F472395

General Info

Members Datasets Scaffolds Average Seq Length
648 246 616 402

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0000411|Ga0466957_0000411_13445_14797
Length 450
Sequence VASVAVSGKYTGPIPGRINIGGLLLLFVVKFWQLTVNLVKFFLLHMTEKSLLYRKKVIKHLYFSNMLSCADLSDKIHKSLPVTAKMLSKLMEDGWVAETGFAASTGGRRPVTYSLKPDVMYVISVAMDQLITRIAIMNMQNKNVTDTEIFPLPLTKNQQALSTLAEKIEEVIKRSGIAKSSIAGIGIGMPGFVDAAKGINYSFLEPEQGSLTQYISHKVKLPVFIDNDSRLIALAELKFGAARGKKNAMVINVGWGVGLGMILNGELFRGHNGFAGEFSHIPLFLNNKLCSCGKSGCLETETSLLIVIEKANKGLKDGRVSLLNELSPERAEQAFQDVIQAAGKGDKFAVEILSEAGYNIGRGVAILIHLLNPEVVILSGRGSSAGRIWQAPIQQALNEHCIPRLSQNTEVAISSMGYQAELTGAAALVMENYEKIEWRKESGKVDHLIS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2738541278 Niastella sp. CF465 Isolate Unclassified
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
6 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
7 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
8 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
9 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
10 2914759650 Rhizosphaericola mali Isolate Rhizosphere
11 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
12 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
13 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
14 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
15 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
19 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
119 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
120 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
168 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
169 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
170 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
176 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
181 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
184 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
185 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
186 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
189 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
197 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
198 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
199 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
200 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
201 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
217 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
230 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
231 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
232 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
233 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
234 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
235 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
236 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
237 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
238 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
239 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
240 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
243 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
244 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
245 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
246 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.38
Metatranscriptomes 0.15
Isolates 2.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.94
Nodule 0
Rhizoplane 0.15
Rhizosphere 86.11
Stem 0
Stem Tuber 0
Unclassified 6.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1898023 2162886007 Bacteria 2406
2 SwRhRL2b_contig_1905487 2162886007 Bacteria 7776
3 MRS1b_contig_1820062 2162886011 Bacteria 1650
4 JGI24740J21852_10001447 3300001979 Bacteria 10883
5 JGI24740J21852_10002576 3300001979 Bacteria 8170
6 JGI24744J21845_10013557 3300002077 Bacteria 1642
7 JGI25154J39366_1000028 3300002738 Bacteria 195818
8 JGI25406J46586_10003895 3300003203 Bacteria 6978
9 rootH1_10136269 3300003316 Bacteria 3985
10 rootH2_10002166 3300003320 Bacteria 80521
11 rootH2_10026598 3300003320 Unclassified 1500
12 rootH2_10063549 3300003320 Bacteria 4065
13 rootH2_10075466 3300003320 Unclassified 4072
14 rootH2_10213446 3300003320 Bacteria 3160
15 rootH2_10306631 3300003320 Bacteria 2203
16 rootL2_10007315 3300003322 Bacteria 2651
17 rootL2_10072276 3300003322 Bacteria 7617
18 rootL2_10095474 3300003322 Bacteria 6617
19 rootL2_10179877 3300003322 Bacteria 2246
20 rootL2_10181442 3300003322 Bacteria 5967
21 rootL2_10187122 3300003322 Bacteria 3233
22 rootL2_10194409 3300003322 Unclassified 2982
23 rootH1_10006077 3300003323 Bacteria 14451
24 rootH1_10014157 3300003323 Bacteria 3810
25 rootH1_10076781 3300003323 Bacteria 3290
26 rootH1_10110584 3300003323 Unclassified 4271
27 rootH1_10120525 3300003323 Bacteria 10790
28 rootH1_10218367 3300003323 Bacteria 2777
29 rootH1_10270368 3300003323 Bacteria 3184
30 JGI25160J50197_1000358 3300003354 Bacteria 30190
31 JGI25160J50197_1005269 3300003354 Bacteria 5412
32 Ga0055535_1000572 3300003761 Bacteria 31004
33 Ga0055542_1005928 3300003762 Bacteria 2678
34 Ga0058861_11585166 3300004800 Bacteria 2732
35 Ga0065714_10004779 3300005288 Bacteria 6310
36 Ga0065704_10070305 3300005289 Bacteria 36252
37 Ga0065704_10071036 3300005289 Bacteria 13598
38 Ga0065704_10086017 3300005289 Bacteria 3163
39 Ga0065712_10082630 3300005290 Bacteria 2872
40 Ga0070658_10011704 3300005327 Bacteria 7038
41 Ga0070658_10014599 3300005327 Bacteria 6303
42 Ga0070658_10052687 3300005327 Bacteria 3301
43 Ga0070658_10069777 3300005327 Bacteria 2876
44 Ga0070658_10105408 3300005327 Bacteria 2332
45 Ga0070658_10147562 3300005327 Bacteria 1968
46 Ga0070676_10004267 3300005328 Bacteria 7507
47 Ga0070683_100005913 3300005329 Bacteria 10239
48 Ga0070690_100050138 3300005330 Bacteria 2663
49 Ga0070690_100123260 3300005330 Bacteria 1742
50 Ga0070670_100018249 3300005331 Bacteria 6019
51 Ga0070670_100076176 3300005331 Unclassified 2882
52 Ga0070670_100150585 3300005331 Bacteria 2013
53 Ga0070670_100282275 3300005331 Bacteria 1450
54 Ga0068869_100015307 3300005334 Bacteria 5141
55 Ga0068869_100161071 3300005334 Bacteria 1747
56 Ga0068869_100274222 3300005334 Bacteria 1354
57 Ga0070666_10000029 3300005335 Bacteria 141568
58 Ga0070666_10009103 3300005335 Bacteria 6192
59 Ga0070680_100001551 3300005336 Bacteria 16772
60 Ga0070680_100010458 3300005336 Bacteria 7155
61 Ga0070682_100003358 3300005337 Bacteria 8870
62 Ga0068868_100003582 3300005338 Bacteria 10820
63 Ga0068868_100007566 3300005338 Bacteria 7737
64 Ga0068868_100037453 3300005338 Bacteria 3760
65 Ga0068868_100061966 3300005338 Bacteria 2964
66 Ga0068868_100282973 3300005338 Bacteria 1404
67 Ga0070660_100051065 3300005339 Bacteria 3183
68 Ga0070691_10022527 3300005341 Bacteria 2922
69 Ga0070691_10123188 3300005341 Bacteria 1307
70 Ga0070687_100058784 3300005343 Bacteria 2022
71 Ga0070668_100016047 3300005347 Bacteria 5603
72 Ga0070668_100032942 3300005347 Bacteria 3944
73 Ga0070668_100092365 3300005347 Bacteria 2387
74 Ga0070668_100092742 3300005347 Unclassified 2382
75 Ga0070669_100002247 3300005353 Bacteria 13997
76 Ga0070669_100026176 3300005353 Bacteria 4197
77 Ga0070669_100169275 3300005353 Bacteria 1702
78 Ga0070675_100001165 3300005354 Bacteria 19018
79 Ga0070675_100010879 3300005354 Bacteria 7117
80 Ga0070675_100076695 3300005354 Bacteria 2781
81 Ga0070674_100006515 3300005356 Bacteria 6819
82 Ga0070674_100033355 3300005356 Bacteria 3426
83 Ga0070673_100004392 3300005364 Bacteria 8912
84 Ga0070673_100039383 3300005364 Bacteria 3616
85 Ga0070673_100068425 3300005364 Unclassified 2843
86 Ga0070688_100002600 3300005365 Bacteria 9153
87 Ga0070659_100022182 3300005366 Bacteria 4843
88 Ga0070659_100174333 3300005366 Bacteria 1763
89 Ga0070667_100008090 3300005367 Bacteria 8721
90 Ga0070667_100022113 3300005367 Bacteria 5275
91 Ga0070667_100193996 3300005367 Bacteria 1800
92 Ga0070700_100023179 3300005441 Bacteria 3629
93 Ga0070678_100006683 3300005456 Bacteria 6789
94 Ga0070678_100196617 3300005456 Bacteria 1661
95 Ga0070662_100131214 3300005457 Bacteria 1932
96 Ga0070681_10015185 3300005458 Bacteria 7660
97 Ga0070681_10098585 3300005458 Bacteria 2869
98 Ga0070681_10126190 3300005458 Bacteria 2492
99 Ga0070681_10180222 3300005458 Bacteria 2034
100 Ga0068867_100023015 3300005459 Bacteria 4458
101 Ga0068867_100026794 3300005459 Bacteria 4140
102 Ga0070685_10148373 3300005466 Bacteria 1484
103 Ga0070698_100001150 3300005471 Bacteria 29264
104 Ga0070679_100001501 3300005530 Bacteria 20739
105 Ga0070679_100004674 3300005530 Bacteria 12637
106 Ga0070679_100009059 3300005530 Bacteria 9390
107 Ga0070684_100001987 3300005535 Bacteria 15036
108 Ga0070684_100010447 3300005535 Bacteria 7356
109 Ga0068853_100002923 3300005539 Bacteria 12995
110 Ga0068853_100314672 3300005539 Bacteria 1450
111 Ga0068853_100376903 3300005539 Bacteria 1324
112 Ga0070672_100033889 3300005543 Bacteria 3871
113 Ga0070672_100057436 3300005543 Bacteria 3055
114 Ga0070693_100012032 3300005547 Bacteria 4369
115 Ga0070665_100000074 3300005548 Bacteria 192944
116 Ga0070665_100022051 3300005548 Bacteria 6407
117 Ga0070665_100031635 3300005548 Bacteria 5326
118 Ga0070704_100163559 3300005549 Bacteria 1762
119 Ga0068855_100004568 3300005563 Bacteria 16916
120 Ga0068855_100012719 3300005563 Bacteria 10149
121 Ga0068855_100024022 3300005563 Bacteria 7298
122 Ga0068855_100030877 3300005563 Bacteria 6405
123 Ga0068855_100053688 3300005563 Bacteria 4740
124 Ga0068855_100062689 3300005563 Bacteria 4340
125 Ga0068855_100077008 3300005563 Bacteria 3870
126 Ga0068855_100186563 3300005563 Bacteria 2342
127 Ga0068855_100238736 3300005563 Bacteria 2032
128 Ga0068855_100287288 3300005563 Bacteria 1824
129 Ga0068857_100002026 3300005577 Bacteria 16423
130 Ga0068857_100007022 3300005577 Bacteria 9693
131 Ga0068857_100118436 3300005577 Bacteria 2383
132 Ga0068857_100122354 3300005577 Bacteria 2344
133 Ga0068857_100155175 3300005577 Bacteria 2076
134 Ga0068857_100176588 3300005577 Bacteria 1943
135 Ga0068854_100010050 3300005578 Bacteria 6128
136 Ga0068854_100087872 3300005578 Bacteria 2307
137 Ga0068854_100157191 3300005578 Bacteria 1758
138 Ga0068854_100188167 3300005578 Bacteria 1616
139 Ga0068856_100013391 3300005614 Bacteria 7941
140 Ga0068856_100029674 3300005614 Bacteria 5342
141 Ga0068856_100036592 3300005614 Bacteria 4813
142 Ga0068856_100156912 3300005614 Unclassified 2286
143 Ga0068856_100176682 3300005614 Bacteria 2148
144 Ga0068856_100201221 3300005614 Bacteria 2006
145 Ga0068856_100266204 3300005614 Bacteria 1730
146 Ga0068856_100299254 3300005614 Bacteria 1626
147 Ga0068852_100001929 3300005616 Bacteria 14135
148 Ga0068852_100004276 3300005616 Bacteria 10078
149 Ga0068852_100008018 3300005616 Bacteria 7747
150 Ga0068852_100057285 3300005616 Bacteria 3372
151 Ga0068852_100161869 3300005616 Bacteria 2090
152 Ga0068852_100219561 3300005616 Bacteria 1807
153 Ga0068852_100295517 3300005616 Bacteria 1566
154 Ga0068859_100000035 3300005617 Bacteria 169846
155 Ga0068859_100008557 3300005617 Bacteria 10346
156 Ga0068859_100013939 3300005617 Bacteria 8064
157 Ga0068859_100049224 3300005617 Bacteria 4233
158 Ga0068859_100202063 3300005617 Bacteria 2072
159 Ga0068864_100001198 3300005618 Bacteria 21527
160 Ga0068861_100001036 3300005719 Bacteria 17040
161 Ga0068861_100040060 3300005719 Bacteria 3501
162 Ga0068861_100093033 3300005719 Unclassified 2383
163 Ga0068861_100161131 3300005719 Bacteria 1851
164 Ga0068851_10029950 3300005834 Bacteria 2697
165 Ga0068870_10007790 3300005840 Bacteria 4790
166 Ga0068870_10051742 3300005840 Bacteria 2175
167 Ga0068863_100060938 3300005841 Bacteria 3568
168 Ga0068858_100033759 3300005842 Bacteria 4745
169 Ga0068860_100000034 3300005843 Bacteria 243128
170 Ga0068860_100005549 3300005843 Bacteria 12767
171 Ga0068860_100009592 3300005843 Bacteria 9620
172 Ga0068860_100016480 3300005843 Bacteria 7207
173 Ga0068860_100018904 3300005843 Bacteria 6695
174 Ga0068860_100106473 3300005843 Bacteria 2678
175 Ga0068860_100171902 3300005843 Bacteria 2093
176 Ga0068860_100356161 3300005843 Unclassified 1441
177 Ga0068862_100002110 3300005844 Bacteria 17923
178 Ga0081540_1043370 3300005983 Bacteria 2309
179 Ga0081539_10000147 3300005985 Bacteria 164274
180 Ga0070715_10041701 3300006163 Unclassified 1925
181 Ga0075366_10004482 3300006195 Bacteria 7492
182 Ga0075366_10008429 3300006195 Bacteria 5732
183 Ga0075366_10012850 3300006195 Unclassified 4759
184 Ga0075366_10022601 3300006195 Bacteria 3660
185 Ga0097621_100011146 3300006237 Bacteria 6615
186 Ga0068871_100004895 3300006358 Bacteria 9353
187 Ga0068871_100005555 3300006358 Bacteria 8839
188 Ga0068871_100033355 3300006358 Bacteria 4076
189 Ga0068871_100037190 3300006358 Bacteria 3881
190 Ga0068871_100179598 3300006358 Bacteria 1818
191 Ga0075428_100001629 3300006844 Bacteria 23953
192 Ga0075428_100019405 3300006844 Bacteria 7525
193 Ga0075428_100100285 3300006844 Bacteria 3157
194 Ga0075428_100140694 3300006844 Bacteria 2624
195 Ga0075430_100060418 3300006846 Bacteria 3185
196 Ga0075431_100000993 3300006847 Bacteria 25271
197 Ga0075431_100025885 3300006847 Bacteria 6013
198 Ga0075429_100001720 3300006880 Bacteria 18113
199 Ga0075429_100067217 3300006880 Unclassified 3119
200 Ga0068865_100001792 3300006881 Bacteria 12609
201 Ga0097620_100000035 3300006931 Bacteria 169846
202 Ga0097620_100008558 3300006931 Bacteria 10346
203 Ga0097620_100013939 3300006931 Bacteria 8064
204 Ga0097620_100049223 3300006931 Bacteria 4233
205 Ga0097620_100202053 3300006931 Bacteria 2072
206 Ga0097620_100233182 3300006931 Bacteria 1929
207 Ga0105240_10000448 3300009093 Bacteria 75837
208 Ga0105240_10000513 3300009093 Bacteria 71427
209 Ga0105240_10000753 3300009093 Bacteria 59090
210 Ga0105240_10003417 3300009093 Bacteria 24669
211 Ga0105240_10004884 3300009093 Bacteria 20174
212 Ga0105240_10010133 3300009093 Bacteria 13268
213 Ga0105240_10010616 3300009093 Bacteria 12940
214 Ga0105240_10014572 3300009093 Bacteria 10727
215 Ga0105240_10016430 3300009093 Bacteria 10021
216 Ga0105240_10020869 3300009093 Bacteria 8725
217 Ga0105240_10040963 3300009093 Bacteria 5917
218 Ga0105240_10044347 3300009093 Bacteria 5651
219 Ga0105240_10098200 3300009093 Bacteria 3567
220 Ga0105240_10333768 3300009093 Bacteria 1724
221 Ga0111539_10001072 3300009094 Bacteria 36092
222 Ga0105245_10217860 3300009098 Bacteria 1840
223 Ga0105247_10007945 3300009101 Bacteria 6484
224 Ga0114129_10169682 3300009147 Unclassified 2975
225 Ga0105241_10003488 3300009174 Bacteria 11696
226 Ga0105241_10004530 3300009174 Bacteria 10280
227 Ga0105241_10020566 3300009174 Bacteria 4877
228 Ga0105241_10036146 3300009174 Unclassified 3717
229 Ga0105241_10061063 3300009174 Unclassified 2902
230 Ga0105241_10083028 3300009174 Unclassified 2513
231 Ga0105241_10084023 3300009174 Bacteria 2499
232 Ga0105241_10281154 3300009174 Bacteria 1421
233 Ga0105242_10206361 3300009176 Unclassified 1748
234 Ga0105242_10209494 3300009176 Bacteria 1736
235 Ga0105237_10000365 3300009545 Bacteria 64152
236 Ga0105237_10000406 3300009545 Bacteria 61339
237 Ga0105237_10004916 3300009545 Bacteria 15295
238 Ga0105237_10006397 3300009545 Bacteria 13072
239 Ga0105237_10007488 3300009545 Bacteria 11939
240 Ga0105237_10007498 3300009545 Bacteria 11931
241 Ga0105237_10007794 3300009545 Bacteria 11679
242 Ga0105237_10011032 3300009545 Bacteria 9584
243 Ga0105237_10019925 3300009545 Bacteria 6925
244 Ga0105237_10072748 3300009545 Bacteria 3431
245 Ga0105237_10099080 3300009545 Bacteria 2906
246 Ga0105237_10099336 3300009545 Unclassified 2902
247 Ga0105237_10113345 3300009545 Bacteria 2704
248 Ga0105237_10119704 3300009545 Bacteria 2626
249 Ga0105237_10212689 3300009545 Bacteria 1933
250 Ga0105238_10001640 3300009551 Bacteria 22429
251 Ga0105238_10005225 3300009551 Bacteria 12826
252 Ga0105238_10046674 3300009551 Bacteria 4370
253 Ga0105238_10141371 3300009551 Unclassified 2384
254 Ga0105238_10190767 3300009551 Unclassified 2025
255 Ga0105249_10039780 3300009553 Bacteria 4269
256 Ga0105249_10202290 3300009553 Bacteria 1944
257 Ga0105249_10461865 3300009553 Bacteria 1310
258 Ga0105239_10000692 3300010375 Bacteria 48033
259 Ga0105239_10001797 3300010375 Bacteria 28154
260 Ga0105239_10003647 3300010375 Bacteria 18816
261 Ga0105239_10005346 3300010375 Bacteria 15069
262 Ga0105239_10013585 3300010375 Bacteria 9039
263 Ga0105239_10027184 3300010375 Bacteria 6298
264 Ga0105239_10043214 3300010375 Bacteria 4938
265 Ga0105239_10044353 3300010375 Unclassified 4876
266 Ga0105239_10205819 3300010375 Bacteria 2205
267 Ga0105239_10333926 3300010375 Bacteria 1710
268 Ga0105239_10391382 3300010375 Bacteria 1572
269 Ga0105246_10011667 3300011119 Bacteria 5459
270 Ga0105246_10122298 3300011119 Bacteria 1931
271 Ga0157373_10004217 3300013100 Bacteria 10847
272 Ga0157373_10008393 3300013100 Bacteria 7673
273 Ga0157373_10009649 3300013100 Bacteria 7124
274 Ga0157373_10023617 3300013100 Bacteria 4456
275 Ga0157373_10167699 3300013100 Bacteria 1545
276 Ga0157371_10003016 3300013102 Bacteria 15632
277 Ga0157371_10004130 3300013102 Bacteria 12806
278 Ga0157371_10004666 3300013102 Bacteria 11856
279 Ga0157371_10004945 3300013102 Bacteria 11447
280 Ga0157371_10010405 3300013102 Bacteria 7251
281 Ga0157371_10011760 3300013102 Bacteria 6723
282 Ga0157371_10046006 3300013102 Bacteria 3104
283 Ga0157371_10130566 3300013102 Bacteria 1787
284 Ga0157371_10133651 3300013102 Unclassified 1766
285 Ga0157370_10000173 3300013104 Bacteria 80263
286 Ga0157370_10009238 3300013104 Bacteria 10568
287 Ga0157370_10010368 3300013104 Bacteria 9824
288 Ga0157370_10012952 3300013104 Bacteria 8620
289 Ga0157370_10025866 3300013104 Bacteria 5804
290 Ga0157370_10226331 3300013104 Bacteria 1731
291 Ga0157370_10245528 3300013104 Bacteria 1656
292 Ga0157369_10036144 3300013105 Bacteria 5414
293 Ga0157369_10059346 3300013105 Bacteria 4125
294 Ga0157369_10075193 3300013105 Bacteria 3622
295 Ga0157369_10126619 3300013105 Bacteria 2708
296 Ga0157374_10000004 3300013296 Bacteria 759774
297 Ga0157374_10028237 3300013296 Bacteria 5068
298 Ga0157374_10115712 3300013296 Unclassified 2583
299 Ga0157378_10009577 3300013297 Bacteria 8435
300 Ga0157378_10018663 3300013297 Bacteria 6098
301 Ga0157378_10043098 3300013297 Bacteria 4006
302 Ga0157378_10077180 3300013297 Bacteria 3003
303 Ga0157378_10103052 3300013297 Unclassified 2607
304 Ga0157378_10111618 3300013297 Unclassified 2507
305 Ga0157378_10263092 3300013297 Unclassified 1656
306 Ga0163162_10002129 3300013306 Bacteria 18570
307 Ga0163162_10016723 3300013306 Bacteria 7170
308 Ga0163162_10043401 3300013306 Bacteria 4502
309 Ga0163162_10454091 3300013306 Bacteria 1413
310 Ga0163162_10540921 3300013306 Bacteria 1293
311 Ga0157372_10001592 3300013307 Bacteria 24698
312 Ga0157372_10004536 3300013307 Bacteria 14796
313 Ga0157372_10008341 3300013307 Bacteria 11019
314 Ga0157372_10017690 3300013307 Bacteria 7651
315 Ga0157372_10026066 3300013307 Bacteria 6359
316 Ga0157372_10038493 3300013307 Bacteria 5278
317 Ga0157372_10062509 3300013307 Bacteria 4172
318 Ga0157372_10072297 3300013307 Bacteria 3887
319 Ga0157372_10076726 3300013307 Unclassified 3773
320 Ga0157372_10083499 3300013307 Bacteria 3618
321 Ga0157372_10096118 3300013307 Unclassified 3376
322 Ga0157372_10211516 3300013307 Unclassified 2247
323 Ga0157372_10235437 3300013307 Bacteria 2124
324 Ga0157372_10278439 3300013307 Bacteria 1945
325 Ga0157372_10287716 3300013307 Bacteria 1911
326 Ga0157380_10046053 3300014326 Bacteria 3424
327 Ga0157380_10101747 3300014326 Bacteria 2395
328 Ga0182008_10000014 3300014497 Bacteria 263844
329 Ga0157377_10000790 3300014745 Bacteria 13078
330 Ga0157379_10003395 3300014968 Bacteria 13468
331 Ga0157379_10104858 3300014968 Bacteria 2537
332 Ga0157379_10147276 3300014968 Bacteria 2123
333 Ga0157376_10009474 3300014969 Bacteria 7072
334 Ga0157376_10011934 3300014969 Bacteria 6426
335 Ga0157376_10265424 3300014969 Bacteria 1610
336 Ga0209258_100378 3300025242 Bacteria 57308
337 Ga0209646_1000006 3300025246 Bacteria 694084
338 Ga0209026_1000977 3300025250 Bacteria 14280
339 Ga0209148_1000391 3300025254 Bacteria 51783
340 Ga0209758_1001052 3300025297 Bacteria 36116
341 Ga0207426_1000009 3300025302 Bacteria 797229
342 Ga0207426_1000060 3300025302 Bacteria 363139
343 Ga0207426_1000093 3300025302 Bacteria 277663
344 Ga0207697_10004402 3300025315 Bacteria 6733
345 Ga0207656_10030815 3300025321 Unclassified 2218
346 Ga0207710_10026026 3300025900 Bacteria 2526
347 Ga0207688_10012535 3300025901 Bacteria 4614
348 Ga0207688_10021388 3300025901 Bacteria 3535
349 Ga0207680_10000129 3300025903 Bacteria 35136
350 Ga0207680_10051127 3300025903 Bacteria 2470
351 Ga0207647_10003702 3300025904 Bacteria 11430
352 Ga0207645_10000334 3300025907 Bacteria 39321
353 Ga0207643_10011359 3300025908 Bacteria 4808
354 Ga0207643_10047449 3300025908 Bacteria 2430
355 Ga0207705_10057737 3300025909 Bacteria 2799
356 Ga0207705_10193809 3300025909 Bacteria 1537
357 Ga0207654_10004073 3300025911 Bacteria 7362
358 Ga0207654_10009320 3300025911 Bacteria 4983
359 Ga0207654_10014995 3300025911 Bacteria 4013
360 Ga0207654_10018049 3300025911 Unclassified 3699
361 Ga0207654_10044014 3300025911 Bacteria 2533
362 Ga0207707_10003158 3300025912 Bacteria 14626
363 Ga0207707_10071875 3300025912 Bacteria 3015
364 Ga0207707_10164757 3300025912 Bacteria 1937
365 Ga0207695_10000073 3300025913 Bacteria 312565
366 Ga0207695_10000084 3300025913 Bacteria 282392
367 Ga0207695_10000982 3300025913 Bacteria 50708
368 Ga0207695_10002106 3300025913 Bacteria 30249
369 Ga0207695_10007057 3300025913 Bacteria 14408
370 Ga0207695_10016206 3300025913 Bacteria 8734
371 Ga0207695_10016222 3300025913 Bacteria 8730
372 Ga0207695_10041974 3300025913 Bacteria 4891
373 Ga0207695_10052397 3300025913 Unclassified 4276
374 Ga0207671_10000871 3300025914 Bacteria 38241
375 Ga0207671_10002130 3300025914 Bacteria 21609
376 Ga0207671_10002759 3300025914 Bacteria 18342
377 Ga0207671_10002969 3300025914 Bacteria 17433
378 Ga0207671_10003607 3300025914 Bacteria 15295
379 Ga0207671_10003756 3300025914 Bacteria 14949
380 Ga0207671_10005501 3300025914 Bacteria 11657
381 Ga0207671_10008024 3300025914 Bacteria 9033
382 Ga0207671_10016755 3300025914 Bacteria 5683
383 Ga0207671_10022311 3300025914 Bacteria 4787
384 Ga0207671_10043956 3300025914 Bacteria 3302
385 Ga0207671_10046001 3300025914 Bacteria 3228
386 Ga0207671_10086690 3300025914 Bacteria 2354
387 Ga0207671_10139034 3300025914 Bacteria 1870
388 Ga0207660_10001961 3300025917 Bacteria 13719
389 Ga0207660_10032766 3300025917 Bacteria 3588
390 Ga0207657_10032220 3300025919 Bacteria 4738
391 Ga0207657_10232744 3300025919 Bacteria 1473
392 Ga0207652_10000435 3300025921 Bacteria 43359
393 Ga0207652_10004899 3300025921 Bacteria 10831
394 Ga0207652_10011535 3300025921 Bacteria 7124
395 Ga0207681_10002639 3300025923 Bacteria 11370
396 Ga0207681_10209572 3300025923 Bacteria 1501
397 Ga0207694_10006181 3300025924 Bacteria 9146
398 Ga0207694_10008740 3300025924 Bacteria 7642
399 Ga0207694_10029477 3300025924 Bacteria 4188
400 Ga0207650_10119207 3300025925 Bacteria 2052
401 Ga0207650_10131413 3300025925 Bacteria 1959
402 Ga0207659_10172679 3300025926 Bacteria 1706
403 Ga0207644_10154011 3300025931 Bacteria 1781
404 Ga0207686_10148307 3300025934 Bacteria 1630
405 Ga0207691_10008098 3300025940 Bacteria 10094
406 Ga0207689_10013627 3300025942 Bacteria 6933
407 Ga0207689_10030279 3300025942 Bacteria 4511
408 Ga0207689_10046567 3300025942 Bacteria 3584
409 Ga0207689_10049482 3300025942 Bacteria 3467
410 Ga0207689_10089999 3300025942 Bacteria 2521
411 Ga0207689_10090348 3300025942 Bacteria 2516
412 Ga0207689_10305601 3300025942 Bacteria 1319
413 Ga0207667_10002679 3300025949 Bacteria 22020
414 Ga0207667_10003291 3300025949 Bacteria 19940
415 Ga0207667_10004126 3300025949 Bacteria 17853
416 Ga0207667_10005267 3300025949 Bacteria 15778
417 Ga0207667_10010341 3300025949 Bacteria 10911
418 Ga0207667_10010867 3300025949 Bacteria 10616
419 Ga0207667_10031118 3300025949 Bacteria 5764
420 Ga0207667_10075855 3300025949 Bacteria 3490
421 Ga0207667_10184037 3300025949 Bacteria 2145
422 Ga0207667_10283863 3300025949 Bacteria 1692
423 Ga0207651_10110240 3300025960 Bacteria 2064
424 Ga0207712_10034122 3300025961 Bacteria 3445
425 Ga0207712_10081059 3300025961 Bacteria 2362
426 Ga0207712_10083439 3300025961 Bacteria 2332
427 Ga0207668_10041617 3300025972 Bacteria 3108
428 Ga0207668_10059287 3300025972 Bacteria 2681
429 Ga0207668_10088463 3300025972 Bacteria 2268
430 Ga0207640_10013691 3300025981 Bacteria 4654
431 Ga0207640_10089032 3300025981 Bacteria 2132
432 Ga0207640_10147080 3300025981 Unclassified 1726
433 Ga0207658_10021116 3300025986 Bacteria 4515
434 Ga0207658_10155948 3300025986 Bacteria 1866
435 Ga0207677_10002161 3300026023 Bacteria 10329
436 Ga0207703_10011853 3300026035 Bacteria 6788
437 Ga0207639_10002155 3300026041 Bacteria 13254
438 Ga0207639_10123853 3300026041 Bacteria 2129
439 Ga0207702_10011657 3300026078 Bacteria 7323
440 Ga0207702_10059042 3300026078 Bacteria 3266
441 Ga0207702_10122879 3300026078 Unclassified 2326
442 Ga0207702_10145392 3300026078 Bacteria 2151
443 Ga0207641_10000043 3300026088 Bacteria 186340
444 Ga0207641_10040430 3300026088 Bacteria 3905
445 Ga0207641_10065308 3300026088 Bacteria 3113
446 Ga0207648_10004255 3300026089 Bacteria 14783
447 Ga0207648_10004687 3300026089 Bacteria 13985
448 Ga0207648_10104640 3300026089 Unclassified 2482
449 Ga0207648_10174164 3300026089 Bacteria 1902
450 Ga0207676_10002326 3300026095 Bacteria 13635
451 Ga0207676_10082685 3300026095 Bacteria 2613
452 Ga0207674_10004688 3300026116 Bacteria 16408
453 Ga0207674_10051589 3300026116 Bacteria 4197
454 Ga0207674_10083541 3300026116 Bacteria 3193
455 Ga0207674_10193176 3300026116 Unclassified 1985
456 Ga0207675_100002316 3300026118 Bacteria 18907
457 Ga0207675_100006400 3300026118 Bacteria 11156
458 Ga0207675_100044646 3300026118 Bacteria 4142
459 Ga0207675_100046235 3300026118 Bacteria 4066
460 Ga0207675_100143353 3300026118 Bacteria 2270
461 Ga0207683_10008433 3300026121 Bacteria 8821
462 Ga0207683_10102531 3300026121 Bacteria 2555
463 Ga0207683_10148825 3300026121 Bacteria 2112
464 Ga0207698_10001608 3300026142 Bacteria 13148
465 Ga0207698_10004994 3300026142 Bacteria 8134
466 Ga0207698_10005349 3300026142 Bacteria 7917
467 Ga0207698_10009464 3300026142 Bacteria 6216
468 Ga0207698_10033699 3300026142 Bacteria 3725
469 Ga0207698_10042832 3300026142 Bacteria 3386
470 Ga0207698_10045007 3300026142 Bacteria 3321
471 Ga0207698_10098517 3300026142 Unclassified 2416
472 Ga0207698_10261278 3300026142 Bacteria 1591
473 Ga0207698_10336491 3300026142 Bacteria 1420
474 Ga0268266_10000010 3300028379 Bacteria 1030233
475 Ga0268266_10052455 3300028379 Bacteria 3502
476 Ga0268265_10003389 3300028380 Bacteria 11474
477 Ga0268265_10072673 3300028380 Bacteria 2684
478 Ga0268264_10000052 3300028381 Bacteria 321218
479 Ga0268264_10001431 3300028381 Bacteria 22308
480 Ga0268264_10006997 3300028381 Bacteria 9466
481 Ga0268264_10011910 3300028381 Bacteria 7164
482 Ga0268264_10018523 3300028381 Bacteria 5695
483 Ga0268264_10028999 3300028381 Bacteria 4531
484 Ga0268264_10045505 3300028381 Bacteria 3643
485 Ga0268264_10115250 3300028381 Unclassified 2361
486 Ga0268264_10160701 3300028381 Bacteria 2023
487 Ga0307517_10042625 3300028786 Bacteria 4860
488 Ga0307515_10000036 3300028794 Bacteria 332188
489 Ga0307511_10001606 3300030521 Bacteria 23990
490 Ga0265327_10000122 3300031251 Bacteria 169992
491 Ga0307513_10039035 3300031456 Bacteria 5266
492 Ga0307513_10043154 3300031456 Bacteria 4957
493 Ga0307508_10000828 3300031616 Bacteria 35946
494 Ga0307412_10000043 3300031911 Bacteria 166562
495 Ga0307414_10000564 3300032004 Bacteria 19353
496 Ga0307414_10002765 3300032004 Bacteria 9239
497 Ga0307507_10060399 3300033179 Bacteria 3540
498 Ga0307510_10000528 3300033180 Bacteria 38156
499 Ga0395900_0275904 3300037418 Bacteria 1675
500 Ga0395905_0038234 3300037471 Unclassified 4502
501 Ga0395905_0091084 3300037471 Bacteria 2859
502 Ga0436365_0054602 3300039437 Bacteria 10891
503 Ga0439436_0003540 3300041404 Bacteria 4747
504 Ga0439439_0002830 3300041406 Bacteria 3747
505 Ga0439439_0012892 3300041406 Unclassified 2023
506 Ga0451853_2434045 3300041512 Bacteria 4613
507 Ga0439449_0020085 3300042007 Bacteria 2503
508 Ga0439457_000072 3300042014 Bacteria 22114
509 Ga0439457_001608 3300042014 Bacteria 6737
510 Ga0439462_0003290 3300042015 Bacteria 3864
511 Ga0450898_007892 3300042134 Bacteria 1667
512 Ga0439434_0032329 3300042435 Bacteria 1593
513 Ga0466969_0001643 3300044656 Bacteria 11991
514 Ga0466972_0000015 3300044658 Bacteria 210687
515 Ga0466972_0000025 3300044658 Bacteria 186601
516 Ga0466972_0000026 3300044658 Bacteria 184739
517 Ga0466972_0000032 3300044658 Bacteria 159445
518 Ga0466972_0000204 3300044658 Bacteria 43459
519 Ga0466972_0002307 3300044658 Bacteria 9387
520 Ga0466966_0000022 3300044684 Bacteria 112729
521 Ga0466966_0125792 3300044684 Bacteria 1572
522 Ga0466964_0077301 3300044706 Bacteria 1421
523 Ga0466968_0049466 3300044735 Bacteria 1791
524 Ga0466970_0000579 3300044765 Bacteria 17895
525 Ga0466957_0000009 3300044842 Bacteria 76227
526 Ga0466957_0000286 3300044842 Bacteria 24670
527 Ga0466957_0000411 3300044842 Bacteria 20992
528 Ga0466957_0000853 3300044842 Bacteria 15642
529 Ga0466957_0011545 3300044842 Bacteria 5101
530 Ga0466959_0000050 3300045049 Bacteria 83281
531 Ga0495606_0004398 3300046507 Bacteria 14108
532 Ga0495606_0010511 3300046507 Bacteria 7668
533 Ga0495643_0019753 3300046522 Bacteria 3895
534 Ga0495648_0002229 3300046524 Bacteria 18128
535 Ga0495648_0003458 3300046524 Bacteria 13894
536 Ga0495611_0000596 3300046648 Bacteria 20836
537 Ga0495661_0145499 3300046665 Bacteria 1285
538 Ga0495687_000039 3300047443 Bacteria 245077
539 Ga0495686_0004797 3300047472 Bacteria 10915
540 Ga0495686_0030074 3300047472 Bacteria 3530
541 Ga0495686_0098184 3300047472 Bacteria 1770
542 Ga0496108_0244877 3300048911 Bacteria 1560
543 Ga0501032_0098981 3300049569 Bacteria 1932
544 Ga0501033_0211222 3300049570 Bacteria 1384
545 Ga0501036_0018458 3300049572 Bacteria 5844
546 Ga0501037_0054064 3300049573 Bacteria 2937
547 Ga0501038_0002828 3300049574 Bacteria 16153
548 Ga0501038_0102829 3300049574 Bacteria 2376
549 Ga0501038_0125316 3300049574 Bacteria 2115
550 Ga0501039_0008969 3300049575 Bacteria 7619
551 Ga0501043_0030186 3300049579 Bacteria 4259
552 Ga0501043_0051210 3300049579 Bacteria 3245
553 Ga0501043_0095523 3300049579 Bacteria 2336
554 Ga0501043_0108570 3300049579 Unclassified 2179
555 Ga0501043_0188879 3300049579 Bacteria 1603
556 Ga0501046_0096998 3300049580 Bacteria 2265
557 Ga0501047_0006975 3300049581 Bacteria 10606
558 Ga0501047_0019647 3300049581 Bacteria 6482
559 Ga0501047_0236071 3300049581 Bacteria 1680
560 Ga0501047_0296926 3300049581 Bacteria 1459
561 Ga0501067_0081213 3300049583 Bacteria 1797
562 Ga0501068_0032481 3300049584 Bacteria 3105
563 Ga0501074_0051978 3300049590 Bacteria 2958
564 Ga0501219_000251 3300049703 Bacteria 9840
565 Ga0501225_0000596 3300049705 Bacteria 11259
566 Ga0501079_0037046 3300049741 Bacteria 3758
567 Ga0501080_0057254 3300049742 Bacteria 3629
568 Ga0501083_0020899 3300049744 Bacteria 4550
569 Ga0501035_0028404 3300049822 Bacteria 5106
570 Ga0501035_0094139 3300049822 Unclassified 2635
571 Ga0501035_0339122 3300049822 Bacteria 1260
572 Ga0501044_0006895 3300049823 Bacteria 12508
573 Ga0501044_0023064 3300049823 Bacteria 6625
574 Ga0501044_0031379 3300049823 Bacteria 5593
575 Ga0501044_0041038 3300049823 Bacteria 4818
576 Ga0501044_0098007 3300049823 Bacteria 2952
577 Ga0501044_0115749 3300049823 Bacteria 2687
578 Ga0501284_00025 3300050005 Bacteria 76385
579 nmdc:mga0k408_49317_c1 3300050493 Bacteria 2437
580 nmdc:mga05p37_134031_c1 3300050507 Unclassified 3039
581 nmdc:mga05p37_2439_c1 3300050507 Bacteria 7171
582 nmdc:mga05p37_2439_c2 3300050507 Bacteria 7779
583 nmdc:mga09592_7174_c1 3300050508 Bacteria 9060
584 nmdc:mga0qj67_74094_c1 3300050509 Bacteria 2720
585 nmdc:mga08y16_13513_c1 3300050511 Bacteria 8590
586 nmdc:mga08y16_344300_c1 3300050511 Unclassified 1532
587 Ga0500578_0000010 3300053086 Bacteria 217642
588 Ga0500578_0000032 3300053086 Bacteria 138166
589 Ga0500644_0000048 3300053088 Bacteria 73311
590 Ga0500646_0003820 3300053090 Bacteria 3846
591 Ga0500646_0003944 3300053090 Bacteria 3774
592 Ga0500583_0000013 3300053092 Bacteria 150087
593 Ga0500583_0000039 3300053092 Bacteria 87189
594 Ga0500583_0005528 3300053092 Bacteria 4248
595 Ga0500583_0046956 3300053092 Bacteria 1988
596 Ga0500651_0004425 3300053093 Bacteria 7862
597 Ga0500651_0033204 3300053093 Bacteria 3255
598 Ga0500562_000030 3300053108 Bacteria 92407
599 Ga0500569_001173 3300053109 Bacteria 4845
600 Ga0500642_0012016 3300053130 Bacteria 3124
601 Ga0500658_0021324 3300053134 Bacteria 2452
602 Ga0500568_0006850 3300053139 Bacteria 5672
603 Ga0500568_0012237 3300053139 Bacteria 3953
604 Ga0500568_0035283 3300053139 Bacteria 2042
605 Ga0500577_0001531 3300053142 Bacteria 5890
606 Ga0500589_037799 3300053147 Unclassified 2253
607 Ga0500616_0013441 3300053153 Bacteria 4752
608 Ga0500616_0029821 3300053153 Bacteria 2999
609 Ga0500622_0000560 3300053156 Bacteria 34086
610 Ga0500622_0006033 3300053156 Bacteria 7121
611 Ga0500622_0007982 3300053156 Bacteria 5959
612 Ga0500622_0023415 3300053156 Bacteria 3271
613 Ga0500634_0008068 3300053161 Bacteria 5240
614 Ga0500636_0016706 3300053177 Unclassified 4329
615 Ga0500636_0045201 3300053177 Bacteria 2598
616 Ga0500611_003079 3300053727 Bacteria 2091

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0211222 Ga0501033_0211222_36_1040 304
2 3300049569 Ga0501032_0098981 Ga0501032_0098981_866_1852 309
3 3300005535 Ga0070684_100010447 Ga0070684_1000104472 319
4 3300005539 Ga0068853_100314672 Ga0068853_1003146722 319
5 3300009098 Ga0105245_10217860 Ga0105245_102178602 319
6 3300013306 Ga0163162_10540921 Ga0163162_105409211 325
7 3300004800 Ga0058861_11585166 Ga0058861_115851662 330
8 3300003322 rootL2_10179877 rootL2_101798771 332
9 3300025931 Ga0207644_10154011 Ga0207644_101540111 341
10 3300005347 Ga0070668_100092742 Ga0070668_1000927421 344
11 3300009093 Ga0105240_10040963 Ga0105240_100409633 344
12 3300009174 Ga0105241_10061063 Ga0105241_100610633 344
13 3300009545 Ga0105237_10011032 Ga0105237_100110328 344
14 3300009545 Ga0105237_10099336 Ga0105237_100993363 344
15 3300009551 Ga0105238_10190767 Ga0105238_101907672 344
16 3300009553 Ga0105249_10039780 Ga0105249_100397802 344
17 3300009553 Ga0105249_10461865 Ga0105249_104618651 344
18 3300011119 Ga0105246_10011667 Ga0105246_100116672 344
19 3300013296 Ga0157374_10115712 Ga0157374_101157122 344
20 3300013297 Ga0157378_10111618 Ga0157378_101116182 344
21 3300013306 Ga0163162_10454091 Ga0163162_104540911 344
22 3300053156 Ga0500622_0023415 Ga0500622_0023415_349_1446 344
23 3300009093 Ga0105240_10003417 Ga0105240_1000341711 345
24 3300009093 Ga0105240_10020869 Ga0105240_100208694 345
25 3300009093 Ga0105240_10000753 Ga0105240_1000075318 346
26 3300009174 Ga0105241_10003488 Ga0105241_100034881 346
27 3300009545 Ga0105237_10019925 Ga0105237_100199255 346
28 3300009551 Ga0105238_10001640 Ga0105238_100016409 346
29 3300010375 Ga0105239_10044353 Ga0105239_100443531 346
30 3300013307 Ga0157372_10076726 Ga0157372_100767262 346
31 3300046665 Ga0495661_0145499 Ga0495661_0145499_12_1061 348
32 iso_pu_bacteria 2896109856 2896109961 351
33 3300006358 Ga0068871_100033355 Ga0068871_1000333552 355
34 3300013297 Ga0157378_10018663 Ga0157378_100186632 355
35 3300048911 Ga0496108_0244877 Ga0496108_0244877_241_1530 355
36 3300049822 Ga0501035_0339122 Ga0501035_0339122_18_1160 359
37 3300044842 Ga0466957_0000009 Ga0466957_0000009_7234_8433 360
38 3300005563 Ga0068855_100062689 Ga0068855_1000626892 364
39 3300025911 Ga0207654_10044014 Ga0207654_100440143 364
40 3300025949 Ga0207667_10005267 Ga0207667_1000526717 364
41 3300044658 Ga0466972_0000032 Ga0466972_0000032_18333_19490 366
42 3300006358 Ga0068871_100037190 Ga0068871_1000371901 367
43 3300037471 Ga0395905_0038234 Ga0395905_0038234_135_1352 369
44 3300005336 Ga0070680_100001551 Ga0070680_10000155111 370
45 3300005341 Ga0070691_10123188 Ga0070691_101231881 370
46 3300005458 Ga0070681_10015185 Ga0070681_100151853 370
47 3300005530 Ga0070679_100001501 Ga0070679_1000015011 370
48 3300005547 Ga0070693_100012032 Ga0070693_1000120322 370
49 3300005563 Ga0068855_100053688 Ga0068855_1000536882 370
50 3300005563 Ga0068855_100077008 Ga0068855_1000770083 370
51 3300006358 Ga0068871_100179598 Ga0068871_1001795982 370
52 3300009093 Ga0105240_10333768 Ga0105240_103337682 370
53 3300009545 Ga0105237_10072748 Ga0105237_100727481 370
54 3300010375 Ga0105239_10001797 Ga0105239_1000179714 370
55 3300025911 Ga0207654_10009320 Ga0207654_100093202 370
56 3300025912 Ga0207707_10003158 Ga0207707_100031583 370
57 3300025913 Ga0207695_10016222 Ga0207695_100162223 370
58 3300025914 Ga0207671_10043956 Ga0207671_100439562 370
59 3300025917 Ga0207660_10001961 Ga0207660_100019617 370
60 3300025921 Ga0207652_10000435 Ga0207652_1000043532 370
61 3300025949 Ga0207667_10075855 Ga0207667_100758551 370
62 3300005337 Ga0070682_100003358 Ga0070682_1000033584 372
63 3300003323 rootH1_10014157 rootH1_100141572 373
64 3300005288 Ga0065714_10004779 Ga0065714_100047796 373
65 3300005289 Ga0065704_10070305 Ga0065704_100703056 373
66 3300005289 Ga0065704_10086017 Ga0065704_100860172 373
67 3300009093 Ga0105240_10014572 Ga0105240_100145725 373
68 3300009174 Ga0105241_10004530 Ga0105241_100045303 373
69 3300013100 Ga0157373_10009649 Ga0157373_100096494 373
70 3300013104 Ga0157370_10009238 Ga0157370_100092383 373
71 3300031616 Ga0307508_10000828 Ga0307508_1000082817 373
72 3300031911 Ga0307412_10000043 Ga0307412_1000004372 373
73 3300032004 Ga0307414_10002765 Ga0307414_100027653 373
74 3300044658 Ga0466972_0000015 Ga0466972_0000015_12253_13461 374
75 3300005548 Ga0070665_100000074 Ga0070665_10000007416 375
76 3300028379 Ga0268266_10000010 Ga0268266_10000010639 375
77 3300003320 rootH2_10026598 rootH2_100265981 376
78 3300003323 rootH1_10076781 rootH1_100767812 376
79 3300009545 Ga0105237_10007498 Ga0105237_100074987 376
80 3300010375 Ga0105239_10043214 Ga0105239_100432144 376
81 3300025914 Ga0207671_10086690 Ga0207671_100866903 376
82 iso_pu_bacteria 2883068021 2883072654 376
83 3300005341 Ga0070691_10022527 Ga0070691_100225272 377
84 3300049574 Ga0501038_0102829 Ga0501038_0102829_767_1990 377
85 3300049579 Ga0501043_0051210 Ga0501043_0051210_1103_2326 377
86 3300049580 Ga0501046_0096998 Ga0501046_0096998_96_1319 377
87 3300049581 Ga0501047_0296926 Ga0501047_0296926_213_1436 377
88 3300049583 Ga0501067_0081213 Ga0501067_0081213_548_1771 377
89 3300049584 Ga0501068_0032481 Ga0501068_0032481_599_1822 377
90 3300049590 Ga0501074_0051978 Ga0501074_0051978_1064_2287 377
91 3300049741 Ga0501079_0037046 Ga0501079_0037046_1812_3035 377
92 3300049742 Ga0501080_0057254 Ga0501080_0057254_1808_3031 377
93 3300049744 Ga0501083_0020899 Ga0501083_0020899_2898_4121 377
94 3300049822 Ga0501035_0028404 Ga0501035_0028404_2829_4052 377
95 3300053177 Ga0500636_0016706 Ga0500636_0016706_2374_3543 379
96 iso_pu_bacteria 2914759650 2914762387 379
97 3300013102 Ga0157371_10004945 Ga0157371_100049453 380
98 3300030521 Ga0307511_10001606 Ga0307511_1000160614 380
99 iso_pu_bacteria 2738541278 2738724764 380
100 iso_pu_bacteria 2883068021 2883070791 380
101 iso_pu_bacteria 2929154850 2929158082 380
102 iso_pu_bacteria 2929921140 2929924898 380
103 iso_pu_bacteria 8003151029 8003154981 380
104 3300003354 JGI25160J50197_1005269 JGI25160J50197_10052693 381
105 3300025302 Ga0207426_1000009 Ga0207426_100000939 381
106 iso_pu_bacteria 2738541278 2738728779 381
107 iso_pu_bacteria 2818991460 2819680643 381
108 iso_pu_bacteria 2884791551 2884797855 381
109 iso_pu_bacteria 2929177148 2929182973 381
110 iso_pu_bacteria 2945977869 2945978938 381
111 iso_pu_bacteria 2946013367 2946015201 381
112 3300003322 rootL2_10007315 rootL2_100073151 382
113 3300005330 Ga0070690_100050138 Ga0070690_1000501382 382
114 3300005338 Ga0068868_100037453 Ga0068868_1000374532 382
115 3300005343 Ga0070687_100058784 Ga0070687_1000587842 382
116 3300005364 Ga0070673_100039383 Ga0070673_1000393833 382
117 3300005457 Ga0070662_100131214 Ga0070662_1001312141 382
118 3300005578 Ga0068854_100188167 Ga0068854_1001881672 382
119 3300009093 Ga0105240_10000513 Ga0105240_1000051347 382
120 3300009545 Ga0105237_10000406 Ga0105237_1000040610 382
121 3300013104 Ga0157370_10000173 Ga0157370_1000017324 382
122 3300013297 Ga0157378_10009577 Ga0157378_100095777 382
123 3300025913 Ga0207695_10000084 Ga0207695_10000084122 382
124 3300025914 Ga0207671_10002969 Ga0207671_100029695 382
125 3300026118 Ga0207675_100143353 Ga0207675_1001433532 382
126 3300026142 Ga0207698_10098517 Ga0207698_100985172 382
127 3300044658 Ga0466972_0000025 Ga0466972_0000025_32076_33305 382
128 3300046507 Ga0495606_0004398 Ga0495606_0004398_7525_8772 382
129 3300049573 Ga0501037_0054064 Ga0501037_0054064_1663_2889 382
130 3300049823 Ga0501044_0115749 Ga0501044_0115749_1294_2520 382
131 3300050511 nmdc:mga08y16_344300_c1 nmdc:mga08y16_344300_c1_58_1260 382
132 3300053086 Ga0500578_0000032 Ga0500578_0000032_49630_50841 382
133 3300003316 rootH1_10136269 rootH1_101362692 383
134 3300003320 rootH2_10002166 rootH2_100021669 383
135 3300003320 rootH2_10213446 rootH2_102134462 383
136 3300003322 rootL2_10187122 rootL2_101871222 383
137 3300003322 rootL2_10194409 rootL2_101944093 383
138 3300003354 JGI25160J50197_1000358 JGI25160J50197_100035827 383
139 3300003761 Ga0055535_1000572 Ga0055535_100057224 383
140 3300003762 Ga0055542_1005928 Ga0055542_10059282 383
141 3300005327 Ga0070658_10052687 Ga0070658_100526872 383
142 3300005539 Ga0068853_100376903 Ga0068853_1003769031 383
143 3300005614 Ga0068856_100013391 Ga0068856_1000133912 383
144 3300005614 Ga0068856_100029674 Ga0068856_1000296743 383
145 3300006844 Ga0075428_100140694 Ga0075428_1001406943 383
146 3300006847 Ga0075431_100000993 Ga0075431_10000099311 383
147 3300006880 Ga0075429_100067217 Ga0075429_1000672171 383
148 3300009174 Ga0105241_10036146 Ga0105241_100361462 383
149 3300013102 Ga0157371_10003016 Ga0157371_100030163 383
150 3300013102 Ga0157371_10010405 Ga0157371_100104052 383
151 3300013296 Ga0157374_10000004 Ga0157374_1000000424 383
152 3300013307 Ga0157372_10017690 Ga0157372_100176902 383
153 3300013307 Ga0157372_10072297 Ga0157372_100722972 383
154 3300014969 Ga0157376_10011934 Ga0157376_100119344 383
155 3300025242 Ga0209258_100378 Ga0209258_10037840 383
156 3300025254 Ga0209148_1000391 Ga0209148_10003915 383
157 3300025302 Ga0207426_1000093 Ga0207426_1000093130 383
158 3300025909 Ga0207705_10193809 Ga0207705_101938091 383
159 3300025949 Ga0207667_10010341 Ga0207667_100103412 383
160 3300026078 Ga0207702_10011657 Ga0207702_100116572 383
161 3300031251 Ga0265327_10000122 Ga0265327_10000122107 383
162 3300033179 Ga0307507_10060399 Ga0307507_100603991 383
163 3300044842 Ga0466957_0000286 Ga0466957_0000286_12668_13885 383
164 3300045049 Ga0466959_0000050 Ga0466959_0000050_4975_6192 383
165 3300049572 Ga0501036_0018458 Ga0501036_0018458_4637_5833 383
166 3300049574 Ga0501038_0002828 Ga0501038_0002828_6435_7643 383
167 3300049575 Ga0501039_0008969 Ga0501039_0008969_6034_7242 383
168 3300049579 Ga0501043_0108570 Ga0501043_0108570_104_1312 383
169 3300049823 Ga0501044_0041038 Ga0501044_0041038_1952_3160 383
170 3300050507 nmdc:mga05p37_2439_c1 nmdc:mga05p37_2439_c1_5542_6765 383
171 3300050507 nmdc:mga05p37_2439_c2 nmdc:mga05p37_2439_c2_5372_6598 383
172 3300053088 Ga0500644_0000048 Ga0500644_0000048_35616_36797 383
173 3300053153 Ga0500616_0013441 Ga0500616_0013441_130_1347 383
174 3300053161 Ga0500634_0008068 Ga0500634_0008068_1921_3102 383
175 3300001979 JGI24740J21852_10001447 JGI24740J21852_100014475 384
176 3300001979 JGI24740J21852_10002576 JGI24740J21852_100025763 384
177 3300002077 JGI24744J21845_10013557 JGI24744J21845_100135572 384
178 3300002738 JGI25154J39366_1000028 JGI25154J39366_100002843 384
179 3300003320 rootH2_10063549 rootH2_100635492 384
180 3300003320 rootH2_10075466 rootH2_100754661 384
181 3300003322 rootL2_10095474 rootL2_100954742 384
182 3300003322 rootL2_10181442 rootL2_101814422 384
183 3300003323 rootH1_10006077 rootH1_1000607710 384
184 3300003323 rootH1_10270368 rootH1_102703682 384
185 3300005289 Ga0065704_10071036 Ga0065704_100710362 384
186 3300005327 Ga0070658_10105408 Ga0070658_101054081 384
187 3300005327 Ga0070658_10147562 Ga0070658_101475622 384
188 3300005331 Ga0070670_100150585 Ga0070670_1001505852 384
189 3300005331 Ga0070670_100282275 Ga0070670_1002822751 384
190 3300005334 Ga0068869_100015307 Ga0068869_1000153072 384
191 3300005334 Ga0068869_100161071 Ga0068869_1001610711 384
192 3300005334 Ga0068869_100274222 Ga0068869_1002742221 384
193 3300005335 Ga0070666_10000029 Ga0070666_1000002980 384
194 3300005335 Ga0070666_10009103 Ga0070666_100091032 384
195 3300005336 Ga0070680_100010458 Ga0070680_1000104582 384
196 3300005338 Ga0068868_100003582 Ga0068868_1000035822 384
197 3300005338 Ga0068868_100282973 Ga0068868_1002829731 384
198 3300005339 Ga0070660_100051065 Ga0070660_1000510651 384
199 3300005347 Ga0070668_100016047 Ga0070668_1000160473 384
200 3300005347 Ga0070668_100092365 Ga0070668_1000923652 384
201 3300005353 Ga0070669_100026176 Ga0070669_1000261761 384
202 3300005353 Ga0070669_100169275 Ga0070669_1001692751 384
203 3300005356 Ga0070674_100006515 Ga0070674_1000065152 384
204 3300005356 Ga0070674_100033355 Ga0070674_1000333552 384
205 3300005364 Ga0070673_100004392 Ga0070673_1000043921 384
206 3300005364 Ga0070673_100068425 Ga0070673_1000684252 384
207 3300005366 Ga0070659_100022182 Ga0070659_1000221823 384
208 3300005366 Ga0070659_100174333 Ga0070659_1001743331 384
209 3300005367 Ga0070667_100008090 Ga0070667_1000080902 384
210 3300005367 Ga0070667_100193996 Ga0070667_1001939961 384
211 3300005456 Ga0070678_100196617 Ga0070678_1001966171 384
212 3300005458 Ga0070681_10098585 Ga0070681_100985851 384
213 3300005458 Ga0070681_10126190 Ga0070681_101261902 384
214 3300005459 Ga0068867_100023015 Ga0068867_1000230154 384
215 3300005466 Ga0070685_10148373 Ga0070685_101483731 384
216 3300005530 Ga0070679_100009059 Ga0070679_1000090594 384
217 3300005535 Ga0070684_100001987 Ga0070684_1000019873 384
218 3300005539 Ga0068853_100002923 Ga0068853_10000292312 384
219 3300005543 Ga0070672_100033889 Ga0070672_1000338892 384
220 3300005543 Ga0070672_100057436 Ga0070672_1000574362 384
221 3300005548 Ga0070665_100000074 Ga0070665_10000007411 384
222 3300005548 Ga0070665_100022051 Ga0070665_1000220512 384
223 3300005548 Ga0070665_100031635 Ga0070665_1000316353 384
224 3300005563 Ga0068855_100004568 Ga0068855_1000045686 384
225 3300005563 Ga0068855_100024022 Ga0068855_1000240224 384
226 3300005563 Ga0068855_100030877 Ga0068855_1000308772 384
227 3300005563 Ga0068855_100186563 Ga0068855_1001865632 384
228 3300005563 Ga0068855_100287288 Ga0068855_1002872882 384
229 3300005577 Ga0068857_100002026 Ga0068857_1000020261 384
230 3300005577 Ga0068857_100118436 Ga0068857_1001184361 384
231 3300005577 Ga0068857_100122354 Ga0068857_1001223542 384
232 3300005577 Ga0068857_100176588 Ga0068857_1001765882 384
233 3300005578 Ga0068854_100010050 Ga0068854_1000100502 384
234 3300005578 Ga0068854_100087872 Ga0068854_1000878722 384
235 3300005614 Ga0068856_100156912 Ga0068856_1001569122 384
236 3300005614 Ga0068856_100176682 Ga0068856_1001766822 384
237 3300005614 Ga0068856_100266204 Ga0068856_1002662041 384
238 3300005616 Ga0068852_100001929 Ga0068852_1000019291 384
239 3300005616 Ga0068852_100161869 Ga0068852_1001618692 384
240 3300005616 Ga0068852_100219561 Ga0068852_1002195612 384
241 3300005616 Ga0068852_100295517 Ga0068852_1002955172 384
242 3300005617 Ga0068859_100000035 Ga0068859_100000035132 384
243 3300005617 Ga0068859_100013939 Ga0068859_1000139392 384
244 3300005617 Ga0068859_100202063 Ga0068859_1002020631 384
245 3300005618 Ga0068864_100001198 Ga0068864_10000119817 384
246 3300005719 Ga0068861_100093033 Ga0068861_1000930332 384
247 3300005719 Ga0068861_100161131 Ga0068861_1001611311 384
248 3300005834 Ga0068851_10029950 Ga0068851_100299502 384
249 3300005840 Ga0068870_10051742 Ga0068870_100517422 384
250 3300005842 Ga0068858_100033759 Ga0068858_1000337596 384
251 3300005843 Ga0068860_100000034 Ga0068860_100000034150 384
252 3300005843 Ga0068860_100000034 Ga0068860_100000034157 384
253 3300005843 Ga0068860_100005549 Ga0068860_1000055494 384
254 3300005843 Ga0068860_100009592 Ga0068860_1000095924 384
255 3300005843 Ga0068860_100016480 Ga0068860_1000164802 384
256 3300005843 Ga0068860_100018904 Ga0068860_1000189042 384
257 3300005843 Ga0068860_100106473 Ga0068860_1001064731 384
258 3300005843 Ga0068860_100171902 Ga0068860_1001719022 384
259 3300005843 Ga0068860_100356161 Ga0068860_1003561611 384
260 3300006195 Ga0075366_10004482 Ga0075366_100044823 384
261 3300006195 Ga0075366_10008429 Ga0075366_100084297 384
262 3300006195 Ga0075366_10012850 Ga0075366_100128502 384
263 3300006195 Ga0075366_10022601 Ga0075366_100226016 384
264 3300006237 Ga0097621_100011146 Ga0097621_1000111462 384
265 3300006358 Ga0068871_100004895 Ga0068871_1000048952 384
266 3300006358 Ga0068871_100004895 Ga0068871_1000048955 384
267 3300006358 Ga0068871_100005555 Ga0068871_1000055555 384
268 3300006881 Ga0068865_100001792 Ga0068865_1000017922 384
269 3300006881 Ga0068865_100001792 Ga0068865_1000017925 384
270 3300006931 Ga0097620_100000035 Ga0097620_100000035132 384
271 3300006931 Ga0097620_100013939 Ga0097620_1000139392 384
272 3300006931 Ga0097620_100202053 Ga0097620_1002020531 384
273 3300006931 Ga0097620_100233182 Ga0097620_1002331821 384
274 3300009093 Ga0105240_10000448 Ga0105240_1000044857 384
275 3300009093 Ga0105240_10000753 Ga0105240_1000075325 384
276 3300009093 Ga0105240_10004884 Ga0105240_1000488415 384
277 3300009093 Ga0105240_10004884 Ga0105240_100048847 384
278 3300009093 Ga0105240_10010133 Ga0105240_100101334 384
279 3300009093 Ga0105240_10010616 Ga0105240_100106164 384
280 3300009093 Ga0105240_10016430 Ga0105240_100164307 384
281 3300009093 Ga0105240_10098200 Ga0105240_100982003 384
282 3300009101 Ga0105247_10007945 Ga0105247_100079458 384
283 3300009147 Ga0114129_10169682 Ga0114129_101696823 384
284 3300009174 Ga0105241_10020566 Ga0105241_100205666 384
285 3300009174 Ga0105241_10083028 Ga0105241_100830282 384
286 3300009174 Ga0105241_10084023 Ga0105241_100840232 384
287 3300009174 Ga0105241_10281154 Ga0105241_102811541 384
288 3300009176 Ga0105242_10209494 Ga0105242_102094942 384
289 3300009545 Ga0105237_10000365 Ga0105237_1000036546 384
290 3300009545 Ga0105237_10004916 Ga0105237_100049168 384
291 3300009545 Ga0105237_10007488 Ga0105237_100074885 384
292 3300009545 Ga0105237_10007794 Ga0105237_100077943 384
293 3300009545 Ga0105237_10099080 Ga0105237_100990803 384
294 3300009545 Ga0105237_10113345 Ga0105237_101133452 384
295 3300009551 Ga0105238_10001640 Ga0105238_100016402 384
296 3300009551 Ga0105238_10005225 Ga0105238_100052256 384
297 3300009551 Ga0105238_10141371 Ga0105238_101413712 384
298 3300009553 Ga0105249_10202290 Ga0105249_102022902 384
299 3300010375 Ga0105239_10003647 Ga0105239_1000364714 384
300 3300010375 Ga0105239_10005346 Ga0105239_100053466 384
301 3300010375 Ga0105239_10013585 Ga0105239_100135853 384
302 3300010375 Ga0105239_10027184 Ga0105239_100271843 384
303 3300010375 Ga0105239_10205819 Ga0105239_102058192 384
304 3300010375 Ga0105239_10333926 Ga0105239_103339262 384
305 3300011119 Ga0105246_10122298 Ga0105246_101222983 384
306 3300013100 Ga0157373_10008393 Ga0157373_100083933 384
307 3300013102 Ga0157371_10133651 Ga0157371_101336512 384
308 3300013104 Ga0157370_10010368 Ga0157370_100103687 384
309 3300013105 Ga0157369_10126619 Ga0157369_101266193 384
310 3300013296 Ga0157374_10028237 Ga0157374_100282372 384
311 3300013297 Ga0157378_10043098 Ga0157378_100430983 384
312 3300013297 Ga0157378_10077180 Ga0157378_100771802 384
313 3300013297 Ga0157378_10103052 Ga0157378_101030522 384
314 3300013297 Ga0157378_10263092 Ga0157378_102630922 384
315 3300013306 Ga0163162_10002129 Ga0163162_1000212913 384
316 3300013306 Ga0163162_10016723 Ga0163162_100167232 384
317 3300013307 Ga0157372_10001592 Ga0157372_1000159225 384
318 3300013307 Ga0157372_10008341 Ga0157372_100083419 384
319 3300013307 Ga0157372_10038493 Ga0157372_100384933 384
320 3300013307 Ga0157372_10062509 Ga0157372_100625094 384
321 3300013307 Ga0157372_10096118 Ga0157372_100961184 384
322 3300013307 Ga0157372_10211516 Ga0157372_102115161 384
323 3300013307 Ga0157372_10278439 Ga0157372_102784391 384
324 3300014326 Ga0157380_10101747 Ga0157380_101017472 384
325 3300014968 Ga0157379_10003395 Ga0157379_1000339519 384
326 3300014968 Ga0157379_10104858 Ga0157379_101048582 384
327 3300014969 Ga0157376_10009474 Ga0157376_100094744 384
328 3300025246 Ga0209646_1000006 Ga0209646_1000006183 384
329 3300025250 Ga0209026_1000977 Ga0209026_10009774 384
330 3300025297 Ga0209758_1001052 Ga0209758_100105230 384
331 3300025302 Ga0207426_1000060 Ga0207426_100006044 384
332 3300025321 Ga0207656_10030815 Ga0207656_100308152 384
333 3300025900 Ga0207710_10026026 Ga0207710_100260262 384
334 3300025901 Ga0207688_10012535 Ga0207688_100125353 384
335 3300025901 Ga0207688_10021388 Ga0207688_100213882 384
336 3300025903 Ga0207680_10000129 Ga0207680_1000012923 384
337 3300025903 Ga0207680_10051127 Ga0207680_100511271 384
338 3300025907 Ga0207645_10000334 Ga0207645_1000033432 384
339 3300025907 Ga0207645_10000334 Ga0207645_1000033435 384
340 3300025908 Ga0207643_10047449 Ga0207643_100474492 384
341 3300025911 Ga0207654_10014995 Ga0207654_100149952 384
342 3300025911 Ga0207654_10018049 Ga0207654_100180492 384
343 3300025912 Ga0207707_10071875 Ga0207707_100718753 384
344 3300025913 Ga0207695_10000073 Ga0207695_10000073150 384
345 3300025913 Ga0207695_10000982 Ga0207695_1000098216 384
346 3300025913 Ga0207695_10002106 Ga0207695_1000210611 384
347 3300025913 Ga0207695_10007057 Ga0207695_100070572 384
348 3300025913 Ga0207695_10016206 Ga0207695_100162062 384
349 3300025913 Ga0207695_10052397 Ga0207695_100523974 384
350 3300025914 Ga0207671_10000871 Ga0207671_1000087110 384
351 3300025914 Ga0207671_10002130 Ga0207671_100021301 384
352 3300025914 Ga0207671_10002759 Ga0207671_100027596 384
353 3300025914 Ga0207671_10003607 Ga0207671_100036078 384
354 3300025914 Ga0207671_10003756 Ga0207671_1000375612 384
355 3300025914 Ga0207671_10005501 Ga0207671_100055013 384
356 3300025914 Ga0207671_10008024 Ga0207671_100080249 384
357 3300025914 Ga0207671_10022311 Ga0207671_100223114 384
358 3300025919 Ga0207657_10032220 Ga0207657_100322203 384
359 3300025921 Ga0207652_10011535 Ga0207652_100115354 384
360 3300025923 Ga0207681_10209572 Ga0207681_102095721 384
361 3300025924 Ga0207694_10008740 Ga0207694_100087405 384
362 3300025924 Ga0207694_10029477 Ga0207694_100294772 384
363 3300025925 Ga0207650_10119207 Ga0207650_101192072 384
364 3300025925 Ga0207650_10131413 Ga0207650_101314132 384
365 3300025926 Ga0207659_10172679 Ga0207659_101726792 384
366 3300025934 Ga0207686_10148307 Ga0207686_101483071 384
367 3300025940 Ga0207691_10008098 Ga0207691_100080982 384
368 3300025940 Ga0207691_10008098 Ga0207691_100080985 384
369 3300025942 Ga0207689_10013627 Ga0207689_100136273 384
370 3300025942 Ga0207689_10046567 Ga0207689_100465673 384
371 3300025942 Ga0207689_10049482 Ga0207689_100494822 384
372 3300025942 Ga0207689_10089999 Ga0207689_100899992 384
373 3300025942 Ga0207689_10090348 Ga0207689_100903481 384
374 3300025942 Ga0207689_10305601 Ga0207689_103056011 384
375 3300025949 Ga0207667_10002679 Ga0207667_100026792 384
376 3300025949 Ga0207667_10003291 Ga0207667_100032913 384
377 3300025949 Ga0207667_10010867 Ga0207667_100108676 384
378 3300025949 Ga0207667_10031118 Ga0207667_100311183 384
379 3300025949 Ga0207667_10184037 Ga0207667_101840372 384
380 3300025949 Ga0207667_10283863 Ga0207667_102838631 384
381 3300025960 Ga0207651_10110240 Ga0207651_101102402 384
382 3300025961 Ga0207712_10034122 Ga0207712_100341222 384
383 3300025961 Ga0207712_10081059 Ga0207712_100810592 384
384 3300025972 Ga0207668_10041617 Ga0207668_100416173 384
385 3300025972 Ga0207668_10059287 Ga0207668_100592872 384
386 3300025972 Ga0207668_10088463 Ga0207668_100884632 384
387 3300025981 Ga0207640_10013691 Ga0207640_100136912 384
388 3300025981 Ga0207640_10089032 Ga0207640_100890322 384
389 3300025981 Ga0207640_10147080 Ga0207640_101470801 384
390 3300025986 Ga0207658_10021116 Ga0207658_100211162 384
391 3300025986 Ga0207658_10155948 Ga0207658_101559482 384
392 3300026023 Ga0207677_10002161 Ga0207677_100021616 384
393 3300026035 Ga0207703_10011853 Ga0207703_100118532 384
394 3300026041 Ga0207639_10002155 Ga0207639_100021559 384
395 3300026041 Ga0207639_10123853 Ga0207639_101238532 384
396 3300026078 Ga0207702_10059042 Ga0207702_100590423 384
397 3300026078 Ga0207702_10122879 Ga0207702_101228792 384
398 3300026088 Ga0207641_10000043 Ga0207641_10000043111 384
399 3300026088 Ga0207641_10040430 Ga0207641_100404302 384
400 3300026089 Ga0207648_10004255 Ga0207648_100042552 384
401 3300026089 Ga0207648_10004255 Ga0207648_100042555 384
402 3300026089 Ga0207648_10104640 Ga0207648_101046402 384
403 3300026089 Ga0207648_10174164 Ga0207648_101741642 384
404 3300026095 Ga0207676_10002326 Ga0207676_100023267 384
405 3300026095 Ga0207676_10082685 Ga0207676_100826853 384
406 3300026116 Ga0207674_10051589 Ga0207674_100515892 384
407 3300026116 Ga0207674_10083541 Ga0207674_100835412 384
408 3300026116 Ga0207674_10193176 Ga0207674_101931762 384
409 3300026118 Ga0207675_100006400 Ga0207675_1000064003 384
410 3300026118 Ga0207675_100046235 Ga0207675_1000462352 384
411 3300026121 Ga0207683_10008433 Ga0207683_100084333 384
412 3300026121 Ga0207683_10102531 Ga0207683_101025312 384
413 3300026121 Ga0207683_10148825 Ga0207683_101488252 384
414 3300026142 Ga0207698_10001608 Ga0207698_100016087 384
415 3300026142 Ga0207698_10005349 Ga0207698_100053492 384
416 3300026142 Ga0207698_10261278 Ga0207698_102612781 384
417 3300026142 Ga0207698_10336491 Ga0207698_103364911 384
418 3300028379 Ga0268266_10000010 Ga0268266_10000010634 384
419 3300028379 Ga0268266_10052455 Ga0268266_100524552 384
420 3300028380 Ga0268265_10072673 Ga0268265_100726731 384
421 3300028381 Ga0268264_10000052 Ga0268264_10000052150 384
422 3300028381 Ga0268264_10000052 Ga0268264_10000052158 384
423 3300028381 Ga0268264_10001431 Ga0268264_1000143117 384
424 3300028381 Ga0268264_10006997 Ga0268264_100069976 384
425 3300028381 Ga0268264_10011910 Ga0268264_100119103 384
426 3300028381 Ga0268264_10018523 Ga0268264_100185233 384
427 3300028381 Ga0268264_10028999 Ga0268264_100289992 384
428 3300028381 Ga0268264_10045505 Ga0268264_100455052 384
429 3300028381 Ga0268264_10160701 Ga0268264_101607012 384
430 3300028786 Ga0307517_10042625 Ga0307517_100426252 384
431 3300028794 Ga0307515_10000036 Ga0307515_1000003643 384
432 3300031456 Ga0307513_10039035 Ga0307513_100390355 384
433 3300033180 Ga0307510_10000528 Ga0307510_1000052814 384
434 3300037418 Ga0395900_0275904 Ga0395900_0275904_413_1615 384
435 3300039437 Ga0436365_0054602 Ga0436365_0054602_6761_7981 384
436 3300041404 Ga0439436_0003540 Ga0439436_0003540_72_1286 384
437 3300041406 Ga0439439_0002830 Ga0439439_0002830_2454_3668 384
438 3300041406 Ga0439439_0012892 Ga0439439_0012892_83_1309 384
439 3300042007 Ga0439449_0020085 Ga0439449_0020085_1262_2476 384
440 3300042014 Ga0439457_000072 Ga0439457_000072_20177_21391 384
441 3300042134 Ga0450898_007892 Ga0450898_007892_205_1434 384
442 3300042435 Ga0439434_0032329 Ga0439434_0032329_315_1541 384
443 3300044656 Ga0466969_0001643 Ga0466969_0001643_7316_8542 384
444 3300044658 Ga0466972_0000204 Ga0466972_0000204_3002_4216 384
445 3300044658 Ga0466972_0002307 Ga0466972_0002307_817_2034 384
446 3300044684 Ga0466966_0000022 Ga0466966_0000022_80738_81964 384
447 3300044684 Ga0466966_0125792 Ga0466966_0125792_281_1507 384
448 3300044706 Ga0466964_0077301 Ga0466964_0077301_64_1290 384
449 3300044735 Ga0466968_0049466 Ga0466968_0049466_14_1231 384
450 3300044842 Ga0466957_0011545 Ga0466957_0011545_2460_3668 384
451 3300046522 Ga0495643_0019753 Ga0495643_0019753_518_1759 384
452 3300046524 Ga0495648_0002229 Ga0495648_0002229_11566_12786 384
453 3300046524 Ga0495648_0003458 Ga0495648_0003458_12180_13403 384
454 3300046648 Ga0495611_0000596 Ga0495611_0000596_2591_3805 384
455 3300047443 Ga0495687_000039 Ga0495687_000039_194133_195350 384
456 3300047443 Ga0495687_000039 Ga0495687_000039_202758_203975 384
457 3300047472 Ga0495686_0004797 Ga0495686_0004797_7685_8914 384
458 3300047472 Ga0495686_0030074 Ga0495686_0030074_2020_3246 384
459 3300049579 Ga0501043_0030186 Ga0501043_0030186_1664_2887 384
460 3300049581 Ga0501047_0006975 Ga0501047_0006975_7243_8451 384
461 3300049581 Ga0501047_0236071 Ga0501047_0236071_255_1463 384
462 3300049703 Ga0501219_000251 Ga0501219_000251_6686_7897 384
463 3300049823 Ga0501044_0023064 Ga0501044_0023064_2671_3882 384
464 3300049823 Ga0501044_0031379 Ga0501044_0031379_951_2159 384
465 3300050005 Ga0501284_00025 Ga0501284_00025_39229_40440 384
466 3300050493 nmdc:mga0k408_49317_c1 nmdc:mga0k408_49317_c1_889_2100 384
467 3300050507 nmdc:mga05p37_134031_c1 nmdc:mga05p37_134031_c1_942_2159 384
468 3300053086 Ga0500578_0000010 Ga0500578_0000010_43573_44793 384
469 3300053090 Ga0500646_0003944 Ga0500646_0003944_1319_2518 384
470 3300053092 Ga0500583_0000039 Ga0500583_0000039_64986_66197 384
471 3300053092 Ga0500583_0005528 Ga0500583_0005528_404_1603 384
472 3300053092 Ga0500583_0046956 Ga0500583_0046956_528_1751 384
473 3300053093 Ga0500651_0033204 Ga0500651_0033204_1464_2663 384
474 3300053108 Ga0500562_000030 Ga0500562_000030_73168_74397 384
475 3300053109 Ga0500569_001173 Ga0500569_001173_2135_3334 384
476 3300053130 Ga0500642_0012016 Ga0500642_0012016_1115_2338 384
477 3300053134 Ga0500658_0021324 Ga0500658_0021324_892_2091 384
478 3300053139 Ga0500568_0012237 Ga0500568_0012237_600_1823 384
479 3300053142 Ga0500577_0001531 Ga0500577_0001531_1590_2789 384
480 3300053153 Ga0500616_0029821 Ga0500616_0029821_1225_2424 384
481 3300053156 Ga0500622_0000560 Ga0500622_0000560_17227_18456 384
482 3300053156 Ga0500622_0006033 Ga0500622_0006033_1095_2315 384
483 3300053727 Ga0500611_003079 Ga0500611_003079_694_1911 384
484 3300003323 rootH1_10110584 rootH1_101105843 385
485 3300005327 Ga0070658_10011704 Ga0070658_100117043 385
486 3300005327 Ga0070658_10014599 Ga0070658_100145994 385
487 3300005327 Ga0070658_10069777 Ga0070658_100697772 385
488 3300005329 Ga0070683_100005913 Ga0070683_1000059133 385
489 3300005331 Ga0070670_100018249 Ga0070670_1000182492 385
490 3300005458 Ga0070681_10180222 Ga0070681_101802222 385
491 3300005530 Ga0070679_100004674 Ga0070679_1000046745 385
492 3300005563 Ga0068855_100012719 Ga0068855_1000127193 385
493 3300005563 Ga0068855_100238736 Ga0068855_1002387362 385
494 3300005577 Ga0068857_100007022 Ga0068857_1000070226 385
495 3300005614 Ga0068856_100036592 Ga0068856_1000365923 385
496 3300005614 Ga0068856_100201221 Ga0068856_1002012212 385
497 3300005614 Ga0068856_100299254 Ga0068856_1002992542 385
498 3300005616 Ga0068852_100004276 Ga0068852_1000042764 385
499 3300005616 Ga0068852_100008018 Ga0068852_1000080182 385
500 3300005616 Ga0068852_100057285 Ga0068852_1000572852 385
501 3300005983 Ga0081540_1043370 Ga0081540_10433702 385
502 3300006163 Ga0070715_10041701 Ga0070715_100417012 385
503 3300006844 Ga0075428_100001629 Ga0075428_1000016298 385
504 3300006844 Ga0075428_100019405 Ga0075428_1000194052 385
505 3300006846 Ga0075430_100060418 Ga0075430_1000604182 385
506 3300006847 Ga0075431_100025885 Ga0075431_1000258852 385
507 3300006880 Ga0075429_100001720 Ga0075429_10000172011 385
508 3300009093 Ga0105240_10044347 Ga0105240_100443472 385
509 3300009545 Ga0105237_10006397 Ga0105237_100063979 385
510 3300009545 Ga0105237_10119704 Ga0105237_101197042 385
511 3300009545 Ga0105237_10212689 Ga0105237_102126891 385
512 3300009551 Ga0105238_10046674 Ga0105238_100466744 385
513 3300010375 Ga0105239_10000692 Ga0105239_1000069235 385
514 3300010375 Ga0105239_10391382 Ga0105239_103913821 385
515 3300013100 Ga0157373_10023617 Ga0157373_100236172 385
516 3300013100 Ga0157373_10167699 Ga0157373_101676991 385
517 3300013102 Ga0157371_10011760 Ga0157371_100117605 385
518 3300013102 Ga0157371_10046006 Ga0157371_100460062 385
519 3300013102 Ga0157371_10130566 Ga0157371_101305661 385
520 3300013104 Ga0157370_10245528 Ga0157370_102455281 385
521 3300013105 Ga0157369_10036144 Ga0157369_100361442 385
522 3300013105 Ga0157369_10059346 Ga0157369_100593462 385
523 3300013306 Ga0163162_10043401 Ga0163162_100434012 385
524 3300013307 Ga0157372_10004536 Ga0157372_100045362 385
525 3300013307 Ga0157372_10026066 Ga0157372_100260662 385
526 3300013307 Ga0157372_10287716 Ga0157372_102877162 385
527 3300014968 Ga0157379_10147276 Ga0157379_101472762 385
528 3300014969 Ga0157376_10265424 Ga0157376_102654241 385
529 3300025904 Ga0207647_10003702 Ga0207647_100037023 385
530 3300025909 Ga0207705_10057737 Ga0207705_100577372 385
531 3300025911 Ga0207654_10004073 Ga0207654_100040731 385
532 3300025912 Ga0207707_10164757 Ga0207707_101647571 385
533 3300025913 Ga0207695_10000073 Ga0207695_10000073143 385
534 3300025913 Ga0207695_10000982 Ga0207695_1000098223 385
535 3300025913 Ga0207695_10041974 Ga0207695_100419742 385
536 3300025914 Ga0207671_10002130 Ga0207671_100021308 385
537 3300025914 Ga0207671_10016755 Ga0207671_100167553 385
538 3300025914 Ga0207671_10046001 Ga0207671_100460012 385
539 3300025914 Ga0207671_10139034 Ga0207671_101390341 385
540 3300025921 Ga0207652_10004899 Ga0207652_100048997 385
541 3300025924 Ga0207694_10006181 Ga0207694_100061814 385
542 3300025949 Ga0207667_10004126 Ga0207667_100041266 385
543 3300026078 Ga0207702_10145392 Ga0207702_101453922 385
544 3300026116 Ga0207674_10004688 Ga0207674_1000468810 385
545 3300026142 Ga0207698_10004994 Ga0207698_100049944 385
546 3300026142 Ga0207698_10009464 Ga0207698_100094643 385
547 3300026142 Ga0207698_10033699 Ga0207698_100336992 385
548 3300026142 Ga0207698_10045007 Ga0207698_100450072 385
549 3300031456 Ga0307513_10043154 Ga0307513_100431542 385
550 3300037471 Ga0395905_0091084 Ga0395905_0091084_850_2070 385
551 3300041512 Ga0451853_2434045 Ga0451853_2434045_2018_3241 385
552 3300042014 Ga0439457_001608 Ga0439457_001608_5484_6707 385
553 3300042015 Ga0439462_0003290 Ga0439462_0003290_2097_3320 385
554 3300044658 Ga0466972_0000026 Ga0466972_0000026_93444_94664 385
555 3300044765 Ga0466970_0000579 Ga0466970_0000579_9214_10434 385
556 3300044842 Ga0466957_0000853 Ga0466957_0000853_6049_7266 385
557 3300049574 Ga0501038_0125316 Ga0501038_0125316_441_1676 385
558 3300049579 Ga0501043_0095523 Ga0501043_0095523_677_1915 385
559 3300049579 Ga0501043_0188879 Ga0501043_0188879_312_1532 385
560 3300049581 Ga0501047_0019647 Ga0501047_0019647_2147_3364 385
561 3300049705 Ga0501225_0000596 Ga0501225_0000596_2388_3611 385
562 3300049822 Ga0501035_0094139 Ga0501035_0094139_1262_2500 385
563 3300049823 Ga0501044_0006895 Ga0501044_0006895_4040_5257 385
564 3300049823 Ga0501044_0098007 Ga0501044_0098007_873_2087 385
565 3300050508 nmdc:mga09592_7174_c1 nmdc:mga09592_7174_c1_7002_8213 385
566 3300050509 nmdc:mga0qj67_74094_c1 nmdc:mga0qj67_74094_c1_994_2205 385
567 3300053090 Ga0500646_0003820 Ga0500646_0003820_1194_2417 385
568 3300053092 Ga0500583_0000013 Ga0500583_0000013_54447_55670 385
569 3300053139 Ga0500568_0006850 Ga0500568_0006850_950_2170 385
570 3300053147 Ga0500589_037799 Ga0500589_037799_667_1890 385
571 3300053156 Ga0500622_0007982 Ga0500622_0007982_810_2033 385
572 3300053177 Ga0500636_0045201 Ga0500636_0045201_473_1696 385
573 3300003323 rootH1_10218367 rootH1_102183672 386
574 3300005577 Ga0068857_100155175 Ga0068857_1001551752 386
575 3300013104 Ga0157370_10226331 Ga0157370_102263311 386
576 3300013105 Ga0157369_10075193 Ga0157369_100751932 386
577 3300013307 Ga0157372_10083499 Ga0157372_100834992 386
578 3300013307 Ga0157372_10235437 Ga0157372_102354372 386
579 3300025917 Ga0207660_10032766 Ga0207660_100327662 386
580 3300025919 Ga0207657_10232744 Ga0207657_102327441 386
581 3300003203 JGI25406J46586_10003895 JGI25406J46586_100038952 387
582 3300005290 Ga0065712_10082630 Ga0065712_100826301 387
583 3300005328 Ga0070676_10004267 Ga0070676_100042672 387
584 3300005331 Ga0070670_100076176 Ga0070670_1000761762 387
585 3300005338 Ga0068868_100007566 Ga0068868_1000075662 387
586 3300005338 Ga0068868_100061966 Ga0068868_1000619662 387
587 3300005354 Ga0070675_100010879 Ga0070675_1000108792 387
588 3300005354 Ga0070675_100076695 Ga0070675_1000766951 387
589 3300005367 Ga0070667_100022113 Ga0070667_1000221132 387
590 3300005456 Ga0070678_100006683 Ga0070678_1000066832 387
591 3300005578 Ga0068854_100157191 Ga0068854_1001571911 387
592 3300005617 Ga0068859_100049224 Ga0068859_1000492241 387
593 3300005719 Ga0068861_100040060 Ga0068861_1000400602 387
594 3300005840 Ga0068870_10007790 Ga0068870_100077902 387
595 3300005841 Ga0068863_100060938 Ga0068863_1000609382 387
596 3300005985 Ga0081539_10000147 Ga0081539_10000147112 387
597 3300006931 Ga0097620_100049223 Ga0097620_1000492231 387
598 3300025908 Ga0207643_10011359 Ga0207643_100113592 387
599 3300026088 Ga0207641_10065308 Ga0207641_100653081 387
600 3300026118 Ga0207675_100044646 Ga0207675_1000446462 387
601 3300026142 Ga0207698_10042832 Ga0207698_100428322 387
602 3300028381 Ga0268264_10115250 Ga0268264_101152502 387
603 3300044842 Ga0466957_0000411 Ga0466957_0000411_13445_14797 387
604 2162886011 MRS1b_contig_1820062 MRS1b_0028.00000540 389
605 3300005330 Ga0070690_100123260 Ga0070690_1001232601 389
606 3300005347 Ga0070668_100032942 Ga0070668_1000329422 389
607 3300005353 Ga0070669_100002247 Ga0070669_1000022474 389
608 3300005354 Ga0070675_100001165 Ga0070675_10000116512 389
609 3300005365 Ga0070688_100002600 Ga0070688_1000026004 389
610 3300005441 Ga0070700_100023179 Ga0070700_1000231795 389
611 3300005459 Ga0068867_100026794 Ga0068867_1000267941 389
612 3300005471 Ga0070698_100001150 Ga0070698_10000115022 389
613 3300005549 Ga0070704_100163559 Ga0070704_1001635591 389
614 3300005617 Ga0068859_100008557 Ga0068859_1000085574 389
615 3300005719 Ga0068861_100001036 Ga0068861_1000010369 389
616 3300005844 Ga0068862_100002110 Ga0068862_10000211012 389
617 3300006844 Ga0075428_100100285 Ga0075428_1001002851 389
618 3300006931 Ga0097620_100008558 Ga0097620_1000085584 389
619 3300009094 Ga0111539_10001072 Ga0111539_1000107220 389
620 3300009176 Ga0105242_10206361 Ga0105242_102063612 389
621 3300014326 Ga0157380_10046053 Ga0157380_100460532 389
622 3300014745 Ga0157377_10000790 Ga0157377_100007902 389
623 3300025315 Ga0207697_10004402 Ga0207697_100044025 389
624 3300025923 Ga0207681_10002639 Ga0207681_100026396 389
625 3300025942 Ga0207689_10030279 Ga0207689_100302791 389
626 3300025961 Ga0207712_10083439 Ga0207712_100834391 389
627 3300026089 Ga0207648_10004687 Ga0207648_1000468710 389
628 3300026118 Ga0207675_100002316 Ga0207675_10000231613 389
629 3300028380 Ga0268265_10003389 Ga0268265_100033899 389
630 3300050511 nmdc:mga08y16_13513_c1 nmdc:mga08y16_13513_c1_5819_7051 389
631 iso_pu_bacteria 2738541284 2738764176 392
632 iso_pu_bacteria 2775506987 2776611996 392
633 3300003320 rootH2_10306631 rootH2_103066311 395
634 3300003322 rootL2_10072276 rootL2_100722766 395
635 3300003323 rootH1_10120525 rootH1_101205252 395
636 3300046507 Ga0495606_0010511 Ga0495606_0010511_4620_5807 395
637 3300047472 Ga0495686_0098184 Ga0495686_0098184_62_1249 395
638 2162886007 SwRhRL2b_contig_1898023 SwRhRL2b_0532.00000740 396
639 2162886007 SwRhRL2b_contig_1905487 SwRhRL2b_0652.00004810 396
640 3300013100 Ga0157373_10004217 Ga0157373_100042171 396
641 3300013102 Ga0157371_10004130 Ga0157371_100041307 396
642 3300013102 Ga0157371_10004666 Ga0157371_100046666 396
643 3300013104 Ga0157370_10012952 Ga0157370_100129524 396
644 3300013104 Ga0157370_10025866 Ga0157370_100258663 396
645 3300014497 Ga0182008_10000014 Ga0182008_10000014141 396
646 3300032004 Ga0307414_10000564 Ga0307414_100005643 396
647 3300053093 Ga0500651_0004425 Ga0500651_0004425_2751_3941 396
648 3300053139 Ga0500568_0035283 Ga0500568_0035283_589_1779 396

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00480

ROK

ROK family

123

432

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bdd-assembly2.cif.gz_D crystal structure of a putative multiple antibiotic-resistance repressor (ssu05_1136) from streptococcus suis 89/1591 at 2.20 a resolution 0.9365 11 55
2qww-assembly4.cif.gz_G crystal structure of multiple antibiotic-resistance repressor (marr) (yp_013417.1) from listeria monocytogenes 4b f2365 at 2.07 a resolution 0.9321 10 74
2qww-assembly3.cif.gz_F crystal structure of multiple antibiotic-resistance repressor (marr) (yp_013417.1) from listeria monocytogenes 4b f2365 at 2.07 a resolution 0.9316 10 74
6wxq-assembly1.cif.gz_A crystal structure of crispr-associated transcription factor csa3 complexed with ca4 0.9302 13 75
5zup-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.9272 26 58
ID Description Score Start End Superfamily
3nrvB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9615 11 55 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9439 12 75 1.10.10.10
af_P37309_5_97_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9386 11 75 1.10.10.10
3bddD00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9365 11 55 1.10.10.10
4ijaA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9278 12 74 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3C0S5S6-F1-model_v4 ROK family protein 0.9396 12 255 GO:0003824
GO:0005737
AF-A0A3C0S5S6-F1-model_v4 ROK family protein 0.9321 12 255 GO:0003824
GO:0005737
AF-A0A519Y332-F1-model_v4 ROK family protein 0.9286 1 339 GO:0003824
GO:0005737
AF-A0A519Y332-F1-model_v4 ROK family protein 0.926 1 339 GO:0003824
GO:0005737
AF-A0A845KGN1-F1-model_v4 deleted 0.9099 186 388

Feature Viewer

pLDDT pTM Quality
91.62 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map