | 3300049823 | Bacteria | 1813 |
| 614 | Ga0501045_0015644 | 3300049824 | Bacteria | 5382 |
| 615 | Ga0501045_0096253 | 3300049824 | Bacteria | 2190 |
| 616 | nmdc:mga05p37_560917_c1 | 3300050507 | Bacteria | 1298 |
| 617 | nmdc:mga08y16_56116_c1 | 3300050511 | Bacteria | 4117 |
| 618 | nmdc:mga0a205_2175_c1 | 3300050515 | Bacteria | 17244 |
| 619 | nmdc:mga0a205_7295_c1 | 3300050515 | Bacteria | 10002 |
| 620 | Ga0495601_0000072 | 3300053077 | Bacteria | 56009 |
| 621 | Ga0495601_0000122 | 3300053077 | Bacteria | 43268 |
| 622 | Ga0495601_0010614 | 3300053077 | Bacteria | 5488 |
| 623 | Ga0495601_0102825 | 3300053077 | Bacteria | 1846 |
| 624 | Ga0495601_0107034 | 3300053077 | Bacteria | 1809 |
| 625 | Ga0495601_0113911 | 3300053077 | Bacteria | 1753 |
| 626 | Ga0495601_0172652 | 3300053077 | Bacteria | 1413 |
| 627 | Ga0495612_0000418 | 3300053078 | Bacteria | 16966 |
| 628 | Ga0495612_0013575 | 3300053078 | Bacteria | 3280 |
| 629 | Ga0495655_0000011 | 3300053083 | Bacteria | 118490 |
| 630 | Ga0495655_0003598 | 3300053083 | Bacteria | 2572 |
| 631 | Ga0495595_0000014 | 3300053084 | Bacteria | 145255 |
| 632 | Ga0495595_0000832 | 3300053084 | Bacteria | 11806 |
| 633 | Ga0495595_0060281 | 3300053084 | Bacteria | 1776 |
| 634 | Ga0495619_0000001 | 3300053085 | Bacteria | 586054 |
| 635 | Ga0495619_0000022 | 3300053085 | Bacteria | 184144 |
| 636 | Ga0495619_0000114 | 3300053085 | Bacteria | 59624 |
| 637 | Ga0495619_0002345 | 3300053085 | Bacteria | 12464 |
| 638 | Ga0495619_0006842 | 3300053085 | Bacteria | 7207 |
| 639 | Ga0495619_0015275 | 3300053085 | Bacteria | 4855 |
| 640 | Ga0495619_0038350 | 3300053085 | Bacteria | 3125 |
| 641 | Ga0500566_0049493 | 3300053094 | Bacteria | 2407 |
| 642 | Ga0500595_019359 | 3300053119 | Bacteria | 2471 |
| 643 | Ga0500614_007233 | 3300053123 | Bacteria | 2338 |
| 644 | Ga0500628_000058 | 3300053129 | Bacteria | 32870 |
| 645 | Ga0500658_0126809 | 3300053134 | Bacteria | 1135 |
| 646 | Ga0501084_0115304 | 3300054114 | Bacteria | 2258 |
| 647 | Ga0501084_0121720 | 3300054114 | Bacteria | 2194 |
| 648 | Ga0501082_0102835 | 3300060353 | Bacteria | 2471 |
| 649 | Ga0501082_0114469 | 3300060353 | Bacteria | 2335 |
| 650 | Ga0530510_0013748 | 3300061734 | Bacteria | 5698 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009148 | Ga0105243_10413709 | Ga0105243_104137092 | 298 |
| 2 | 3300048915 | Ga0496112_0156243 | Ga0496112_0156243_26_928 | 299 |
| 3 | 3300041512 | Ga0451853_4000083 | Ga0451853_4000083_479_1540 | 305 |
| 4 | 3300035111 | Ga0373923_0001923 | Ga0373923_0001923_3399_4334 | 306 |
| 5 | 3300048916 | Ga0496113_0010806 | Ga0496113_0010806_289_1281 | 307 |
| 6 | 3300039437 | Ga0436365_1906577 | Ga0436365_1906577_2626_3630 | 308 |
| 7 | 3300046455 | Ga0495603_0001106 | Ga0495603_0001106_34_969 | 310 |
| 8 | 3300044656 | Ga0466969_0027736 | Ga0466969_0027736_959_1900 | 312 |
| 9 | 3300045049 | Ga0466959_0009827 | Ga0466959_0009827_2945_3886 | 312 |
| 10 | 3300053083 | Ga0495655_0003598 | Ga0495655_0003598_257_1198 | 312 |
| 11 | 3300044694 | Ga0466963_0104967 | Ga0466963_0104967_396_1352 | 317 |
| 12 | 3300005530 | Ga0070679_100065841 | Ga0070679_1000658413 | 319 |
| 13 | 3300025921 | Ga0207652_10038430 | Ga0207652_100384303 | 319 |
| 14 | 3300049586 | Ga0501070_0004256 | Ga0501070_0004256_10404_11405 | 319 |
| 15 | 3300049590 | Ga0501074_0117989 | Ga0501074_0117989_617_1618 | 319 |
| 16 | 3300049742 | Ga0501080_0057304 | Ga0501080_0057304_103_1104 | 319 |
| 17 | 3300005339 | Ga0070660_100070178 | Ga0070660_1000701781 | 322 |
| 18 | 3300005340 | Ga0070689_100136377 | Ga0070689_1001363771 | 322 |
| 19 | 3300005366 | Ga0070659_100010273 | Ga0070659_1000102739 | 322 |
| 20 | 3300005457 | Ga0070662_100186049 | Ga0070662_1001860492 | 322 |
| 21 | 3300005545 | Ga0070695_100083214 | Ga0070695_1000832142 | 322 |
| 22 | 3300005564 | Ga0070664_100128393 | Ga0070664_1001283933 | 322 |
| 23 | 3300005614 | Ga0068856_100073970 | Ga0068856_1000739704 | 322 |
| 24 | 3300005616 | Ga0068852_100083820 | Ga0068852_1000838203 | 322 |
| 25 | 3300005617 | Ga0068859_100302192 | Ga0068859_1003021922 | 322 |
| 26 | 3300006931 | Ga0097620_100302205 | Ga0097620_1003022052 | 322 |
| 27 | 3300009101 | Ga0105247_10058118 | Ga0105247_100581183 | 322 |
| 28 | 3300009553 | Ga0105249_10058194 | Ga0105249_100581943 | 322 |
| 29 | 3300011119 | Ga0105246_10122004 | Ga0105246_101220042 | 322 |
| 30 | 3300013296 | Ga0157374_10216794 | Ga0157374_102167941 | 322 |
| 31 | 3300013307 | Ga0157372_10078118 | Ga0157372_100781184 | 322 |
| 32 | 3300014326 | Ga0157380_10034374 | Ga0157380_100343742 | 322 |
| 33 | 3300014969 | Ga0157376_10418534 | Ga0157376_104185341 | 322 |
| 34 | 3300025901 | Ga0207688_10037725 | Ga0207688_100377253 | 322 |
| 35 | 3300025907 | Ga0207645_10117181 | Ga0207645_101171812 | 322 |
| 36 | 3300025915 | Ga0207693_10040592 | Ga0207693_100405923 | 322 |
| 37 | 3300025918 | Ga0207662_10114478 | Ga0207662_101144782 | 322 |
| 38 | 3300025933 | Ga0207706_10206341 | Ga0207706_102063412 | 322 |
| 39 | 3300025941 | Ga0207711_10277549 | Ga0207711_102775492 | 322 |
| 40 | 3300025944 | Ga0207661_10090944 | Ga0207661_100909443 | 322 |
| 41 | 3300026067 | Ga0207678_10066757 | Ga0207678_100667573 | 322 |
| 42 | 3300026078 | Ga0207702_10333035 | Ga0207702_103330352 | 322 |
| 43 | 3300026088 | Ga0207641_10451023 | Ga0207641_104510232 | 322 |
| 44 | 3300028379 | Ga0268266_10066807 | Ga0268266_100668074 | 322 |
| 45 | 3300028380 | Ga0268265_10065259 | Ga0268265_100652592 | 322 |
| 46 | 3300028381 | Ga0268264_10269689 | Ga0268264_102696891 | 322 |
| 47 | 3300048907 | Ga0496104_0082417 | Ga0496104_0082417_1572_2573 | 322 |
| 48 | 3300048909 | Ga0496106_0048658 | Ga0496106_0048658_1686_2687 | 322 |
| 49 | 3300048911 | Ga0496108_0043488 | Ga0496108_0043488_2623_3624 | 322 |
| 50 | 3300048912 | Ga0496109_0110113 | Ga0496109_0110113_23_1024 | 322 |
| 51 | 3300048915 | Ga0496112_0043399 | Ga0496112_0043399_928_1929 | 322 |
| 52 | 3300048916 | Ga0496113_0005783 | Ga0496113_0005783_4963_5964 | 322 |
| 53 | 3300006844 | Ga0075428_100207514 | Ga0075428_1002075141 | 323 |
| 54 | 3300006847 | Ga0075431_100037610 | Ga0075431_1000376102 | 323 |
| 55 | 3300006871 | Ga0075434_100081845 | Ga0075434_1000818451 | 323 |
| 56 | 3300009094 | Ga0111539_10042787 | Ga0111539_100427875 | 323 |
| 57 | 3300009147 | Ga0114129_10067032 | Ga0114129_100670326 | 323 |
| 58 | 3300050507 | nmdc:mga05p37_560917_c1 | nmdc:mga05p37_560917_c1_94_1098 | 323 |
| 59 | 3300050511 | nmdc:mga08y16_56116_c1 | nmdc:mga08y16_56116_c1_2862_3866 | 323 |
| 60 | 3300005337 | Ga0070682_100072821 | Ga0070682_1000728212 | 324 |
| 61 | 3300009098 | Ga0105245_10000283 | Ga0105245_1000028330 | 324 |
| 62 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007158 | 324 |
| 63 | 3300025961 | Ga0207712_10000007 | Ga0207712_10000007111 | 324 |
| 64 | 3300048907 | Ga0496104_0000727 | Ga0496104_0000727_24124_25113 | 324 |
| 65 | 3300005335 | Ga0070666_10029130 | Ga0070666_100291302 | 325 |
| 66 | 3300005548 | Ga0070665_100005634 | Ga0070665_1000056349 | 325 |
| 67 | 3300005616 | Ga0068852_100000012 | Ga0068852_10000001290 | 325 |
| 68 | 3300025903 | Ga0207680_10002472 | Ga0207680_100024724 | 325 |
| 69 | 3300026142 | Ga0207698_10000012 | Ga0207698_10000012209 | 325 |
| 70 | 3300026142 | Ga0207698_10004988 | Ga0207698_100049887 | 325 |
| 71 | 3300028379 | Ga0268266_10002478 | Ga0268266_100024785 | 325 |
| 72 | 3300045976 | Ga0466967_0170884 | Ga0466967_0170884_978_1970 | 325 |
| 73 | 3300046674 | Ga0495588_0000198 | Ga0495588_0000198_25672_26670 | 325 |
| 74 | 3300048916 | Ga0496113_0124379 | Ga0496113_0124379_37_1056 | 325 |
| 75 | 3300005535 | Ga0070684_100087546 | Ga0070684_1000875462 | 326 |
| 76 | 3300009148 | Ga0105243_10026965 | Ga0105243_100269654 | 326 |
| 77 | 3300025935 | Ga0207709_10012655 | Ga0207709_100126552 | 326 |
| 78 | 3300025944 | Ga0207661_10021523 | Ga0207661_100215232 | 326 |
| 79 | 3300026118 | Ga0207675_100143311 | Ga0207675_1001433112 | 326 |
| 80 | 3300028563 | Ga0265319_1000015 | Ga0265319_1000015161 | 326 |
| 81 | 3300046463 | Ga0495653_0100162 | Ga0495653_0100162_340_1326 | 326 |
| 82 | 3300046516 | Ga0495628_0000323 | Ga0495628_0000323_28458_29456 | 326 |
| 83 | 3300048088 | Ga0495602_0007041 | Ga0495602_0007041_1532_2530 | 326 |
| 84 | 3300006028 | Ga0070717_10000006 | Ga0070717_10000006113 | 327 |
| 85 | 3300032002 | Ga0307416_100585422 | Ga0307416_1005854222 | 327 |
| 86 | 3300044694 | Ga0466963_0013010 | Ga0466963_0013010_3089_4084 | 327 |
| 87 | 3300045836 | Ga0466958_0189258 | Ga0466958_0189258_86_1078 | 327 |
| 88 | 3300046517 | Ga0495630_0000219 | Ga0495630_0000219_18805_19797 | 327 |
| 89 | 3300046529 | Ga0495652_0054038 | Ga0495652_0054038_436_1425 | 327 |
| 90 | 3300046543 | Ga0495645_0044560 | Ga0495645_0044560_1512_2501 | 327 |
| 91 | 3300046675 | Ga0495657_0000011 | Ga0495657_0000011_25614_26606 | 327 |
| 92 | 3300048913 | Ga0496110_0547254 | Ga0496110_0547254_20_1015 | 327 |
| 93 | 3300048924 | Ga0496121_0004246 | Ga0496121_0004246_7576_8565 | 327 |
| 94 | 3300049569 | Ga0501032_0161499 | Ga0501032_0161499_104_1096 | 327 |
| 95 | 3300049572 | Ga0501036_0004810 | Ga0501036_0004810_248_1240 | 327 |
| 96 | 3300049574 | Ga0501038_0077775 | Ga0501038_0077775_711_1703 | 327 |
| 97 | 3300049575 | Ga0501039_0005821 | Ga0501039_0005821_7818_8810 | 327 |
| 98 | 3300049576 | Ga0501040_0001151 | Ga0501040_0001151_1843_2835 | 327 |
| 99 | 3300049578 | Ga0501042_0051615 | Ga0501042_0051615_532_1524 | 327 |
| 100 | 3300049579 | Ga0501043_0362925 | Ga0501043_0362925_76_1068 | 327 |
| 101 | 3300049580 | Ga0501046_0038885 | Ga0501046_0038885_255_1247 | 327 |
| 102 | 3300049582 | Ga0501048_0028246 | Ga0501048_0028246_2696_3688 | 327 |
| 103 | 3300049587 | Ga0501071_0000883 | Ga0501071_0000883_14978_15970 | 327 |
| 104 | 3300049588 | Ga0501072_0003041 | Ga0501072_0003041_10567_11559 | 327 |
| 105 | 3300049591 | Ga0501075_0007364 | Ga0501075_0007364_225_1217 | 327 |
| 106 | 3300049592 | Ga0501076_0016149 | Ga0501076_0016149_3572_4564 | 327 |
| 107 | 3300049593 | Ga0501077_0019637 | Ga0501077_0019637_2858_3850 | 327 |
| 108 | 3300049741 | Ga0501079_0018586 | Ga0501079_0018586_482_1474 | 327 |
| 109 | 3300049742 | Ga0501080_0256107 | Ga0501080_0256107_344_1336 | 327 |
| 110 | 3300049743 | Ga0501081_0005886 | Ga0501081_0005886_794_1786 | 327 |
| 111 | 3300049744 | Ga0501083_0028225 | Ga0501083_0028225_2738_3730 | 327 |
| 112 | 3300049824 | Ga0501045_0015644 | Ga0501045_0015644_3758_4750 | 327 |
| 113 | 3300053077 | Ga0495601_0172652 | Ga0495601_0172652_51_1040 | 327 |
| 114 | 3300054114 | Ga0501084_0115304 | Ga0501084_0115304_832_1824 | 327 |
| 115 | 3300060353 | Ga0501082_0102835 | Ga0501082_0102835_909_1901 | 327 |
| 116 | 3300061734 | Ga0530510_0013748 | Ga0530510_0013748_825_1817 | 327 |
| 117 | 3300005614 | Ga0068856_100118457 | Ga0068856_1001184572 | 328 |
| 118 | 3300005615 | Ga0070702_100134770 | Ga0070702_1001347702 | 328 |
| 119 | 3300005617 | Ga0068859_100094199 | Ga0068859_1000941994 | 328 |
| 120 | 3300006028 | Ga0070717_10049389 | Ga0070717_100493892 | 328 |
| 121 | 3300006048 | Ga0075363_100003580 | Ga0075363_1000035803 | 328 |
| 122 | 3300006175 | Ga0070712_100003065 | Ga0070712_1000030653 | 328 |
| 123 | 3300006237 | Ga0097621_100442234 | Ga0097621_1004422341 | 328 |
| 124 | 3300006931 | Ga0097620_100094205 | Ga0097620_1000942054 | 328 |
| 125 | 3300009094 | Ga0111539_10463583 | Ga0111539_104635831 | 328 |
| 126 | 3300009176 | Ga0105242_10141838 | Ga0105242_101418383 | 328 |
| 127 | 3300009553 | Ga0105249_10225495 | Ga0105249_102254952 | 328 |
| 128 | 3300013308 | Ga0157375_10590022 | Ga0157375_105900222 | 328 |
| 129 | 3300014326 | Ga0157380_10336822 | Ga0157380_103368222 | 328 |
| 130 | 3300014968 | Ga0157379_10006911 | Ga0157379_100069113 | 328 |
| 131 | 3300017792 | Ga0163161_10381362 | Ga0163161_103813621 | 328 |
| 132 | 3300025905 | Ga0207685_10019862 | Ga0207685_100198622 | 328 |
| 133 | 3300025915 | Ga0207693_10000234 | Ga0207693_1000023437 | 328 |
| 134 | 3300025918 | Ga0207662_10065932 | Ga0207662_100659322 | 328 |
| 135 | 3300025933 | Ga0207706_10083342 | Ga0207706_100833423 | 328 |
| 136 | 3300025934 | Ga0207686_10023583 | Ga0207686_100235834 | 328 |
| 137 | 3300025939 | Ga0207665_10007612 | Ga0207665_100076126 | 328 |
| 138 | 3300025949 | Ga0207667_10165896 | Ga0207667_101658962 | 328 |
| 139 | 3300026023 | Ga0207677_10067862 | Ga0207677_100678622 | 328 |
| 140 | 3300026078 | Ga0207702_10096026 | Ga0207702_100960262 | 328 |
| 141 | 3300026089 | Ga0207648_10059624 | Ga0207648_100596243 | 328 |
| 142 | 3300026118 | Ga0207675_100037724 | Ga0207675_1000377243 | 328 |
| 143 | 3300028558 | Ga0265326_10000017 | Ga0265326_1000001774 | 328 |
| 144 | 3300028573 | Ga0265334_10000029 | Ga0265334_1000002942 | 328 |
| 145 | 3300028800 | Ga0265338_10002565 | Ga0265338_100025658 | 328 |
| 146 | 3300035083 | Ga0373926_0000179 | Ga0373926_0000179_10562_11563 | 328 |
| 147 | 3300035089 | Ga0373944_0000082 | Ga0373944_0000082_2414_3415 | 328 |
| 148 | 3300035113 | Ga0373936_0007224 | Ga0373936_0007224_2309_3310 | 328 |
| 149 | 3300035116 | Ga0373945_0036661 | Ga0373945_0036661_267_1268 | 328 |
| 150 | 3300035170 | Ga0373943_0004661 | Ga0373943_0004661_2655_3656 | 328 |
| 151 | 3300035171 | Ga0373946_0003466 | Ga0373946_0003466_448_1449 | 328 |
| 152 | 3300035172 | Ga0373955_0013807 | Ga0373955_0013807_72_1073 | 328 |
| 153 | 3300035692 | Ga0373935_0001338 | Ga0373935_0001338_10413_11414 | 328 |
| 154 | 3300035695 | Ga0373927_0002208 | Ga0373927_0002208_2492_3493 | 328 |
| 155 | 3300035725 | Ga0373947_0019065 | Ga0373947_0019065_2254_3255 | 328 |
| 156 | 3300036401 | Ga0373937_0121515 | Ga0373937_0121515_837_1838 | 328 |
| 157 | 3300041494 | Ga0451837_0223618 | Ga0451837_0223618_19_1017 | 328 |
| 158 | 3300044901 | Ga0466960_0000026 | Ga0466960_0000026_9071_10066 | 328 |
| 159 | 3300045976 | Ga0466967_0262355 | Ga0466967_0262355_525_1523 | 328 |
| 160 | 3300046455 | Ga0495603_0005405 | Ga0495603_0005405_2419_3420 | 328 |
| 161 | 3300046459 | Ga0495629_0010791 | Ga0495629_0010791_2818_3819 | 328 |
| 162 | 3300046461 | Ga0495641_0002698 | Ga0495641_0002698_2736_3737 | 328 |
| 163 | 3300046462 | Ga0495651_0324921 | Ga0495651_0324921_12_1001 | 328 |
| 164 | 3300046472 | Ga0495580_0006076 | Ga0495580_0006076_8715_9716 | 328 |
| 165 | 3300046473 | Ga0495582_0008275 | Ga0495582_0008275_4043_5044 | 328 |
| 166 | 3300046475 | Ga0495639_0001804 | Ga0495639_0001804_2945_3946 | 328 |
| 167 | 3300046476 | Ga0495662_0005633 | Ga0495662_0005633_2836_3837 | 328 |
| 168 | 3300046517 | Ga0495630_0001411 | Ga0495630_0001411_2273_3274 | 328 |
| 169 | 3300046526 | Ga0495666_0007744 | Ga0495666_0007744_2945_3946 | 328 |
| 170 | 3300046531 | Ga0495665_0001243 | Ga0495665_0001243_7378_8379 | 328 |
| 171 | 3300046533 | Ga0495640_0002638 | Ga0495640_0002638_13078_14079 | 328 |
| 172 | 3300046535 | Ga0495586_0007859 | Ga0495586_0007859_959_1960 | 328 |
| 173 | 3300046535 | Ga0495586_0025731 | Ga0495586_0025731_896_1897 | 328 |
| 174 | 3300046642 | Ga0495634_0002651 | Ga0495634_0002651_3729_4730 | 328 |
| 175 | 3300046663 | Ga0495635_0003860 | Ga0495635_0003860_5209_6210 | 328 |
| 176 | 3300046674 | Ga0495588_0004283 | Ga0495588_0004283_1927_2928 | 328 |
| 177 | 3300046683 | Ga0495658_0000323 | Ga0495658_0000323_14204_15205 | 328 |
| 178 | 3300046689 | Ga0495613_0002559 | Ga0495613_0002559_10435_11436 | 328 |
| 179 | 3300046690 | Ga0495624_0002323 | Ga0495624_0002323_10813_11814 | 328 |
| 180 | 3300047315 | Ga0495581_0016160 | Ga0495581_0016160_2224_3225 | 328 |
| 181 | 3300047319 | Ga0495674_0001737 | Ga0495674_0001737_13758_14759 | 328 |
| 182 | 3300047322 | Ga0495680_0003586 | Ga0495680_0003586_13879_14880 | 328 |
| 183 | 3300047471 | Ga0495684_0075062 | Ga0495684_0075062_1311_2312 | 328 |
| 184 | 3300047673 | Ga0495593_0008941 | Ga0495593_0008941_2163_3164 | 328 |
| 185 | 3300048089 | Ga0495614_0005735 | Ga0495614_0005735_4229_5230 | 328 |
| 186 | 3300048904 | Ga0496101_0122630 | Ga0496101_0122630_67_1071 | 328 |
| 187 | 3300048906 | Ga0496103_0094999 | Ga0496103_0094999_414_1415 | 328 |
| 188 | 3300048907 | Ga0496104_0098288 | Ga0496104_0098288_1220_2221 | 328 |
| 189 | 3300048908 | Ga0496105_0076170 | Ga0496105_0076170_1608_2612 | 328 |
| 190 | 3300048910 | Ga0496107_0013416 | Ga0496107_0013416_2597_3601 | 328 |
| 191 | 3300048910 | Ga0496107_0021983 | Ga0496107_0021983_3355_4356 | 328 |
| 192 | 3300048911 | Ga0496108_0091681 | Ga0496108_0091681_512_1516 | 328 |
| 193 | 3300048912 | Ga0496109_0043682 | Ga0496109_0043682_336_1340 | 328 |
| 194 | 3300048912 | Ga0496109_0185105 | Ga0496109_0185105_328_1332 | 328 |
| 195 | 3300048913 | Ga0496110_0068583 | Ga0496110_0068583_875_1879 | 328 |
| 196 | 3300048914 | Ga0496111_0050344 | Ga0496111_0050344_1379_2380 | 328 |
| 197 | 3300048915 | Ga0496112_0006769 | Ga0496112_0006769_2683_3687 | 328 |
| 198 | 3300048915 | Ga0496112_0066655 | Ga0496112_0066655_732_1736 | 328 |
| 199 | 3300048916 | Ga0496113_0049681 | Ga0496113_0049681_85_1089 | 328 |
| 200 | 3300048917 | Ga0496114_0315721 | Ga0496114_0315721_251_1252 | 328 |
| 201 | 3300049742 | Ga0501080_0100266 | Ga0501080_0100266_1026_2042 | 328 |
| 202 | 3300005343 | Ga0070687_100014608 | Ga0070687_1000146082 | 329 |
| 203 | 3300005441 | Ga0070700_100073273 | Ga0070700_1000732732 | 329 |
| 204 | 3300005548 | Ga0070665_100077446 | Ga0070665_1000774463 | 329 |
| 205 | 3300005615 | Ga0070702_100118625 | Ga0070702_1001186252 | 329 |
| 206 | 3300005719 | Ga0068861_100130836 | Ga0068861_1001308362 | 329 |
| 207 | 3300009098 | Ga0105245_10013269 | Ga0105245_100132695 | 329 |
| 208 | 3300009148 | Ga0105243_10069228 | Ga0105243_100692283 | 329 |
| 209 | 3300010375 | Ga0105239_10547380 | Ga0105239_105473802 | 329 |
| 210 | 3300014325 | Ga0163163_10214330 | Ga0163163_102143302 | 329 |
| 211 | 3300025899 | Ga0207642_10028650 | Ga0207642_100286502 | 329 |
| 212 | 3300025909 | Ga0207705_10236379 | Ga0207705_102363792 | 329 |
| 213 | 3300025918 | Ga0207662_10031594 | Ga0207662_100315943 | 329 |
| 214 | 3300025935 | Ga0207709_10095975 | Ga0207709_100959752 | 329 |
| 215 | 3300025944 | Ga0207661_10041366 | Ga0207661_100413664 | 329 |
| 216 | 3300026023 | Ga0207677_10113112 | Ga0207677_101131122 | 329 |
| 217 | 3300026075 | Ga0207708_10032427 | Ga0207708_100324273 | 329 |
| 218 | 3300026118 | Ga0207675_100085534 | Ga0207675_1000855343 | 329 |
| 219 | 3300028379 | Ga0268266_10272544 | Ga0268266_102725442 | 329 |
| 220 | 3300044693 | Ga0466961_0064016 | Ga0466961_0064016_1078_2076 | 329 |
| 221 | 3300044842 | Ga0466957_0079885 | Ga0466957_0079885_347_1372 | 329 |
| 222 | 3300046455 | Ga0495603_0000428 | Ga0495603_0000428_13266_14261 | 329 |
| 223 | 3300046523 | Ga0495644_0000532 | Ga0495644_0000532_1012_2007 | 329 |
| 224 | 3300046681 | Ga0495647_0083834 | Ga0495647_0083834_39_1034 | 329 |
| 225 | 3300046689 | Ga0495613_0000352 | Ga0495613_0000352_20362_21387 | 329 |
| 226 | 3300048088 | Ga0495602_0000021 | Ga0495602_0000021_9080_10105 | 329 |
| 227 | 3300048905 | Ga0496102_0323343 | Ga0496102_0323343_314_1321 | 329 |
| 228 | 3300048912 | Ga0496109_0097659 | Ga0496109_0097659_849_1856 | 329 |
| 229 | 3300049582 | Ga0501048_0059339 | Ga0501048_0059339_640_1638 | 329 |
| 230 | 3300049586 | Ga0501070_0074025 | Ga0501070_0074025_1053_2051 | 329 |
| 231 | 3300053077 | Ga0495601_0000122 | Ga0495601_0000122_22900_23925 | 329 |
| 232 | 3300001977 | JGI24746J21847_1000347 | JGI24746J21847_10003477 | 330 |
| 233 | 3300001979 | JGI24740J21852_10000416 | JGI24740J21852_100004162 | 330 |
| 234 | 3300002239 | JGI24034J26672_10000247 | JGI24034J26672_100002473 | 330 |
| 235 | 3300002244 | JGI24742J22300_10005798 | JGI24742J22300_100057983 | 330 |
| 236 | 3300005329 | Ga0070683_100002179 | Ga0070683_10000217911 | 330 |
| 237 | 3300005329 | Ga0070683_100024848 | Ga0070683_1000248485 | 330 |
| 238 | 3300005329 | Ga0070683_100032004 | Ga0070683_1000320043 | 330 |
| 239 | 3300005329 | Ga0070683_100037511 | Ga0070683_1000375115 | 330 |
| 240 | 3300005333 | Ga0070677_10000001 | Ga0070677_1000000122 | 330 |
| 241 | 3300005336 | Ga0070680_100002015 | Ga0070680_1000020158 | 330 |
| 242 | 3300005337 | Ga0070682_100000028 | Ga0070682_10000002824 | 330 |
| 243 | 3300005337 | Ga0070682_100000080 | Ga0070682_10000008085 | 330 |
| 244 | 3300005338 | Ga0068868_100000508 | Ga0068868_1000005084 | 330 |
| 245 | 3300005338 | Ga0068868_100001902 | Ga0068868_1000019028 | 330 |
| 246 | 3300005339 | Ga0070660_100054293 | Ga0070660_1000542934 | 330 |
| 247 | 3300005340 | Ga0070689_100058975 | Ga0070689_1000589752 | 330 |
| 248 | 3300005341 | Ga0070691_10000054 | Ga0070691_1000005435 | 330 |
| 249 | 3300005341 | Ga0070691_10003684 | Ga0070691_100036842 | 330 |
| 250 | 3300005344 | Ga0070661_100060369 | Ga0070661_1000603694 | 330 |
| 251 | 3300005354 | Ga0070675_100000192 | Ga0070675_1000001925 | 330 |
| 252 | 3300005356 | Ga0070674_100000025 | Ga0070674_10000002549 | 330 |
| 253 | 3300005356 | Ga0070674_100000072 | Ga0070674_10000007229 | 330 |
| 254 | 3300005356 | Ga0070674_100048655 | Ga0070674_1000486553 | 330 |
| 255 | 3300005364 | Ga0070673_100026099 | Ga0070673_1000260992 | 330 |
| 256 | 3300005365 | Ga0070688_100000012 | Ga0070688_1000000123 | 330 |
| 257 | 3300005366 | Ga0070659_100005685 | Ga0070659_1000056854 | 330 |
| 258 | 3300005366 | Ga0070659_100024609 | Ga0070659_1000246092 | 330 |
| 259 | 3300005436 | Ga0070713_100000933 | Ga0070713_10000093315 | 330 |
| 260 | 3300005456 | Ga0070678_100010186 | Ga0070678_1000101862 | 330 |
| 261 | 3300005457 | Ga0070662_100000007 | Ga0070662_100000007143 | 330 |
| 262 | 3300005458 | Ga0070681_10003446 | Ga0070681_1000344610 | 330 |
| 263 | 3300005458 | Ga0070681_10006943 | Ga0070681_100069437 | 330 |
| 264 | 3300005458 | Ga0070681_10119236 | Ga0070681_101192362 | 330 |
| 265 | 3300005466 | Ga0070685_10000018 | Ga0070685_1000001886 | 330 |
| 266 | 3300005466 | Ga0070685_10004378 | Ga0070685_100043787 | 330 |
| 267 | 3300005530 | Ga0070679_100001155 | Ga0070679_10000115523 | 330 |
| 268 | 3300005530 | Ga0070679_100003123 | Ga0070679_1000031232 | 330 |
| 269 | 3300005530 | Ga0070679_100005368 | Ga0070679_1000053687 | 330 |
| 270 | 3300005535 | Ga0070684_100007381 | Ga0070684_10000738110 | 330 |
| 271 | 3300005535 | Ga0070684_100013372 | Ga0070684_1000133722 | 330 |
| 272 | 3300005535 | Ga0070684_100037690 | Ga0070684_1000376902 | 330 |
| 273 | 3300005535 | Ga0070684_100038974 | Ga0070684_1000389744 | 330 |
| 274 | 3300005535 | Ga0070684_100434378 | Ga0070684_1004343781 | 330 |
| 275 | 3300005539 | Ga0068853_100042227 | Ga0068853_1000422272 | 330 |
| 276 | 3300005539 | Ga0068853_100183188 | Ga0068853_1001831882 | 330 |
| 277 | 3300005543 | Ga0070672_100000004 | Ga0070672_100000004110 | 330 |
| 278 | 3300005547 | Ga0070693_100012538 | Ga0070693_1000125382 | 330 |
| 279 | 3300005548 | Ga0070665_100000202 | Ga0070665_10000020253 | 330 |
| 280 | 3300005548 | Ga0070665_100119390 | Ga0070665_1001193903 | 330 |
| 281 | 3300005563 | Ga0068855_100194342 | Ga0068855_1001943421 | 330 |
| 282 | 3300005564 | Ga0070664_100042743 | Ga0070664_1000427432 | 330 |
| 283 | 3300005578 | Ga0068854_100001007 | Ga0068854_1000010077 | 330 |
| 284 | 3300005578 | Ga0068854_100168562 | Ga0068854_1001685622 | 330 |
| 285 | 3300005614 | Ga0068856_100002319 | Ga0068856_1000023197 | 330 |
| 286 | 3300005614 | Ga0068856_100115439 | Ga0068856_1001154392 | 330 |
| 287 | 3300005615 | Ga0070702_100065930 | Ga0070702_1000659302 | 330 |
| 288 | 3300005618 | Ga0068864_100000024 | Ga0068864_100000024245 | 330 |
| 289 | 3300005718 | Ga0068866_10000001 | Ga0068866_10000001128 | 330 |
| 290 | 3300005718 | Ga0068866_10000734 | Ga0068866_100007348 | 330 |
| 291 | 3300005834 | Ga0068851_10005932 | Ga0068851_100059324 | 330 |
| 292 | 3300005841 | Ga0068863_100000004 | Ga0068863_100000004294 | 330 |
| 293 | 3300005841 | Ga0068863_100008698 | Ga0068863_1000086984 | 330 |
| 294 | 3300005841 | Ga0068863_100108343 | Ga0068863_1001083432 | 330 |
| 295 | 3300005842 | Ga0068858_100000017 | Ga0068858_10000001726 | 330 |
| 296 | 3300005842 | Ga0068858_100201790 | Ga0068858_1002017903 | 330 |
| 297 | 3300005842 | Ga0068858_100269912 | Ga0068858_1002699122 | 330 |
| 298 | 3300005843 | Ga0068860_100008044 | Ga0068860_1000080446 | 330 |
| 299 | 3300005843 | Ga0068860_100246579 | Ga0068860_1002465791 | 330 |
| 300 | 3300005844 | Ga0068862_100007085 | Ga0068862_1000070857 | 330 |
| 301 | 3300005937 | Ga0081455_10013362 | Ga0081455_100133623 | 330 |
| 302 | 3300005937 | Ga0081455_10155826 | Ga0081455_101558262 | 330 |
| 303 | 3300005983 | Ga0081540_1000006 | Ga0081540_1000006108 | 330 |
| 304 | 3300005985 | Ga0081539_10001003 | Ga0081539_100010037 | 330 |
| 305 | 3300006163 | Ga0070715_10000001 | Ga0070715_10000001102 | 330 |
| 306 | 3300006173 | Ga0070716_100214027 | Ga0070716_1002140272 | 330 |
| 307 | 3300006175 | Ga0070712_100002610 | Ga0070712_1000026106 | 330 |
| 308 | 3300006358 | Ga0068871_100094416 | Ga0068871_1000944161 | 330 |
| 309 | 3300006852 | Ga0075433_10000101 | Ga0075433_100001014 | 330 |
| 310 | 3300006881 | Ga0068865_100000101 | Ga0068865_10000010114 | 330 |
| 311 | 3300009093 | Ga0105240_10033121 | Ga0105240_100331218 | 330 |
| 312 | 3300009098 | Ga0105245_10000098 | Ga0105245_10000098124 | 330 |
| 313 | 3300009098 | Ga0105245_10000969 | Ga0105245_1000096917 | 330 |
| 314 | 3300009101 | Ga0105247_10004151 | Ga0105247_100041516 | 330 |
| 315 | 3300009176 | Ga0105242_10000357 | Ga0105242_100003576 | 330 |
| 316 | 3300009176 | Ga0105242_10000959 | Ga0105242_1000095911 | 330 |
| 317 | 3300009176 | Ga0105242_10096417 | Ga0105242_100964173 | 330 |
| 318 | 3300009177 | Ga0105248_10000032 | Ga0105248_10000032157 | 330 |
| 319 | 3300009545 | Ga0105237_10048234 | Ga0105237_100482344 | 330 |
| 320 | 3300009551 | Ga0105238_10018276 | Ga0105238_100182767 | 330 |
| 321 | 3300009553 | Ga0105249_10000074 | Ga0105249_10000074109 | 330 |
| 322 | 3300009553 | Ga0105249_10008161 | Ga0105249_100081613 | 330 |
| 323 | 3300010375 | Ga0105239_10153103 | Ga0105239_101531033 | 330 |
| 324 | 3300011119 | Ga0105246_10048671 | Ga0105246_100486713 | 330 |
| 325 | 3300013102 | Ga0157371_10003923 | Ga0157371_1000392313 | 330 |
| 326 | 3300013104 | Ga0157370_10019335 | Ga0157370_100193355 | 330 |
| 327 | 3300013104 | Ga0157370_10019970 | Ga0157370_100199705 | 330 |
| 328 | 3300013104 | Ga0157370_10059308 | Ga0157370_100593082 | 330 |
| 329 | 3300013105 | Ga0157369_10000142 | Ga0157369_1000014297 | 330 |
| 330 | 3300013297 | Ga0157378_10003055 | Ga0157378_1000305511 | 330 |
| 331 | 3300013297 | Ga0157378_10131586 | Ga0157378_101315862 | 330 |
| 332 | 3300013307 | Ga0157372_10002742 | Ga0157372_100027426 | 330 |
| 333 | 3300013307 | Ga0157372_10152997 | Ga0157372_101529973 | 330 |
| 334 | 3300013308 | Ga0157375_10000194 | Ga0157375_1000019430 | 330 |
| 335 | 3300013308 | Ga0157375_10002378 | Ga0157375_1000237812 | 330 |
| 336 | 3300013308 | Ga0157375_10071669 | Ga0157375_100716692 | 330 |
| 337 | 3300014326 | Ga0157380_10000138 | Ga0157380_1000013839 | 330 |
| 338 | 3300014326 | Ga0157380_10008530 | Ga0157380_100085305 | 330 |
| 339 | 3300014968 | Ga0157379_10027103 | Ga0157379_100271032 | 330 |
| 340 | 3300014969 | Ga0157376_10005648 | Ga0157376_100056484 | 330 |
| 341 | 3300014969 | Ga0157376_10288785 | Ga0157376_102887851 | 330 |
| 342 | 3300017792 | Ga0163161_10000032 | Ga0163161_1000003220 | 330 |
| 343 | 3300017792 | Ga0163161_10401625 | Ga0163161_104016251 | 330 |
| 344 | 3300020070 | Ga0206356_10658233 | Ga0206356_106582332 | 330 |
| 345 | 3300020082 | Ga0206353_10830263 | Ga0206353_108302633 | 330 |
| 346 | 3300021377 | Ga0213874_10006302 | Ga0213874_100063022 | 330 |
| 347 | 3300021384 | Ga0213876_10021062 | Ga0213876_100210623 | 330 |
| 348 | 3300022467 | Ga0224712_10054332 | Ga0224712_100543322 | 330 |
| 349 | 3300025321 | Ga0207656_10003397 | Ga0207656_100033972 | 330 |
| 350 | 3300025893 | Ga0207682_10000053 | Ga0207682_1000005328 | 330 |
| 351 | 3300025899 | Ga0207642_10000006 | Ga0207642_10000006131 | 330 |
| 352 | 3300025899 | Ga0207642_10000007 | Ga0207642_10000007104 | 330 |
| 353 | 3300025899 | Ga0207642_10000068 | Ga0207642_1000006824 | 330 |
| 354 | 3300025900 | Ga0207710_10000580 | Ga0207710_1000058013 | 330 |
| 355 | 3300025905 | Ga0207685_10000011 | Ga0207685_10000011102 | 330 |
| 356 | 3300025912 | Ga0207707_10004923 | Ga0207707_100049236 | 330 |
| 357 | 3300025912 | Ga0207707_10022186 | Ga0207707_100221865 | 330 |
| 358 | 3300025914 | Ga0207671_10035293 | Ga0207671_100352932 | 330 |
| 359 | 3300025916 | Ga0207663_10343825 | Ga0207663_103438251 | 330 |
| 360 | 3300025917 | Ga0207660_10010713 | Ga0207660_100107134 | 330 |
| 361 | 3300025917 | Ga0207660_10068939 | Ga0207660_100689393 | 330 |
| 362 | 3300025919 | Ga0207657_10065933 | Ga0207657_100659332 | 330 |
| 363 | 3300025920 | Ga0207649_10000640 | Ga0207649_1000064020 | 330 |
| 364 | 3300025920 | Ga0207649_10043307 | Ga0207649_100433071 | 330 |
| 365 | 3300025921 | Ga0207652_10000549 | Ga0207652_100005493 | 330 |
| 366 | 3300025921 | Ga0207652_10002646 | Ga0207652_100026462 | 330 |
| 367 | 3300025921 | Ga0207652_10003833 | Ga0207652_100038339 | 330 |
| 368 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004703 | 330 |
| 369 | 3300025926 | Ga0207659_10000020 | Ga0207659_1000002031 | 330 |
| 370 | 3300025927 | Ga0207687_10000055 | Ga0207687_1000005522 | 330 |
| 371 | 3300025927 | Ga0207687_10000822 | Ga0207687_100008226 | 330 |
| 372 | 3300025927 | Ga0207687_10135770 | Ga0207687_101357702 | 330 |
| 373 | 3300025928 | Ga0207700_10000070 | Ga0207700_1000007026 | 330 |
| 374 | 3300025928 | Ga0207700_10323531 | Ga0207700_103235312 | 330 |
| 375 | 3300025932 | Ga0207690_10005424 | Ga0207690_100054247 | 330 |
| 376 | 3300025932 | Ga0207690_10075144 | Ga0207690_100751442 | 330 |
| 377 | 3300025933 | Ga0207706_10000018 | Ga0207706_1000001843 | 330 |
| 378 | 3300025934 | Ga0207686_10000156 | Ga0207686_1000015632 | 330 |
| 379 | 3300025934 | Ga0207686_10001286 | Ga0207686_1000128610 | 330 |
| 380 | 3300025936 | Ga0207670_10044767 | Ga0207670_100447673 | 330 |
| 381 | 3300025936 | Ga0207670_10093790 | Ga0207670_100937902 | 330 |
| 382 | 3300025937 | Ga0207669_10000009 | Ga0207669_10000009127 | 330 |
| 383 | 3300025937 | Ga0207669_10000087 | Ga0207669_1000008730 | 330 |
| 384 | 3300025937 | Ga0207669_10075110 | Ga0207669_100751102 | 330 |
| 385 | 3300025938 | Ga0207704_10000025 | Ga0207704_10000025125 | 330 |
| 386 | 3300025940 | Ga0207691_10000020 | Ga0207691_1000002016 | 330 |
| 387 | 3300025941 | Ga0207711_10000020 | Ga0207711_10000020217 | 330 |
| 388 | 3300025944 | Ga0207661_10002561 | Ga0207661_100025616 | 330 |
| 389 | 3300025944 | Ga0207661_10003274 | Ga0207661_100032747 | 330 |
| 390 | 3300025944 | Ga0207661_10010893 | Ga0207661_100108935 | 330 |
| 391 | 3300025944 | Ga0207661_10033670 | Ga0207661_100336701 | 330 |
| 392 | 3300025945 | Ga0207679_10015156 | Ga0207679_100151564 | 330 |
| 393 | 3300025945 | Ga0207679_10085354 | Ga0207679_100853542 | 330 |
| 394 | 3300025949 | Ga0207667_10163489 | Ga0207667_101634893 | 330 |
| 395 | 3300025960 | Ga0207651_10014509 | Ga0207651_100145094 | 330 |
| 396 | 3300025981 | Ga0207640_10000285 | Ga0207640_1000028536 | 330 |
| 397 | 3300025981 | Ga0207640_10156843 | Ga0207640_101568431 | 330 |
| 398 | 3300025986 | Ga0207658_10009883 | Ga0207658_100098832 | 330 |
| 399 | 3300026023 | Ga0207677_10003454 | Ga0207677_100034541 | 330 |
| 400 | 3300026023 | Ga0207677_10071795 | Ga0207677_100717953 | 330 |
| 401 | 3300026035 | Ga0207703_10000030 | Ga0207703_1000003027 | 330 |
| 402 | 3300026035 | Ga0207703_10003621 | Ga0207703_100036214 | 330 |
| 403 | 3300026035 | Ga0207703_10068420 | Ga0207703_100684203 | 330 |
| 404 | 3300026035 | Ga0207703_10107480 | Ga0207703_101074802 | 330 |
| 405 | 3300026041 | Ga0207639_10034550 | Ga0207639_100345502 | 330 |
| 406 | 3300026041 | Ga0207639_10044598 | Ga0207639_100445982 | 330 |
| 407 | 3300026041 | Ga0207639_10108666 | Ga0207639_101086662 | 330 |
| 408 | 3300026041 | Ga0207639_10197639 | Ga0207639_101976392 | 330 |
| 409 | 3300026067 | Ga0207678_10003121 | Ga0207678_100031212 | 330 |
| 410 | 3300026075 | Ga0207708_10063340 | Ga0207708_100633402 | 330 |
| 411 | 3300026078 | Ga0207702_10000016 | Ga0207702_10000016129 | 330 |
| 412 | 3300026078 | Ga0207702_10002500 | Ga0207702_100025007 | 330 |
| 413 | 3300026078 | Ga0207702_10217840 | Ga0207702_102178402 | 330 |
| 414 | 3300026088 | Ga0207641_10000094 | Ga0207641_1000009435 | 330 |
| 415 | 3300026088 | Ga0207641_10040062 | Ga0207641_100400622 | 330 |
| 416 | 3300026088 | Ga0207641_10041339 | Ga0207641_100413393 | 330 |
| 417 | 3300026088 | Ga0207641_10114453 | Ga0207641_101144533 | 330 |
| 418 | 3300026089 | Ga0207648_10000931 | Ga0207648_100009319 | 330 |
| 419 | 3300026095 | Ga0207676_10000048 | Ga0207676_100000488 | 330 |
| 420 | 3300026121 | Ga0207683_10006441 | Ga0207683_1000644110 | 330 |
| 421 | 3300026142 | Ga0207698_10037889 | Ga0207698_100378893 | 330 |
| 422 | 3300028379 | Ga0268266_10000020 | Ga0268266_10000020144 | 330 |
| 423 | 3300028379 | Ga0268266_10005194 | Ga0268266_100051947 | 330 |
| 424 | 3300028379 | Ga0268266_10143261 | Ga0268266_101432611 | 330 |
| 425 | 3300028380 | Ga0268265_10037565 | Ga0268265_100375652 | 330 |
| 426 | 3300028381 | Ga0268264_10005469 | Ga0268264_100054696 | 330 |
| 427 | 3300028556 | Ga0265337_1000002 | Ga0265337_1000002112 | 330 |
| 428 | 3300028558 | Ga0265326_10000007 | Ga0265326_10000007170 | 330 |
| 429 | 3300028563 | Ga0265319_1000028 | Ga0265319_1000028124 | 330 |
| 430 | 3300028654 | Ga0265322_10000001 | Ga0265322_10000001133 | 330 |
| 431 | 3300028666 | Ga0265336_10005833 | Ga0265336_100058335 | 330 |
| 432 | 3300028800 | Ga0265338_10000230 | Ga0265338_1000023028 | 330 |
| 433 | 3300029957 | Ga0265324_10000263 | Ga0265324_100002634 | 330 |
| 434 | 3300031239 | Ga0265328_10005534 | Ga0265328_100055344 | 330 |
| 435 | 3300031240 | Ga0265320_10000002 | Ga0265320_10000002133 | 330 |
| 436 | 3300031249 | Ga0265339_10010618 | Ga0265339_100106186 | 330 |
| 437 | 3300031250 | Ga0265331_10002898 | Ga0265331_100028986 | 330 |
| 438 | 3300031251 | Ga0265327_10000011 | Ga0265327_10000011133 | 330 |
| 439 | 3300031344 | Ga0265316_10012769 | Ga0265316_100127697 | 330 |
| 440 | 3300031711 | Ga0265314_10000058 | Ga0265314_1000005840 | 330 |
| 441 | 3300032126 | Ga0307415_100011277 | Ga0307415_1000112773 | 330 |
| 442 | 3300036401 | Ga0373937_0024973 | Ga0373937_0024973_4118_5116 | 330 |
| 443 | 3300036401 | Ga0373937_0136811 | Ga0373937_0136811_236_1234 | 330 |
| 444 | 3300037853 | Ga0436364_0472332 | Ga0436364_0472332_12785_13789 | 330 |
| 445 | 3300037853 | Ga0436364_0532051 | Ga0436364_0532051_1846_2850 | 330 |
| 446 | 3300037853 | Ga0436364_0727059 | Ga0436364_0727059_5028_6032 | 330 |
| 447 | 3300037853 | Ga0436364_0863469 | Ga0436364_0863469_151_1155 | 330 |
| 448 | 3300037853 | Ga0436364_1207140 | Ga0436364_1207140_1509_2513 | 330 |
| 449 | 3300037853 | Ga0436364_1299511 | Ga0436364_1299511_1688_2689 | 330 |
| 450 | 3300039437 | Ga0436365_0595886 | Ga0436365_0595886_658_1662 | 330 |
| 451 | 3300039437 | Ga0436365_0720424 | Ga0436365_0720424_1380_2384 | 330 |
| 452 | 3300041486 | Ga0451807_1000803 | Ga0451807_1000803_181_1179 | 330 |
| 453 | 3300041491 | Ga0451833_0131667 | Ga0451833_0131667_671_1669 | 330 |
| 454 | 3300041512 | Ga0451853_3002922 | Ga0451853_3002922_1601_2599 | 330 |
| 455 | 3300044694 | Ga0466963_0000192 | Ga0466963_0000192_24676_25674 | 330 |
| 456 | 3300044694 | Ga0466963_0244239 | Ga0466963_0244239_123_1142 | 330 |
| 457 | 3300044719 | Ga0466971_0054676 | Ga0466971_0054676_249_1253 | 330 |
| 458 | 3300044842 | Ga0466957_0003132 | Ga0466957_0003132_2365_3384 | 330 |
| 459 | 3300045049 | Ga0466959_0043638 | Ga0466959_0043638_1006_2007 | 330 |
| 460 | 3300045836 | Ga0466958_0201777 | Ga0466958_0201777_244_1245 | 330 |
| 461 | 3300045976 | Ga0466967_0000046 | Ga0466967_0000046_39017_40039 | 330 |
| 462 | 3300045976 | Ga0466967_0076184 | Ga0466967_0076184_738_1739 | 330 |
| 463 | 3300046454 | Ga0495592_0000109 | Ga0495592_0000109_45441_46439 | 330 |
| 464 | 3300046455 | Ga0495603_0000023 | Ga0495603_0000023_23045_24043 | 330 |
| 465 | 3300046458 | Ga0495591_013816 | Ga0495591_013816_120_1118 | 330 |
| 466 | 3300046459 | Ga0495629_0000218 | Ga0495629_0000218_34582_35604 | 330 |
| 467 | 3300046459 | Ga0495629_0004724 | Ga0495629_0004724_7176_8174 | 330 |
| 468 | 3300046460 | Ga0495638_0077288 | Ga0495638_0077288_230_1237 | 330 |
| 469 | 3300046461 | Ga0495641_0000003 | Ga0495641_0000003_125358_126356 | 330 |
| 470 | 3300046473 | Ga0495582_0000027 | Ga0495582_0000027_26463_27461 | 330 |
| 471 | 3300046476 | Ga0495662_0000131 | Ga0495662_0000131_8716_9714 | 330 |
| 472 | 3300046476 | Ga0495662_0004612 | Ga0495662_0004612_4563_5582 | 330 |
| 473 | 3300046499 | Ga0495594_0000013 | Ga0495594_0000013_25779_26786 | 330 |
| 474 | 3300046507 | Ga0495606_0000211 | Ga0495606_0000211_33138_34160 | 330 |
| 475 | 3300046511 | Ga0495608_0000031 | Ga0495608_0000031_36896_37909 | 330 |
| 476 | 3300046511 | Ga0495608_0005837 | Ga0495608_0005837_5050_6048 | 330 |
| 477 | 3300046511 | Ga0495608_0009896 | Ga0495608_0009896_3640_4638 | 330 |
| 478 | 3300046511 | Ga0495608_0091558 | Ga0495608_0091558_40_1038 | 330 |
| 479 | 3300046514 | Ga0495618_0000004 | Ga0495618_0000004_192040_193038 | 330 |
| 480 | 3300046515 | Ga0495620_0007472 | Ga0495620_0007472_2848_3846 | 330 |
| 481 | 3300046516 | Ga0495628_0062707 | Ga0495628_0062707_766_1764 | 330 |
| 482 | 3300046516 | Ga0495628_0087318 | Ga0495628_0087318_411_1409 | 330 |
| 483 | 3300046516 | Ga0495628_0200678 | Ga0495628_0200678_106_1104 | 330 |
| 484 | 3300046517 | Ga0495630_0000018 | Ga0495630_0000018_27895_28917 | 330 |
| 485 | 3300046517 | Ga0495630_0001847 | Ga0495630_0001847_3719_4717 | 330 |
| 486 | 3300046517 | Ga0495630_0138859 | Ga0495630_0138859_32_1030 | 330 |
| 487 | 3300046529 | Ga0495652_0000003 | Ga0495652_0000003_14170_15174 | 330 |
| 488 | 3300046533 | Ga0495640_0112114 | Ga0495640_0112114_643_1647 | 330 |
| 489 | 3300046535 | Ga0495586_0000606 | Ga0495586_0000606_3209_4207 | 330 |
| 490 | 3300046536 | Ga0495587_0017319 | Ga0495587_0017319_2391_3392 | 330 |
| 491 | 3300046539 | Ga0495621_0000542 | Ga0495621_0000542_6859_7857 | 330 |
| 492 | 3300046543 | Ga0495645_0002138 | Ga0495645_0002138_10046_11047 | 330 |
| 493 | 3300046557 | Ga0495622_0000014 | Ga0495622_0000014_98127_99134 | 330 |
| 494 | 3300046559 | Ga0495667_0000075 | Ga0495667_0000075_33495_34508 | 330 |
| 495 | 3300046642 | Ga0495634_0000556 | Ga0495634_0000556_32511_33509 | 330 |
| 496 | 3300046642 | Ga0495634_0000944 | Ga0495634_0000944_21309_22307 | 330 |
| 497 | 3300046642 | Ga0495634_0003687 | Ga0495634_0003687_3970_4971 | 330 |
| 498 | 3300046642 | Ga0495634_0071688 | Ga0495634_0071688_884_1882 | 330 |
| 499 | 3300046660 | Ga0495625_0000122 | Ga0495625_0000122_100949_101956 | 330 |
| 500 | 3300046663 | Ga0495635_0000042 | Ga0495635_0000042_22951_23949 | 330 |
| 501 | 3300046663 | Ga0495635_0011459 | Ga0495635_0011459_1348_2346 | 330 |
| 502 | 3300046675 | Ga0495657_0000024 | Ga0495657_0000024_36896_37909 | 330 |
| 503 | 3300046675 | Ga0495657_0009789 | Ga0495657_0009789_3265_4263 | 330 |
| 504 | 3300046678 | Ga0495599_0019054 | Ga0495599_0019054_2569_3567 | 330 |
| 505 | 3300046681 | Ga0495647_0000007 | Ga0495647_0000007_79919_80917 | 330 |
| 506 | 3300046681 | Ga0495647_0000437 | Ga0495647_0000437_4427_5449 | 330 |
| 507 | 3300046683 | Ga0495658_0000025 | Ga0495658_0000025_26463_27461 | 330 |
| 508 | 3300046684 | Ga0495669_0000307 | Ga0495669_0000307_11041_12039 | 330 |
| 509 | 3300046684 | Ga0495669_0026771 | Ga0495669_0026771_430_1431 | 330 |
| 510 | 3300046689 | Ga0495613_0000042 | Ga0495613_0000042_8612_9610 | 330 |
| 511 | 3300046690 | Ga0495624_0000009 | Ga0495624_0000009_31208_32206 | 330 |
| 512 | 3300046690 | Ga0495624_0000037 | Ga0495624_0000037_70912_71934 | 330 |
| 513 | 3300046690 | Ga0495624_0005245 | Ga0495624_0005245_4418_5416 | 330 |
| 514 | 3300046691 | Ga0495670_0074756 | Ga0495670_0074756_14_1012 | 330 |
| 515 | 3300046694 | Ga0495649_0005916 | Ga0495649_0005916_3650_4648 | 330 |
| 516 | 3300046809 | Ga0495600_0000407 | Ga0495600_0000407_20950_21948 | 330 |
| 517 | 3300047317 | Ga0495604_0000038 | Ga0495604_0000038_82499_83497 | 330 |
| 518 | 3300047317 | Ga0495604_0000073 | Ga0495604_0000073_18705_19730 | 330 |
| 519 | 3300047319 | Ga0495674_0000042 | Ga0495674_0000042_39315_40319 | 330 |
| 520 | 3300047321 | Ga0495676_0000980 | Ga0495676_0000980_2735_3733 | 330 |
| 521 | 3300047321 | Ga0495676_0004769 | Ga0495676_0004769_7783_8781 | 330 |
| 522 | 3300047321 | Ga0495676_0111289 | Ga0495676_0111289_730_1728 | 330 |
| 523 | 3300047322 | Ga0495680_0000196 | Ga0495680_0000196_2987_3985 | 330 |
| 524 | 3300047322 | Ga0495680_0002982 | Ga0495680_0002982_14797_15795 | 330 |
| 525 | 3300047322 | Ga0495680_0003091 | Ga0495680_0003091_7693_8706 | 330 |
| 526 | 3300047322 | Ga0495680_0067723 | Ga0495680_0067723_322_1320 | 330 |
| 527 | 3300047322 | Ga0495680_0068766 | Ga0495680_0068766_1648_2646 | 330 |
| 528 | 3300047322 | Ga0495680_0243843 | Ga0495680_0243843_109_1107 | 330 |
| 529 | 3300047444 | Ga0495675_0000209 | Ga0495675_0000209_36899_37912 | 330 |
| 530 | 3300047444 | Ga0495675_0141478 | Ga0495675_0141478_356_1360 | 330 |
| 531 | 3300047472 | Ga0495686_0072578 | Ga0495686_0072578_571_1575 | 330 |
| 532 | 3300047673 | Ga0495593_0078733 | Ga0495593_0078733_319_1317 | 330 |
| 533 | 3300048903 | Ga0496100_0000002 | Ga0496100_0000002_101987_102985 | 330 |
| 534 | 3300048903 | Ga0496100_0000038 | Ga0496100_0000038_62544_63542 | 330 |
| 535 | 3300048904 | Ga0496101_0000001 | Ga0496101_0000001_101987_102985 | 330 |
| 536 | 3300048904 | Ga0496101_0000153 | Ga0496101_0000153_52772_53770 | 330 |
| 537 | 3300048904 | Ga0496101_0109634 | Ga0496101_0109634_163_1167 | 330 |
| 538 | 3300048905 | Ga0496102_0000584 | Ga0496102_0000584_32051_33049 | 330 |
| 539 | 3300048905 | Ga0496102_0030907 | Ga0496102_0030907_1629_2630 | 330 |
| 540 | 3300048905 | Ga0496102_0464012 | Ga0496102_0464012_87_1091 | 330 |
| 541 | 3300048906 | Ga0496103_0000043 | Ga0496103_0000043_78927_79925 | 330 |
| 542 | 3300048906 | Ga0496103_0177571 | Ga0496103_0177571_201_1202 | 330 |
| 543 | 3300048907 | Ga0496104_0000002 | Ga0496104_0000002_671233_672231 | 330 |
| 544 | 3300048907 | Ga0496104_0000013 | Ga0496104_0000013_341293_342291 | 330 |
| 545 | 3300048907 | Ga0496104_0031192 | Ga0496104_0031192_1207_2232 | 330 |
| 546 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_655948_656946 | 330 |
| 547 | 3300048908 | Ga0496105_0000006 | Ga0496105_0000006_54873_55871 | 330 |
| 548 | 3300048908 | Ga0496105_0015196 | Ga0496105_0015196_2466_3467 | 330 |
| 549 | 3300048908 | Ga0496105_0041611 | Ga0496105_0041611_1510_2514 | 330 |
| 550 | 3300048909 | Ga0496106_0000018 | Ga0496106_0000018_78821_79819 | 330 |
| 551 | 3300048909 | Ga0496106_0000022 | Ga0496106_0000022_96267_97265 | 330 |
| 552 | 3300048909 | Ga0496106_0000138 | Ga0496106_0000138_14131_15129 | 330 |
| 553 | 3300048910 | Ga0496107_0000006 | Ga0496107_0000006_5527_6525 | 330 |
| 554 | 3300048910 | Ga0496107_0000016 | Ga0496107_0000016_69335_70333 | 330 |
| 555 | 3300048910 | Ga0496107_0065767 | Ga0496107_0065767_883_1881 | 330 |
| 556 | 3300048911 | Ga0496108_0000150 | Ga0496108_0000150_58780_59799 | 330 |
| 557 | 3300048911 | Ga0496108_0309835 | Ga0496108_0309835_269_1291 | 330 |
| 558 | 3300048912 | Ga0496109_0000007 | Ga0496109_0000007_239457_240476 | 330 |
| 559 | 3300048912 | Ga0496109_0000028 | Ga0496109_0000028_128846_129868 | 330 |
| 560 | 3300048912 | Ga0496109_0000369 | Ga0496109_0000369_34920_35918 | 330 |
| 561 | 3300048913 | Ga0496110_0000033 | Ga0496110_0000033_33509_34522 | 330 |
| 562 | 3300048914 | Ga0496111_0000125 | Ga0496111_0000125_27905_28918 | 330 |
| 563 | 3300048915 | Ga0496112_0000003 | Ga0496112_0000003_237835_238833 | 330 |
| 564 | 3300048915 | Ga0496112_0226607 | Ga0496112_0226607_11_1009 | 330 |
| 565 | 3300048915 | Ga0496112_0338909 | Ga0496112_0338909_171_1169 | 330 |
| 566 | 3300048917 | Ga0496114_0000014 | Ga0496114_0000014_55321_56319 | 330 |
| 567 | 3300048917 | Ga0496114_0029717 | Ga0496114_0029717_572_1570 | 330 |
| 568 | 3300048918 | Ga0496115_0000020 | Ga0496115_0000020_22052_23071 | 330 |
| 569 | 3300048918 | Ga0496115_0000255 | Ga0496115_0000255_23508_24506 | 330 |
| 570 | 3300048918 | Ga0496115_0131296 | Ga0496115_0131296_48_1076 | 330 |
| 571 | 3300048919 | Ga0496116_0000819 | Ga0496116_0000819_15744_16745 | 330 |
| 572 | 3300048920 | Ga0496117_0001154 | Ga0496117_0001154_1307_2308 | 330 |
| 573 | 3300048921 | Ga0496118_0002138 | Ga0496118_0002138_11940_12941 | 330 |
| 574 | 3300048922 | Ga0496119_0005629 | Ga0496119_0005629_2031_3029 | 330 |
| 575 | 3300048922 | Ga0496119_0007031 | Ga0496119_0007031_5145_6149 | 330 |
| 576 | 3300048922 | Ga0496119_0010882 | Ga0496119_0010882_2290_3291 | 330 |
| 577 | 3300048922 | Ga0496119_0035108 | Ga0496119_0035108_940_1941 | 330 |
| 578 | 3300048923 | Ga0496120_0001229 | Ga0496120_0001229_17902_18903 | 330 |
| 579 | 3300048923 | Ga0496120_0011279 | Ga0496120_0011279_5038_6036 | 330 |
| 580 | 3300048924 | Ga0496121_0017908 | Ga0496121_0017908_1025_2029 | 330 |
| 581 | 3300048924 | Ga0496121_0026538 | Ga0496121_0026538_325_1326 | 330 |
| 582 | 3300048928 | Ga0496125_0045145 | Ga0496125_0045145_368_1372 | 330 |
| 583 | 3300048928 | Ga0496125_0162817 | Ga0496125_0162817_407_1408 | 330 |
| 584 | 3300048929 | Ga0496126_0009557 | Ga0496126_0009557_1339_2343 | 330 |
| 585 | 3300049568 | Ga0501031_0069173 | Ga0501031_0069173_1066_2070 | 330 |
| 586 | 3300049569 | Ga0501032_0000377 | Ga0501032_0000377_193_1197 | 330 |
| 587 | 3300049570 | Ga0501033_0000303 | Ga0501033_0000303_1111_2115 | 330 |
| 588 | 3300049572 | Ga0501036_0000446 | Ga0501036_0000446_1069_2073 | 330 |
| 589 | 3300049572 | Ga0501036_0311431 | Ga0501036_0311431_263_1261 | 330 |
| 590 | 3300049574 | Ga0501038_0000245 | Ga0501038_0000245_43998_45002 | 330 |
| 591 | 3300049576 | Ga0501040_0195107 | Ga0501040_0195107_244_1248 | 330 |
| 592 | 3300049578 | Ga0501042_0032199 | Ga0501042_0032199_104_1111 | 330 |
| 593 | 3300049578 | Ga0501042_0093445 | Ga0501042_0093445_1000_2004 | 330 |
| 594 | 3300049580 | Ga0501046_0093827 | Ga0501046_0093827_1101_2105 | 330 |
| 595 | 3300049581 | Ga0501047_0000263 | Ga0501047_0000263_46955_47959 | 330 |
| 596 | 3300049581 | Ga0501047_0009009 | Ga0501047_0009009_5562_6566 | 330 |
| 597 | 3300049584 | Ga0501068_0098376 | Ga0501068_0098376_644_1648 | 330 |
| 598 | 3300049586 | Ga0501070_0000710 | Ga0501070_0000710_28409_29413 | 330 |
| 599 | 3300049588 | Ga0501072_0035607 | Ga0501072_0035607_2821_3819 | 330 |
| 600 | 3300049588 | Ga0501072_0280482 | Ga0501072_0280482_105_1109 | 330 |
| 601 | 3300049589 | Ga0501073_0002082 | Ga0501073_0002082_12767_13771 | 330 |
| 602 | 3300049590 | Ga0501074_0050754 | Ga0501074_0050754_1029_2033 | 330 |
| 603 | 3300049591 | Ga0501075_0013017 | Ga0501075_0013017_1673_2671 | 330 |
| 604 | 3300049742 | Ga0501080_0302747 | Ga0501080_0302747_49_1053 | 330 |
| 605 | 3300049822 | Ga0501035_0000391 | Ga0501035_0000391_2389_3393 | 330 |
| 606 | 3300049823 | Ga0501044_0137123 | Ga0501044_0137123_229_1233 | 330 |
| 607 | 3300049823 | Ga0501044_0227640 | Ga0501044_0227640_290_1291 | 330 |
| 608 | 3300049824 | Ga0501045_0096253 | Ga0501045_0096253_1077_2081 | 330 |
| 609 | 3300050515 | nmdc:mga0a205_2175_c1 | nmdc:mga0a205_2175_c1_3312_4325 | 330 |
| 610 | 3300053077 | Ga0495601_0000072 | Ga0495601_0000072_11741_12739 | 330 |
| 611 | 3300053077 | Ga0495601_0010614 | Ga0495601_0010614_3215_4213 | 330 |
| 612 | 3300053077 | Ga0495601_0102825 | Ga0495601_0102825_361_1359 | 330 |
| 613 | 3300053077 | Ga0495601_0107034 | Ga0495601_0107034_290_1288 | 330 |
| 614 | 3300053077 | Ga0495601_0113911 | Ga0495601_0113911_261_1259 | 330 |
| 615 | 3300053078 | Ga0495612_0000418 | Ga0495612_0000418_1027_2025 | 330 |
| 616 | 3300053078 | Ga0495612_0013575 | Ga0495612_0013575_1326_2324 | 330 |
| 617 | 3300053083 | Ga0495655_0000011 | Ga0495655_0000011_80726_81724 | 330 |
| 618 | 3300053084 | Ga0495595_0000014 | Ga0495595_0000014_107347_108360 | 330 |
| 619 | 3300053084 | Ga0495595_0000832 | Ga0495595_0000832_5069_6067 | 330 |
| 620 | 3300053084 | Ga0495595_0060281 | Ga0495595_0060281_605_1606 | 330 |
| 621 | 3300053085 | Ga0495619_0000001 | Ga0495619_0000001_208775_209773 | 330 |
| 622 | 3300053085 | Ga0495619_0000022 | Ga0495619_0000022_155987_157000 | 330 |
| 623 | 3300053085 | Ga0495619_0000114 | Ga0495619_0000114_3181_4194 | 330 |
| 624 | 3300053085 | Ga0495619_0002345 | Ga0495619_0002345_3725_4723 | 330 |
| 625 | 3300053085 | Ga0495619_0006842 | Ga0495619_0006842_3048_4046 | 330 |
| 626 | 3300053085 | Ga0495619_0015275 | Ga0495619_0015275_3054_4052 | 330 |
| 627 | 3300053085 | Ga0495619_0038350 | Ga0495619_0038350_1074_2072 | 330 |
| 628 | 3300053094 | Ga0500566_0049493 | Ga0500566_0049493_349_1347 | 330 |
| 629 | 3300053119 | Ga0500595_019359 | Ga0500595_019359_1145_2146 | 330 |
| 630 | 3300053123 | Ga0500614_007233 | Ga0500614_007233_22_1020 | 330 |
| 631 | 3300053129 | Ga0500628_000058 | Ga0500628_000058_3176_4174 | 330 |
| 632 | 3300053134 | Ga0500658_0126809 | Ga0500658_0126809_58_1059 | 330 |
| 633 | 3300054114 | Ga0501084_0121720 | Ga0501084_0121720_144_1148 | 330 |
| 634 | 3300060353 | Ga0501082_0114469 | Ga0501082_0114469_231_1235 | 330 |
| 635 | 3300005535 | Ga0070684_100066635 | Ga0070684_1000666353 | 331 |
| 636 | 3300006852 | Ga0075433_10008780 | Ga0075433_100087805 | 331 |
| 637 | 3300020082 | Ga0206353_11869196 | Ga0206353_118691962 | 331 |
| 638 | 3300025912 | Ga0207707_10024956 | Ga0207707_100249564 | 331 |
| 639 | 3300025944 | Ga0207661_10023075 | Ga0207661_100230752 | 331 |
| 640 | 3300032126 | Ga0307415_100019407 | Ga0307415_1000194073 | 331 |
| 641 | 3300047471 | Ga0495684_0075193 | Ga0495684_0075193_107_1123 | 331 |
| 642 | 3300048913 | Ga0496110_0000653 | Ga0496110_0000653_1029_2033 | 331 |
| 643 | 3300048914 | Ga0496111_0000444 | Ga0496111_0000444_18875_19879 | 331 |
| 644 | 3300049586 | Ga0501070_0239100 | Ga0501070_0239100_241_1272 | 331 |
| 645 | 3300050515 | nmdc:mga0a205_7295_c1 | nmdc:mga0a205_7295_c1_6127_7128 | 331 |
| 646 | 3300000549 | LJQas_1003811 | LJQas_10038112 | 332 |
| 647 | 3300005981 | Ga0081538_10009934 | Ga0081538_100099346 | 332 |
| 648 | 3300031852 | Ga0307410_10192078 | Ga0307410_101920782 | 332 |
| 649 | 3300031911 | Ga0307412_10198725 | Ga0307412_101987253 | 332 |
| 650 | 3300031995 | Ga0307409_100114427 | Ga0307409_1001144272 | 332 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7txb-assembly2.cif.gz_A | structure of the class ii fructose-1,6-bisphophatase from mycobacterium tuberculosis complexed with substrate f1,6bp | 0.9757 | 17 | 319 |
| 6ayv-assembly1.cif.gz_A | crystal structure of fructose-1,6-bisphosphatase t84a from mycobacterium tuberculosis | 0.9707 | 15 | 320 |
| 7txb-assembly2.cif.gz_A | structure of the class ii fructose-1,6-bisphophatase from mycobacterium tuberculosis complexed with substrate f1,6bp | 0.9663 | 17 | 319 |
| 6ayu-assembly1.cif.gz_A | crystal structure of fructose-1,6-bisphosphatase t84s from mycobacterium tuberculosis | 0.9624 | 15 | 325 |
| 2r8t-assembly1.cif.gz_A | crystal structure of the fructose 1,6-bisphosphatase glpx from e.coli in the complex with fructose 1,6-bisphosphate | 0.9385 | 10 | 319 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WN21_138_292_3.40.190.90 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9848 | 118 | 271 | 3.40.190.90 |
| af_P9WN21_138_292_3.40.190.90 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9723 | 118 | 271 | 3.40.190.90 |
| 1ni9A01 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 | 0.9241 | 10 | 319 | 3.30.540.10 |
| 3rplA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9166 | 118 | 271 | 3.40.190.90 |
| 2r8tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.8919 | 118 | 272 | 3.40.190.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2H5ZSQ3-F1-model_v4 | D-fructose 1,6-bisphosphatase class 2/sedoheptulose 1,7-bisphosphatase (EC 3.1.3.11) | 1.002 | 275 | 320 |
GO:0006071
GO:0006094 GO:0042132 |
| AF-A0A6J6XH43-F1-model_v4 | Unannotated protein | 0.9958 | 216 | 320 |
GO:0005829
GO:0006071 GO:0006094 GO:0030388 GO:0042132 |
| AF-A0A2V9YZ07-F1-model_v4 | fructose-bisphosphatase (EC 3.1.3.11) | 0.9942 | 257 | 319 |
GO:0005829
GO:0006071 GO:0006094 GO:0030388 GO:0042132 |
| AF-A0A6L6EFV4-F1-model_v4 | Fructose-1,6-bisphosphatase class 2 (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase class 2) | 0.9937 | 257 | 320 |
GO:0005829
GO:0006071 GO:0006094 GO:0030388 GO:0042132 |
| AF-A0A3N6B4U5-F1-model_v4 | fructose-bisphosphatase (EC 3.1.3.11) | 0.9915 | 271 | 319 |
GO:0005829
GO:0006071 GO:0006094 GO:0030388 GO:0042132 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar