F472378

General Info

Members Datasets Scaffolds Average Seq Length
648 291 1296 115

Family's Representative Sequence

Representative Sequence 3300026088|Ga0207641_10264388|Ga0207641_102643882
Length 142
Sequence MAGDHLTAASAAGVRAPLDMPVECVAGFTAMASERVELLQGTLDLIVLRALSTMGPQHAYGLAARLEQVADDPFPLNQWTLYAALTRLEQKGWIKGTWQRTESNREAKYYAITRSGLRALDEQVERWRKLSGLVNKLIVGPS

Samples

Sample ID Description Type Environment
1 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
179 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
180 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
183 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
197 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
209 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
210 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
213 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
214 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
215 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
216 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
260 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
261 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
262 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
263 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
264 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
265 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
270 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
271 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
274 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
275 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
276 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
277 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
278 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
281 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
282 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
287 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
288 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.09
Nodule 0
Rhizoplane 1.7
Rhizosphere 94.29
Stem 0
Stem Tuber 0
Unclassified 30.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207641_10264388 3300026088 Bacteria 1612
2 JGI24749J21850_1019264 3300002076 Bacteria 964
3 Ga0065712_10004149 3300005290 Bacteria 3360
4 Ga0065712_10280535 3300005290 Bacteria 897
5 Ga0065715_10093002 3300005293 Bacteria 4802
6 Ga0065715_10328485 3300005293 Bacteria 988
7 Ga0065707_10317579 3300005295 Unclassified 972
8 Ga0065707_10675759 3300005295 Bacteria 634
9 Ga0065707_10772296 3300005295 Bacteria 610
10 Ga0070676_10530096 3300005328 Bacteria 840
11 Ga0070690_101121305 3300005330 Bacteria 625
12 Ga0070670_100110622 3300005331 Bacteria 2367
13 Ga0070670_100220991 3300005331 Bacteria 1648
14 Ga0070670_100711257 3300005331 Bacteria 904
15 Ga0070677_10084680 3300005333 Unclassified 1365
16 Ga0070677_10248187 3300005333 Bacteria 882
17 Ga0068869_100087909 3300005334 Bacteria 2332
18 Ga0068869_100265286 3300005334 Bacteria 1376
19 Ga0068869_100299310 3300005334 Unclassified 1298
20 Ga0068869_100331698 3300005334 Bacteria 1236
21 Ga0068869_100385596 3300005334 Unclassified 1149
22 Ga0068869_102030272 3300005334 Bacteria 516
23 Ga0070666_10039814 3300005335 Bacteria 3135
24 Ga0070666_10231448 3300005335 Unclassified 1305
25 Ga0070680_100927219 3300005336 Bacteria 752
26 Ga0070682_100414344 3300005337 Bacteria 1022
27 Ga0068868_100569639 3300005338 Unclassified 1000
28 Ga0070660_100108390 3300005339 Bacteria 2207
29 Ga0070689_100073507 3300005340 Bacteria 2674
30 Ga0070689_100095837 3300005340 Bacteria 2344
31 Ga0070689_100392832 3300005340 Bacteria 1171
32 Ga0070689_101499612 3300005340 Unclassified 611
33 Ga0070687_100434969 3300005343 Unclassified 869
34 Ga0070687_100575792 3300005343 Bacteria 770
35 Ga0070661_100614147 3300005344 Bacteria 880
36 Ga0070668_101401750 3300005347 Unclassified 637
37 Ga0070669_100004233 3300005353 Bacteria 10381
38 Ga0070669_100017281 3300005353 Bacteria 5146
39 Ga0070669_100028961 3300005353 Bacteria 3991
40 Ga0070669_100802178 3300005353 Unclassified 800
41 Ga0070675_100041546 3300005354 Bacteria 3756
42 Ga0070671_100089343 3300005355 Bacteria 2579
43 Ga0070671_101974711 3300005355 Unclassified 519
44 Ga0070674_100691001 3300005356 Unclassified 871
45 Ga0070674_101691915 3300005356 Unclassified 572
46 Ga0070673_100033921 3300005364 Bacteria 3857
47 Ga0070673_100182726 3300005364 Bacteria 1796
48 Ga0070673_100520826 3300005364 Unclassified 1077
49 Ga0070688_100445725 3300005365 Bacteria 967
50 Ga0070688_100502345 3300005365 Unclassified 915
51 Ga0070688_100663786 3300005365 Bacteria 804
52 Ga0070688_101151119 3300005365 Unclassified 622
53 Ga0070659_100125706 3300005366 Bacteria 2080
54 Ga0070667_100070240 3300005367 Unclassified 2981
55 Ga0070709_10778717 3300005434 Bacteria 749
56 Ga0070714_100034109 3300005435 Bacteria 4260
57 Ga0070713_100120666 3300005436 Bacteria 2299
58 Ga0070710_10460967 3300005437 Bacteria 863
59 Ga0070705_100895111 3300005440 Unclassified 713
60 Ga0070700_100103642 3300005441 Bacteria 1879
61 Ga0070700_100158925 3300005441 Bacteria 1554
62 Ga0070700_100267197 3300005441 Bacteria 1234
63 Ga0070700_100273127 3300005441 Bacteria 1222
64 Ga0070700_101045108 3300005441 Bacteria 674
65 Ga0070694_100936388 3300005444 Bacteria 717
66 Ga0070708_100700665 3300005445 Bacteria 953
67 Ga0070663_100523131 3300005455 Bacteria 988
68 Ga0070663_101002360 3300005455 Bacteria 726
69 Ga0070678_100619354 3300005456 Bacteria 968
70 Ga0070678_101057387 3300005456 Unclassified 748
71 Ga0070678_101436554 3300005456 Unclassified 645
72 Ga0070662_100376421 3300005457 Unclassified 1168
73 Ga0070681_10997691 3300005458 Unclassified 757
74 Ga0070681_11647458 3300005458 Bacteria 567
75 Ga0068867_100297387 3300005459 Unclassified 1330
76 Ga0068867_100837199 3300005459 Bacteria 823
77 Ga0068867_101813265 3300005459 Unclassified 574
78 Ga0070706_100344594 3300005467 Bacteria 1389
79 Ga0070706_101990969 3300005467 Bacteria 526
80 Ga0070707_101499621 3300005468 Unclassified 641
81 Ga0070698_102080627 3300005471 Bacteria 521
82 Ga0070679_100363881 3300005530 Bacteria 1394
83 Ga0070684_100126589 3300005535 Bacteria 2302
84 Ga0070684_100360696 3300005535 Unclassified 1337
85 Ga0070684_100537252 3300005535 Bacteria 1084
86 Ga0070697_100316258 3300005536 Bacteria 1344
87 Ga0068853_100009965 3300005539 Bacteria 7674
88 Ga0068853_100329333 3300005539 Unclassified 1417
89 Ga0070672_100125342 3300005543 Bacteria 2106
90 Ga0070672_100150627 3300005543 Bacteria 1924
91 Ga0070672_100270953 3300005543 Bacteria 1433
92 Ga0070672_100660831 3300005543 Unclassified 913
93 Ga0070672_101180432 3300005543 Bacteria 682
94 Ga0070686_101104285 3300005544 Unclassified 655
95 Ga0070695_100511253 3300005545 Bacteria 930
96 Ga0070696_101089980 3300005546 Unclassified 671
97 Ga0070665_100025692 3300005548 Bacteria 5932
98 Ga0070665_101551442 3300005548 Unclassified 670
99 Ga0068855_100093362 3300005563 Bacteria 3470
100 Ga0068855_100170140 3300005563 Bacteria 2468
101 Ga0070664_100101210 3300005564 Bacteria 2506
102 Ga0070664_100615039 3300005564 Bacteria 1008
103 Ga0070664_101450727 3300005564 Unclassified 649
104 Ga0070664_101898929 3300005564 Unclassified 565
105 Ga0068857_100097166 3300005577 Bacteria 2640
106 Ga0068857_100341671 3300005577 Unclassified 1385
107 Ga0068857_100916453 3300005577 Unclassified 841
108 Ga0068857_101247416 3300005577 Unclassified 720
109 Ga0068857_101248526 3300005577 Bacteria 720
110 Ga0068854_100091647 3300005578 Bacteria 2263
111 Ga0068856_100006523 3300005614 Bacteria 11442
112 Ga0068856_100025503 3300005614 Bacteria 5765
113 Ga0068852_100004087 3300005616 Bacteria 10269
114 Ga0068852_101354036 3300005616 Unclassified 734
115 Ga0068859_100024787 3300005617 Bacteria 6020
116 Ga0068859_100344927 3300005617 Unclassified 1584
117 Ga0068859_101246758 3300005617 Bacteria 819
118 Ga0068859_101457478 3300005617 Unclassified 755
119 Ga0068859_101585269 3300005617 Unclassified 723
120 Ga0068859_101730692 3300005617 Unclassified 690
121 Ga0068864_100016883 3300005618 Bacteria 6084
122 Ga0068864_100349705 3300005618 Bacteria 1394
123 Ga0068864_100529560 3300005618 Bacteria 1137
124 Ga0068864_100555043 3300005618 Bacteria 1111
125 Ga0068864_100807546 3300005618 Bacteria 922
126 Ga0068866_10429448 3300005718 Unclassified 859
127 Ga0068861_100047464 3300005719 Bacteria 3241
128 Ga0068861_100223999 3300005719 Unclassified 1591
129 Ga0068861_102060105 3300005719 Bacteria 570
130 Ga0068851_10162914 3300005834 Unclassified 1226
131 Ga0068870_11350692 3300005840 Unclassified 521
132 Ga0068863_100459862 3300005841 Unclassified 1250
133 Ga0068863_100560411 3300005841 Bacteria 1129
134 Ga0068863_101535491 3300005841 Bacteria 675
135 Ga0068858_100016108 3300005842 Bacteria 7022
136 Ga0068858_100652193 3300005842 Bacteria 1023
137 Ga0068858_100732698 3300005842 Unclassified 963
138 Ga0068858_101489495 3300005842 Unclassified 667
139 Ga0068860_100035128 3300005843 Bacteria 4809
140 Ga0068860_100514161 3300005843 Unclassified 1197
141 Ga0068860_100784824 3300005843 Bacteria 965
142 Ga0068862_100006400 3300005844 Bacteria 9792
143 Ga0068862_100012891 3300005844 Bacteria 6913
144 Ga0068862_100254258 3300005844 Bacteria 1602
145 Ga0068862_100436242 3300005844 Bacteria 1232
146 Ga0068862_100658264 3300005844 Unclassified 1011
147 Ga0068862_100767510 3300005844 Unclassified 939
148 Ga0068862_102251659 3300005844 Unclassified 556
149 Ga0081455_10117134 3300005937 Bacteria 2106
150 Ga0081455_10824943 3300005937 Unclassified 581
151 Ga0075365_10000902 3300006038 Bacteria 12461
152 Ga0075363_100056316 3300006048 Bacteria 2108
153 Ga0075364_10017485 3300006051 Bacteria 4480
154 Ga0070715_10239734 3300006163 Bacteria 942
155 Ga0075367_10009106 3300006178 Bacteria 5173
156 Ga0075367_10014246 3300006178 Unclassified 4299
157 Ga0075367_10065861 3300006178 Unclassified 2170
158 Ga0075367_10181795 3300006178 Unclassified 1311
159 Ga0075367_10745493 3300006178 Unclassified 623
160 Ga0075366_10192475 3300006195 Bacteria 1240
161 Ga0097621_100011160 3300006237 Bacteria 6612
162 Ga0097621_100099593 3300006237 Unclassified 2443
163 Ga0097621_100588781 3300006237 Bacteria 1016
164 Ga0097621_101134961 3300006237 Bacteria 735
165 Ga0097621_101174738 3300006237 Unclassified 722
166 Ga0097621_101671934 3300006237 Unclassified 606
167 Ga0075370_10118212 3300006353 Unclassified 1542
168 Ga0075370_10670825 3300006353 Bacteria 630
169 Ga0068871_100035953 3300006358 Bacteria 3940
170 Ga0068871_100036690 3300006358 Bacteria 3904
171 Ga0068871_101648600 3300006358 Bacteria 608
172 Ga0075428_100052336 3300006844 Bacteria 4476
173 Ga0075428_100070521 3300006844 Bacteria 3820
174 Ga0075428_100160158 3300006844 Unclassified 2443
175 Ga0075428_100617954 3300006844 Bacteria 1157
176 Ga0075428_100985046 3300006844 Bacteria 893
177 Ga0075428_101205941 3300006844 Unclassified 798
178 Ga0075428_101619139 3300006844 Bacteria 677
179 Ga0075428_102156187 3300006844 Unclassified 575
180 Ga0075430_100106840 3300006846 Bacteria 2335
181 Ga0075430_100340534 3300006846 Bacteria 1239
182 Ga0075431_100091969 3300006847 Bacteria 3131
183 Ga0075431_100340128 3300006847 Bacteria 1510
184 Ga0075431_101850182 3300006847 Bacteria 559
185 Ga0075433_10011464 3300006852 Bacteria 7139
186 Ga0075433_10036779 3300006852 Bacteria 4220
187 Ga0075433_10041750 3300006852 Bacteria 3976
188 Ga0075433_10679920 3300006852 Unclassified 902
189 Ga0075433_11378995 3300006852 Unclassified 610
190 Ga0075434_100022514 3300006871 Bacteria 6136
191 Ga0075434_100204819 3300006871 Bacteria 1993
192 Ga0075434_100290861 3300006871 Bacteria 1654
193 Ga0075434_100756325 3300006871 Unclassified 989
194 Ga0075434_101182562 3300006871 Unclassified 777
195 Ga0075434_102583480 3300006871 Unclassified 508
196 Ga0075429_100005407 3300006880 Bacteria 10991
197 Ga0075429_100052728 3300006880 Unclassified 3539
198 Ga0075429_100121640 3300006880 Bacteria 2282
199 Ga0075429_100904907 3300006880 Unclassified 772
200 Ga0068865_100005689 3300006881 Bacteria 7573
201 Ga0068865_101127618 3300006881 Bacteria 692
202 Ga0068865_101737008 3300006881 Bacteria 563
203 Ga0068865_101943680 3300006881 Bacteria 533
204 Ga0068865_101997595 3300006881 Unclassified 526
205 Ga0097620_100024787 3300006931 Bacteria 6020
206 Ga0097620_100344899 3300006931 Unclassified 1584
207 Ga0097620_101246563 3300006931 Bacteria 819
208 Ga0097620_101457064 3300006931 Unclassified 755
209 Ga0097620_101585264 3300006931 Unclassified 723
210 Ga0097620_101730692 3300006931 Unclassified 690
211 Ga0075435_100068198 3300007076 Bacteria 2897
212 Ga0075435_100376856 3300007076 Bacteria 1219
213 Ga0075435_100583161 3300007076 Unclassified 969
214 Ga0105240_10017230 3300009093 Bacteria 9744
215 Ga0105240_10027336 3300009093 Bacteria 7469
216 Ga0105240_11295856 3300009093 Bacteria 768
217 Ga0111539_10000877 3300009094 Bacteria 39291
218 Ga0111539_10015430 3300009094 Bacteria 9504
219 Ga0111539_10026354 3300009094 Bacteria 7108
220 Ga0111539_10091868 3300009094 Bacteria 3566
221 Ga0111539_10580621 3300009094 Bacteria 1305
222 Ga0111539_12002676 3300009094 Unclassified 672
223 Ga0111539_12037580 3300009094 Bacteria 666
224 Ga0111539_12114514 3300009094 Unclassified 653
225 Ga0105245_10266989 3300009098 Bacteria 1667
226 Ga0105247_10001343 3300009101 Bacteria 17878
227 Ga0114129_10005381 3300009147 Bacteria 18070
228 Ga0114129_10019197 3300009147 Bacteria 9739
229 Ga0114129_10047217 3300009147 Bacteria 6051
230 Ga0114129_10291083 3300009147 Bacteria 2179
231 Ga0114129_10630225 3300009147 Bacteria 1386
232 Ga0114129_10859206 3300009147 Bacteria 1153
233 Ga0114129_12849921 3300009147 Bacteria 573
234 Ga0105243_10099205 3300009148 Unclassified 2414
235 Ga0105243_12189121 3300009148 Bacteria 589
236 Ga0105241_10002184 3300009174 Bacteria 14740
237 Ga0105241_10410023 3300009174 Unclassified 1190
238 Ga0105241_10474447 3300009174 Bacteria 1111
239 Ga0105242_10041588 3300009176 Bacteria 3708
240 Ga0105242_10203011 3300009176 Unclassified 1762
241 Ga0105242_10426908 3300009176 Bacteria 1243
242 Ga0105248_10006564 3300009177 Bacteria 12756
243 Ga0105248_10007290 3300009177 Bacteria 12133
244 Ga0105248_10291241 3300009177 Unclassified 1838
245 Ga0105248_10431829 3300009177 Bacteria 1483
246 Ga0105248_10548146 3300009177 Bacteria 1304
247 Ga0105248_10565360 3300009177 Bacteria 1283
248 Ga0105248_10642598 3300009177 Unclassified 1197
249 Ga0105248_10842844 3300009177 Bacteria 1035
250 Ga0105248_12574198 3300009177 Bacteria 580
251 Ga0105237_10018436 3300009545 Bacteria 7222
252 Ga0105237_10302559 3300009545 Bacteria 1602
253 Ga0105237_10376973 3300009545 Unclassified 1423
254 Ga0105238_10015487 3300009551 Bacteria 7717
255 Ga0105238_10103898 3300009551 Bacteria 2822
256 Ga0105238_11067781 3300009551 Bacteria 829
257 Ga0105249_10000704 3300009553 Bacteria 30308
258 Ga0105249_10124852 3300009553 Bacteria 2450
259 Ga0105249_11116634 3300009553 Bacteria 859
260 Ga0105249_11427002 3300009553 Bacteria 764
261 Ga0105249_11556818 3300009553 Bacteria 733
262 Ga0105249_11609787 3300009553 Unclassified 722
263 Ga0105249_12779293 3300009553 Bacteria 561
264 Ga0105239_10296097 3300010375 Bacteria 1822
265 Ga0105239_11106361 3300010375 Unclassified 912
266 Ga0105246_10106455 3300011119 Bacteria 2052
267 Ga0105246_10166582 3300011119 Bacteria 1684
268 Ga0105246_10768699 3300011119 Unclassified 851
269 Ga0105246_11992471 3300011119 Unclassified 560
270 Ga0157373_10688392 3300013100 Unclassified 748
271 Ga0157373_10902196 3300013100 Unclassified 656
272 Ga0157370_10002206 3300013104 Bacteria 23774
273 Ga0157370_10013800 3300013104 Bacteria 8300
274 Ga0157370_10274141 3300013104 Bacteria 1559
275 Ga0157370_11661731 3300013104 Unclassified 573
276 Ga0157369_10006854 3300013105 Bacteria 13141
277 Ga0157369_10016640 3300013105 Bacteria 8268
278 Ga0157369_10539060 3300013105 Bacteria 1207
279 Ga0157369_11017488 3300013105 Bacteria 848
280 Ga0157374_10341734 3300013296 Bacteria 1486
281 Ga0157374_10442984 3300013296 Bacteria 1300
282 Ga0157374_10686732 3300013296 Unclassified 1036
283 Ga0157374_11993310 3300013296 Unclassified 607
284 Ga0157378_10462975 3300013297 Bacteria 1260
285 Ga0157378_10744455 3300013297 Unclassified 1002
286 Ga0157378_10893748 3300013297 Bacteria 919
287 Ga0163162_10384485 3300013306 Bacteria 1537
288 Ga0163162_10615219 3300013306 Bacteria 1212
289 Ga0157372_10076205 3300013307 Unclassified 3786
290 Ga0157372_13218269 3300013307 Unclassified 521
291 Ga0157375_10096642 3300013308 Bacteria 3027
292 Ga0157375_10673530 3300013308 Unclassified 1189
293 Ga0157375_10783165 3300013308 Bacteria 1103
294 Ga0157375_11067737 3300013308 Unclassified 944
295 Ga0157375_12839681 3300013308 Unclassified 579
296 Ga0157375_13103957 3300013308 Unclassified 554
297 Ga0163163_10003928 3300014325 Bacteria 12680
298 Ga0163163_11164469 3300014325 Unclassified 834
299 Ga0157380_10047579 3300014326 Bacteria 3375
300 Ga0157380_10279686 3300014326 Bacteria 1526
301 Ga0157380_10500489 3300014326 Unclassified 1180
302 Ga0157380_11133698 3300014326 Unclassified 823
303 Ga0157377_11233577 3300014745 Unclassified 581
304 Ga0157377_11645693 3300014745 Bacteria 516
305 Ga0157379_10070866 3300014968 Bacteria 3119
306 Ga0157379_10136696 3300014968 Bacteria 2208
307 Ga0157376_10232792 3300014969 Unclassified 1712
308 Ga0157376_10657624 3300014969 Bacteria 1049
309 Ga0157376_11028787 3300014969 Bacteria 847
310 Ga0213873_10041715 3300021358 Unclassified 1184
311 Ga0213875_10039989 3300021388 Bacteria 2208
312 Ga0224712_10202717 3300022467 Bacteria 902
313 Ga0224712_10529244 3300022467 Bacteria 571
314 Ga0207666_1049318 3300025271 Bacteria 666
315 Ga0207710_10004326 3300025900 Bacteria 6217
316 Ga0207688_10060716 3300025901 Bacteria 2130
317 Ga0207688_10246788 3300025901 Bacteria 1081
318 Ga0207688_10528332 3300025901 Bacteria 740
319 Ga0207688_10947056 3300025901 Bacteria 545
320 Ga0207688_10969674 3300025901 Unclassified 538
321 Ga0207680_10170238 3300025903 Bacteria 1466
322 Ga0207680_10307735 3300025903 Bacteria 1106
323 Ga0207647_10241518 3300025904 Bacteria 1037
324 Ga0207685_10195160 3300025905 Bacteria 947
325 Ga0207699_10126725 3300025906 Unclassified 1659
326 Ga0207699_10437151 3300025906 Bacteria 937
327 Ga0207645_10372089 3300025907 Bacteria 958
328 Ga0207645_11184860 3300025907 Unclassified 513
329 Ga0207707_10002924 3300025912 Bacteria 15232
330 Ga0207707_10069825 3300025912 Bacteria 3062
331 Ga0207707_11620720 3300025912 Unclassified 509
332 Ga0207695_10016151 3300025913 Bacteria 8755
333 Ga0207695_10095646 3300025913 Bacteria 2974
334 Ga0207671_10005893 3300025914 Bacteria 11119
335 Ga0207671_10317259 3300025914 Unclassified 1233
336 Ga0207663_10950256 3300025916 Bacteria 688
337 Ga0207662_10196162 3300025918 Bacteria 1305
338 Ga0207657_10012621 3300025919 Bacteria 8327
339 Ga0207657_10661585 3300025919 Bacteria 813
340 Ga0207649_10025767 3300025920 Bacteria 3432
341 Ga0207649_10461316 3300025920 Bacteria 960
342 Ga0207652_10609595 3300025921 Unclassified 978
343 Ga0207652_10758099 3300025921 Bacteria 863
344 Ga0207681_10122652 3300025923 Bacteria 1908
345 Ga0207681_10141820 3300025923 Bacteria 1790
346 Ga0207681_10554883 3300025923 Unclassified 946
347 Ga0207694_10013006 3300025924 Bacteria 6266
348 Ga0207694_10172785 3300025924 Bacteria 1750
349 Ga0207694_10317667 3300025924 Bacteria 1285
350 Ga0207650_10071503 3300025925 Bacteria 2610
351 Ga0207650_10917125 3300025925 Bacteria 744
352 Ga0207659_10602032 3300025926 Bacteria 937
353 Ga0207700_10039541 3300025928 Bacteria 3435
354 Ga0207700_10115361 3300025928 Bacteria 2169
355 Ga0207700_10890707 3300025928 Unclassified 796
356 Ga0207700_11007313 3300025928 Unclassified 745
357 Ga0207664_10010885 3300025929 Bacteria 6442
358 Ga0207644_10779124 3300025931 Bacteria 799
359 Ga0207690_10373345 3300025932 Bacteria 1132
360 Ga0207706_10224620 3300025933 Bacteria 1644
361 Ga0207706_11274325 3300025933 Bacteria 608
362 Ga0207686_10104506 3300025934 Bacteria 1897
363 Ga0207709_10341571 3300025935 Bacteria 1127
364 Ga0207709_11077358 3300025935 Bacteria 659
365 Ga0207670_10068713 3300025936 Bacteria 2442
366 Ga0207670_10450696 3300025936 Unclassified 1037
367 Ga0207670_11170717 3300025936 Unclassified 650
368 Ga0207704_10081486 3300025938 Bacteria 2093
369 Ga0207704_11544481 3300025938 Bacteria 570
370 Ga0207691_10012757 3300025940 Bacteria 8045
371 Ga0207691_10088136 3300025940 Bacteria 2783
372 Ga0207691_10495715 3300025940 Bacteria 1037
373 Ga0207691_10785349 3300025940 Bacteria 801
374 Ga0207711_10002774 3300025941 Bacteria 15418
375 Ga0207711_10017684 3300025941 Bacteria 5923
376 Ga0207711_10239728 3300025941 Bacteria 1662
377 Ga0207711_10874508 3300025941 Unclassified 836
378 Ga0207689_10112243 3300025942 Bacteria 2241
379 Ga0207689_10236160 3300025942 Bacteria 1511
380 Ga0207689_10955552 3300025942 Bacteria 723
381 Ga0207661_10138674 3300025944 Bacteria 2091
382 Ga0207679_10404350 3300025945 Bacteria 1202
383 Ga0207679_10736922 3300025945 Bacteria 896
384 Ga0207667_10006766 3300025949 Bacteria 13841
385 Ga0207667_10032589 3300025949 Bacteria 5613
386 Ga0207667_10196152 3300025949 Bacteria 2071
387 Ga0207651_10635303 3300025960 Bacteria 936
388 Ga0207651_10788474 3300025960 Bacteria 842
389 Ga0207712_10361701 3300025961 Bacteria 1209
390 Ga0207712_11421562 3300025961 Bacteria 621
391 Ga0207668_10697694 3300025972 Bacteria 892
392 Ga0207668_10938554 3300025972 Bacteria 771
393 Ga0207640_11315849 3300025981 Bacteria 645
394 Ga0207658_10080956 3300025986 Bacteria 2489
395 Ga0207677_12302499 3300026023 Bacteria 501
396 Ga0207703_10006854 3300026035 Bacteria 9072
397 Ga0207703_10725396 3300026035 Bacteria 946
398 Ga0207639_10010649 3300026041 Bacteria 6367
399 Ga0207639_10560950 3300026041 Unclassified 1049
400 Ga0207639_10629854 3300026041 Unclassified 991
401 Ga0207678_10045297 3300026067 Unclassified 3804
402 Ga0207678_10370164 3300026067 Bacteria 1238
403 Ga0207708_10093490 3300026075 Bacteria 2321
404 Ga0207708_10121398 3300026075 Bacteria 2036
405 Ga0207708_10444631 3300026075 Bacteria 1079
406 Ga0207702_10299726 3300026078 Bacteria 1525
407 Ga0207702_11179514 3300026078 Unclassified 760
408 Ga0207702_11660645 3300026078 Bacteria 632
409 Ga0207641_10001309 3300026088 Bacteria 24607
410 Ga0207648_10077040 3300026089 Unclassified 2906
411 Ga0207648_10291836 3300026089 Bacteria 1460
412 Ga0207648_11498393 3300026089 Bacteria 634
413 Ga0207676_10092742 3300026095 Unclassified 2484
414 Ga0207676_10723427 3300026095 Bacteria 966
415 Ga0207676_11000144 3300026095 Unclassified 824
416 Ga0207674_10369706 3300026116 Bacteria 1386
417 Ga0207674_10899295 3300026116 Unclassified 853
418 Ga0207674_11405644 3300026116 Unclassified 667
419 Ga0207675_100029102 3300026118 Bacteria 5148
420 Ga0207675_100144334 3300026118 Bacteria 2263
421 Ga0207675_100333938 3300026118 Bacteria 1482
422 Ga0207675_100914358 3300026118 Bacteria 894
423 Ga0207675_101190071 3300026118 Bacteria 782
424 Ga0207675_101196799 3300026118 Bacteria 780
425 Ga0207675_102012866 3300026118 Bacteria 595
426 Ga0207683_10779743 3300026121 Unclassified 887
427 Ga0207698_10358976 3300026142 Unclassified 1379
428 Ga0207698_11297270 3300026142 Bacteria 743
429 Ga0210002_1028042 3300027617 Unclassified 929
430 Ga0209971_1089858 3300027682 Unclassified 749
431 Ga0209998_10037335 3300027717 Bacteria 1093
432 Ga0209813_10015184 3300027866 Bacteria 2082
433 Ga0207428_10005536 3300027907 Bacteria 11768
434 Ga0207428_10101725 3300027907 Bacteria 2220
435 Ga0207428_10358698 3300027907 Bacteria 1072
436 Ga0207428_10503235 3300027907 Bacteria 880
437 Ga0268266_10141235 3300028379 Bacteria 2161
438 Ga0268265_10010082 3300028380 Bacteria 6378
439 Ga0268265_10180990 3300028380 Bacteria 1811
440 Ga0268265_11294425 3300028380 Bacteria 729
441 Ga0268265_11483583 3300028380 Unclassified 681
442 Ga0268265_11538017 3300028380 Bacteria 669
443 Ga0268265_12240330 3300028380 Bacteria 553
444 Ga0268264_10090888 3300028381 Unclassified 2632
445 Ga0268264_10091188 3300028381 Bacteria 2628
446 Ga0268264_12264553 3300028381 Unclassified 551
447 Ga0265318_10141642 3300028577 Bacteria 883
448 Ga0265330_10266975 3300031235 Unclassified 721
449 Ga0265332_10091968 3300031238 Bacteria 1282
450 Ga0307408_100016751 3300031548 Bacteria 4899
451 Ga0307408_100124303 3300031548 Bacteria 2003
452 Ga0307408_100680199 3300031548 Bacteria 923
453 Ga0265313_10003726 3300031595 Bacteria 12129
454 Ga0265314_10000216 3300031711 Bacteria 85672
455 Ga0265314_10430005 3300031711 Unclassified 707
456 Ga0307405_10049922 3300031731 Bacteria 2588
457 Ga0307405_10756850 3300031731 Bacteria 810
458 Ga0307405_10821789 3300031731 Unclassified 780
459 Ga0307413_10083477 3300031824 Unclassified 2056
460 Ga0307410_10159552 3300031852 Bacteria 1688
461 Ga0307410_10315662 3300031852 Bacteria 1238
462 Ga0307410_10372515 3300031852 Bacteria 1147
463 Ga0307406_10146007 3300031901 Bacteria 1681
464 Ga0307407_10057792 3300031903 Bacteria 2252
465 Ga0307407_10717982 3300031903 Unclassified 754
466 Ga0307412_10019274 3300031911 Bacteria 4126
467 Ga0307412_11131413 3300031911 Bacteria 698
468 Ga0307409_100445536 3300031995 Bacteria 1248
469 Ga0307409_101803558 3300031995 Unclassified 641
470 Ga0307416_100021100 3300032002 Bacteria 4668
471 Ga0307416_100103958 3300032002 Bacteria 2481
472 Ga0307416_100197469 3300032002 Bacteria 1905
473 Ga0307416_100324934 3300032002 Unclassified 1543
474 Ga0307411_10187960 3300032005 Bacteria 1574
475 Ga0307411_10206396 3300032005 Bacteria 1513
476 Ga0307411_10220855 3300032005 Unclassified 1470
477 Ga0307415_100111173 3300032126 Bacteria 2033
478 Ga0307415_100224485 3300032126 Bacteria 1508
479 Ga0307415_100423945 3300032126 Unclassified 1143
480 Ga0373930_0156184 3300034816 Bacteria 575
481 Ga0373926_0040041 3300035083 Unclassified 1672
482 Ga0373949_0307143 3300035090 Bacteria 505
483 Ga0373939_0154383 3300035114 Bacteria 838
484 Ga0373941_0031811 3300035115 Bacteria 1575
485 Ga0373941_0221269 3300035115 Bacteria 728
486 Ga0373954_0013040 3300035118 Bacteria 3700
487 Ga0373943_0635499 3300035170 Unclassified 630
488 Ga0373962_0065421 3300035242 Bacteria 1076
489 Ga0373962_0110671 3300035242 Bacteria 866
490 Ga0373931_0358231 3300035691 Bacteria 915
491 Ga0373933_0032750 3300035724 Unclassified 3022
492 Ga0373933_0470912 3300035724 Unclassified 822
493 Ga0373947_0084425 3300035725 Unclassified 1971
494 Ga0373937_0112709 3300036401 Bacteria 2530
495 Ga0373937_0560998 3300036401 Bacteria 1085
496 Ga0373937_0741624 3300036401 Bacteria 929
497 Ga0373937_1283977 3300036401 Unclassified 680
498 Ga0436364_0898853 3300037853 Bacteria 6369
499 Ga0436365_0351660 3300039437 Unclassified 3987
500 Ga0436365_0680683 3300039437 Unclassified 1012
501 Ga0436365_0806459 3300039437 Unclassified 890
502 Ga0436362_0054859 3300039453 Unclassified 1792
503 Ga0439453_0023731 3300041408 Bacteria 1121
504 Ga0439461_0204124 3300041410 Unclassified 532
505 Ga0451853_3411573 3300041512 Bacteria 873
506 Ga0439443_050276 3300042003 Bacteria 728
507 Ga0439451_130210 3300042009 Unclassified 514
508 Ga0439434_0041188 3300042435 Unclassified 1419
509 Ga0439435_0004792 3300042436 Bacteria 2935
510 Ga0466970_0147849 3300044765 Bacteria 1297
511 Ga0451576_1065507 3300045051 Bacteria 846
512 Ga0495590_0306204 3300046457 Archaea 598
513 Ga0495638_0008641 3300046460 Bacteria 7203
514 Ga0495580_0077268 3300046472 Unclassified 2322
515 Ga0495580_0243992 3300046472 Unclassified 1231
516 Ga0495584_0380911 3300046491 Bacteria 717
517 Ga0495586_0301465 3300046535 Unclassified 918
518 Ga0495656_0661645 3300046615 Bacteria 561
519 Ga0495656_0673821 3300046615 Bacteria 556
520 Ga0495625_0195751 3300046660 Bacteria 1336
521 Ga0495647_0136594 3300046681 Bacteria 1043
522 Ga0495581_0275234 3300047315 Bacteria 984
523 Ga0495604_1014415 3300047317 Unclassified 513
524 Ga0496104_0079636 3300048907 Bacteria 3123
525 Ga0496104_0821284 3300048907 Bacteria 835
526 Ga0496104_0985665 3300048907 Unclassified 747
527 Ga0496106_1585107 3300048909 Bacteria 502
528 Ga0496108_0002608 3300048911 Bacteria 14436
529 Ga0496109_0284217 3300048912 Bacteria 1559
530 Ga0496110_0970358 3300048913 Bacteria 757
531 Ga0496112_0214102 3300048915 Bacteria 1883
532 Ga0496112_0603350 3300048915 Bacteria 1030
533 Ga0496113_0022633 3300048916 Unclassified 4449
534 Ga0496114_0143922 3300048917 Bacteria 2066
535 Ga0501291_096494 3300049514 Unclassified 611
536 Ga0501031_0062530 3300049568 Unclassified 2426
537 Ga0501032_0001490 3300049569 Bacteria 18687
538 Ga0501032_0010646 3300049569 Bacteria 6622
539 Ga0501034_0008515 3300049571 Bacteria 10827
540 Ga0501034_0036361 3300049571 Bacteria 4988
541 Ga0501034_0227059 3300049571 Unclassified 1817
542 Ga0501034_0296409 3300049571 Bacteria 1554
543 Ga0501034_0518438 3300049571 Bacteria 1104
544 Ga0501036_0004804 3300049572 Bacteria 10922
545 Ga0501036_0276583 3300049572 Unclassified 1405
546 Ga0501036_0410482 3300049572 Bacteria 1129
547 Ga0501036_0616526 3300049572 Bacteria 899
548 Ga0501038_0004001 3300049574 Bacteria 13688
549 Ga0501039_0016635 3300049575 Bacteria 5634
550 Ga0501040_0107678 3300049576 Unclassified 1948
551 Ga0501041_0347339 3300049577 Bacteria 937
552 Ga0501042_0219060 3300049578 Bacteria 1373
553 Ga0501046_0035617 3300049580 Bacteria 4010
554 Ga0501046_0804543 3300049580 Unclassified 658
555 Ga0501047_0002240 3300049581 Bacteria 18517
556 Ga0501047_0003173 3300049581 Bacteria 15580
557 Ga0501047_0052599 3300049581 Unclassified 3936
558 Ga0501048_0073606 3300049582 Bacteria 2411
559 Ga0501048_0207365 3300049582 Bacteria 1390
560 Ga0501067_0784535 3300049583 Bacteria 537
561 Ga0501068_0002043 3300049584 Bacteria 10768
562 Ga0501068_0003469 3300049584 Bacteria 8493
563 Ga0501069_0021476 3300049585 Unclassified 3504
564 Ga0501070_0069490 3300049586 Unclassified 2916
565 Ga0501071_0137272 3300049587 Unclassified 1820
566 Ga0501071_0689518 3300049587 Unclassified 786
567 Ga0501072_0081186 3300049588 Bacteria 2570
568 Ga0501072_0109886 3300049588 Unclassified 2194
569 Ga0501072_0635970 3300049588 Bacteria 840
570 Ga0501073_0010895 3300049589 Bacteria 6651
571 Ga0501073_0213423 3300049589 Bacteria 1334
572 Ga0501073_0438904 3300049589 Bacteria 902
573 Ga0501074_0026649 3300049590 Unclassified 4191
574 Ga0501074_0127784 3300049590 Bacteria 1819
575 Ga0501075_0098973 3300049591 Bacteria 2214
576 Ga0501076_0046651 3300049592 Bacteria 3424
577 Ga0501076_0548635 3300049592 Bacteria 953
578 Ga0501077_0412414 3300049593 Bacteria 864
579 Ga0501209_239376 3300049656 Unclassified 565
580 Ga0501217_007995 3300049661 Bacteria 2279
581 Ga0501233_215381 3300049668 Bacteria 565
582 Ga0501235_118449 3300049669 Bacteria 661
583 Ga0501257_028976 3300049686 Unclassified 1330
584 Ga0501258_032263 3300049687 Unclassified 667
585 Ga0501079_0401800 3300049741 Unclassified 1075
586 Ga0501079_0445234 3300049741 Bacteria 1017
587 Ga0501079_0688113 3300049741 Bacteria 805
588 Ga0501080_0003457 3300049742 Bacteria 13931
589 Ga0501080_0144439 3300049742 Bacteria 2199
590 Ga0501080_0357693 3300049742 Unclassified 1317
591 Ga0501083_0033136 3300049744 Bacteria 3538
592 Ga0501083_0054083 3300049744 Bacteria 2694
593 Ga0501083_0159184 3300049744 Bacteria 1477
594 Ga0501268_039851 3300049765 Bacteria 881
595 Ga0501273_057611 3300049770 Unclassified 606
596 Ga0501283_021651 3300049779 Bacteria 1032
597 Ga0501283_106603 3300049779 Bacteria 550
598 Ga0501044_0005743 3300049823 Bacteria 13737
599 Ga0501044_0158039 3300049823 Bacteria 2245
600 Ga0501045_0142750 3300049824 Unclassified 1781
601 nmdc:mga03683_304457_c1 3300050489 Bacteria 748
602 nmdc:mga00v17_546052_c1 3300050491 Bacteria 749
603 nmdc:mga00v17_95045_c1 3300050491 Unclassified 1875
604 nmdc:mga0k408_344291_c1 3300050493 Bacteria 889
605 nmdc:mga06z11_111102_c1 3300050494 Unclassified 1518
606 nmdc:mga06z11_123971_c1 3300050494 Unclassified 1444
607 nmdc:mga04h51_150263_c1 3300050495 Bacteria 890
608 nmdc:mga05p37_36613_c1 3300050507 Bacteria 6018
609 nmdc:mga05p37_41164_c1 3300050507 Bacteria 5674
610 nmdc:mga05p37_521092_c1 3300050507 Bacteria 1360
611 nmdc:mga05p37_579167_c2 3300050507 Bacteria 980
612 nmdc:mga05p37_8887_c1 3300050507 Bacteria 11870
613 nmdc:mga09592_17324_c1 3300050508 Bacteria 5902
614 nmdc:mga09592_725947_c1 3300050508 Unclassified 844
615 nmdc:mga09592_817808_c1 3300050508 Unclassified 787
616 nmdc:mga0qj67_121602_c1 3300050509 Bacteria 2112
617 nmdc:mga0qj67_318047_c1 3300050509 Bacteria 1260
618 nmdc:mga06r32_1353772_c1 3300050510 Bacteria 655
619 nmdc:mga06r32_329529_c1 3300050510 Bacteria 1512
620 nmdc:mga06r32_4544_c1 3300050510 Bacteria 12434
621 nmdc:mga06r32_92893_c1 3300050510 Bacteria 2950
622 nmdc:mga08y16_12069_c1 3300050511 Bacteria 9078
623 nmdc:mga08y16_14968_c1 3300050511 Bacteria 8159
624 nmdc:mga08y16_1597836_c1 3300050511 Unclassified 610
625 nmdc:mga08y16_177584_c1 3300050511 Bacteria 2211
626 nmdc:mga08y16_356116_c1 3300050511 Bacteria 1503
627 nmdc:mga08y16_821787_c1 3300050511 Bacteria 921
628 nmdc:mga08y16_874205_c1 3300050511 Bacteria 887
629 nmdc:mga0n895_200221_c1 3300050512 Bacteria 2028
630 nmdc:mga0n895_387735_c1 3300050512 Bacteria 1413
631 nmdc:mga0n895_42764_c1 3300050512 Bacteria 4410
632 nmdc:mga0n895_922455_c1 3300050512 Unclassified 858
633 nmdc:mga0rr50_28806_c1 3300050513 Bacteria 3908
634 nmdc:mga0rr50_299234_c1 3300050513 Bacteria 1345
635 nmdc:mga08x19_269225_c1 3300050514 Bacteria 1179
636 nmdc:mga0a205_1052224_c1 3300050515 Unclassified 661
637 nmdc:mga0a205_19211_c1 3300050515 Bacteria 6440
638 nmdc:mga0a205_20313_c1 3300050515 Bacteria 6264
639 nmdc:mga0a205_368145_c1 3300050515 Bacteria 1303
640 nmdc:mga0a205_559816_c1 3300050515 Bacteria 998
641 nmdc:mga0a205_974921_c1 3300050515 Unclassified 695
642 Ga0500592_011673 3300053116 Bacteria 1405
643 Ga0501084_0002248 3300054114 Bacteria 15498
644 Ga0501084_0497835 3300054114 Unclassified 1030
645 Ga0501082_0030000 3300060353 Bacteria 4685
646 Ga0501082_0044431 3300060353 Unclassified 3832
647 Ga0501082_0049230 3300060353 Bacteria 3633
648 Ga0530510_0184358 3300061734 Unclassified 1548
649 Ga0207641_10264388
650 JGI24749J21850_1019264
651 Ga0065712_10004149
652 Ga0065712_10280535
653 Ga0065715_10093002
654 Ga0065715_10328485
655 Ga0065707_10317579
656 Ga0065707_10675759
657 Ga0065707_10772296
658 Ga0070676_10530096
659 Ga0070690_101121305
660 Ga0070670_100110622
661 Ga0070670_100220991
662 Ga0070670_100711257
663 Ga0070677_10084680
664 Ga0070677_10248187
665 Ga0068869_100087909
666 Ga0068869_100265286
667 Ga0068869_100299310
668 Ga0068869_100331698
669 Ga0068869_100385596
670 Ga0068869_102030272
671 Ga0070666_10039814
672 Ga0070666_10231448
673 Ga0070680_100927219
674 Ga0070682_100414344
675 Ga0068868_100569639
676 Ga0070660_100108390
677 Ga0070689_100073507
678 Ga0070689_100095837
679 Ga0070689_100392832
680 Ga0070689_101499612
681 Ga0070687_100434969
682 Ga0070687_100575792
683 Ga0070661_100614147
684 Ga0070668_101401750
685 Ga0070669_100004233
686 Ga0070669_100017281
687 Ga0070669_100028961
688 Ga0070669_100802178
689 Ga0070675_100041546
690 Ga0070671_100089343
691 Ga0070671_101974711
692 Ga0070674_100691001
693 Ga0070674_101691915
694 Ga0070673_100033921
695 Ga0070673_100182726
696 Ga0070673_100520826
697 Ga0070688_100445725
698 Ga0070688_100502345
699 Ga0070688_100663786
700 Ga0070688_101151119
701 Ga0070659_100125706
702 Ga0070667_100070240
703 Ga0070709_10778717
704 Ga0070714_100034109
705 Ga0070713_100120666
706 Ga0070710_10460967
707 Ga0070705_100895111
708 Ga0070700_100103642
709 Ga0070700_100158925
710 Ga0070700_100267197
711 Ga0070700_100273127
712 Ga0070700_101045108
713 Ga0070694_100936388
714 Ga0070708_100700665
715 Ga0070663_100523131
716 Ga0070663_101002360
717 Ga0070678_100619354
718 Ga0070678_101057387
719 Ga0070678_101436554
720 Ga0070662_100376421
721 Ga0070681_10997691
722 Ga0070681_11647458
723 Ga0068867_100297387
724 Ga0068867_100837199
725 Ga0068867_101813265
726 Ga0070706_100344594
727 Ga0070706_101990969
728 Ga0070707_101499621
729 Ga0070698_102080627
730 Ga0070679_100363881
731 Ga0070684_100126589
732 Ga0070684_100360696
733 Ga0070684_100537252
734 Ga0070697_100316258
735 Ga0068853_100009965
736 Ga0068853_100329333
737 Ga0070672_100125342
738 Ga0070672_100150627
739 Ga0070672_100270953
740 Ga0070672_100660831
741 Ga0070672_101180432
742 Ga0070686_101104285
743 Ga0070695_100511253
744 Ga0070696_101089980
745 Ga0070665_100025692
746 Ga0070665_101551442
747 Ga0068855_100093362
748 Ga0068855_100170140
749 Ga0070664_100101210
750 Ga0070664_100615039
751 Ga0070664_101450727
752 Ga0070664_101898929
753 Ga0068857_100097166
754 Ga0068857_100341671
755 Ga0068857_100916453
756 Ga0068857_101247416
757 Ga0068857_101248526
758 Ga0068854_100091647
759 Ga0068856_100006523
760 Ga0068856_100025503
761 Ga0068852_100004087
762 Ga0068852_101354036
763 Ga0068859_100024787
764 Ga0068859_100344927
765 Ga0068859_101246758
766 Ga0068859_101457478
767 Ga0068859_101585269
768 Ga0068859_101730692
769 Ga0068864_100016883
770 Ga0068864_100349705
771 Ga0068864_100529560
772 Ga0068864_100555043
773 Ga0068864_100807546
774 Ga0068866_10429448
775 Ga0068861_100047464
776 Ga0068861_100223999
777 Ga0068861_102060105
778 Ga0068851_10162914
779 Ga0068870_11350692
780 Ga0068863_100459862
781 Ga0068863_100560411
782 Ga0068863_101535491
783 Ga0068858_100016108
784 Ga0068858_100652193
785 Ga0068858_100732698
786 Ga0068858_101489495
787 Ga0068860_100035128
788 Ga0068860_100514161
789 Ga0068860_100784824
790 Ga0068862_100006400
791 Ga0068862_100012891
792 Ga0068862_100254258
793 Ga0068862_100436242
794 Ga0068862_100658264
795 Ga0068862_100767510
796 Ga0068862_102251659
797 Ga0081455_10117134
798 Ga0081455_10824943
799 Ga0075365_10000902
800 Ga0075363_100056316
801 Ga0075364_10017485
802 Ga0070715_10239734
803 Ga0075367_10009106
804 Ga0075367_10014246
805 Ga0075367_10065861
806 Ga0075367_10181795
807 Ga0075367_10745493
808 Ga0075366_10192475
809 Ga0097621_100011160
810 Ga0097621_100099593
811 Ga0097621_100588781
812 Ga0097621_101134961
813 Ga0097621_101174738
814 Ga0097621_101671934
815 Ga0075370_10118212
816 Ga0075370_10670825
817 Ga0068871_100035953
818 Ga0068871_100036690
819 Ga0068871_101648600
820 Ga0075428_100052336
821 Ga0075428_100070521
822 Ga0075428_100160158
823 Ga0075428_100617954
824 Ga0075428_100985046
825 Ga0075428_101205941
826 Ga0075428_101619139
827 Ga0075428_102156187
828 Ga0075430_100106840
829 Ga0075430_100340534
830 Ga0075431_100091969
831 Ga0075431_100340128
832 Ga0075431_101850182
833 Ga0075433_10011464
834 Ga0075433_10036779
835 Ga0075433_10041750
836 Ga0075433_10679920
837 Ga0075433_11378995
838 Ga0075434_100022514
839 Ga0075434_100204819
840 Ga0075434_100290861
841 Ga0075434_100756325
842 Ga0075434_101182562
843 Ga0075434_102583480
844 Ga0075429_100005407
845 Ga0075429_100052728
846 Ga0075429_100121640
847 Ga0075429_100904907
848 Ga0068865_100005689
849 Ga0068865_101127618
850 Ga0068865_101737008
851 Ga0068865_101943680
852 Ga0068865_101997595
853 Ga0097620_100024787
854 Ga0097620_100344899
855 Ga0097620_101246563
856 Ga0097620_101457064
857 Ga0097620_101585264
858 Ga0097620_101730692
859 Ga0075435_100068198
860 Ga0075435_100376856
861 Ga0075435_100583161
862 Ga0105240_10017230
863 Ga0105240_10027336
864 Ga0105240_11295856
865 Ga0111539_10000877
866 Ga0111539_10015430
867 Ga0111539_10026354
868 Ga0111539_10091868
869 Ga0111539_10580621
870 Ga0111539_12002676
871 Ga0111539_12037580
872 Ga0111539_12114514
873 Ga0105245_10266989
874 Ga0105247_10001343
875 Ga0114129_10005381
876 Ga0114129_10019197
877 Ga0114129_10047217
878 Ga0114129_10291083
879 Ga0114129_10630225
880 Ga0114129_10859206
881 Ga0114129_12849921
882 Ga0105243_10099205
883 Ga0105243_12189121
884 Ga0105241_10002184
885 Ga0105241_10410023
886 Ga0105241_10474447
887 Ga0105242_10041588
888 Ga0105242_10203011
889 Ga0105242_10426908
890 Ga0105248_10006564
891 Ga0105248_10007290
892 Ga0105248_10291241
893 Ga0105248_10431829
894 Ga0105248_10548146
895 Ga0105248_10565360
896 Ga0105248_10642598
897 Ga0105248_10842844
898 Ga0105248_12574198
899 Ga0105237_10018436
900 Ga0105237_10302559
901 Ga0105237_10376973
902 Ga0105238_10015487
903 Ga0105238_10103898
904 Ga0105238_11067781
905 Ga0105249_10000704
906 Ga0105249_10124852
907 Ga0105249_11116634
908 Ga0105249_11427002
909 Ga0105249_11556818
910 Ga0105249_11609787
911 Ga0105249_12779293
912 Ga0105239_10296097
913 Ga0105239_11106361
914 Ga0105246_10106455
915 Ga0105246_10166582
916 Ga0105246_10768699
917 Ga0105246_11992471
918 Ga0157373_10688392
919 Ga0157373_10902196
920 Ga0157370_10002206
921 Ga0157370_10013800
922 Ga0157370_10274141
923 Ga0157370_11661731
924 Ga0157369_10006854
925 Ga0157369_10016640
926 Ga0157369_10539060
927 Ga0157369_11017488
928 Ga0157374_10341734
929 Ga0157374_10442984
930 Ga0157374_10686732
931 Ga0157374_11993310
932 Ga0157378_10462975
933 Ga0157378_10744455
934 Ga0157378_10893748
935 Ga0163162_10384485
936 Ga0163162_10615219
937 Ga0157372_10076205
938 Ga0157372_13218269
939 Ga0157375_10096642
940 Ga0157375_10673530
941 Ga0157375_10783165
942 Ga0157375_11067737
943 Ga0157375_12839681
944 Ga0157375_13103957
945 Ga0163163_10003928
946 Ga0163163_11164469
947 Ga0157380_10047579
948 Ga0157380_10279686
949 Ga0157380_10500489
950 Ga0157380_11133698
951 Ga0157377_11233577
952 Ga0157377_11645693
953 Ga0157379_10070866
954 Ga0157379_10136696
955 Ga0157376_10232792
956 Ga0157376_10657624
957 Ga0157376_11028787
958 Ga0213873_10041715
959 Ga0213875_10039989
960 Ga0224712_10202717
961 Ga0224712_10529244
962 Ga0207666_1049318
963 Ga0207710_10004326
964 Ga0207688_10060716
965 Ga0207688_10246788
966 Ga0207688_10528332
967 Ga0207688_10947056
968 Ga0207688_10969674
969 Ga0207680_10170238
970 Ga0207680_10307735
971 Ga0207647_10241518
972 Ga0207685_10195160
973 Ga0207699_10126725
974 Ga0207699_10437151
975 Ga0207645_10372089
976 Ga0207645_11184860
977 Ga0207707_10002924
978 Ga0207707_10069825
979 Ga0207707_11620720
980 Ga0207695_10016151
981 Ga0207695_10095646
982 Ga0207671_10005893
983 Ga0207671_10317259
984 Ga0207663_10950256
985 Ga0207662_10196162
986 Ga0207657_10012621
987 Ga0207657_10661585
988 Ga0207649_10025767
989 Ga0207649_10461316
990 Ga0207652_10609595
991 Ga0207652_10758099
992 Ga0207681_10122652
993 Ga0207681_10141820
994 Ga0207681_10554883
995 Ga0207694_10013006
996 Ga0207694_10172785
997 Ga0207694_10317667
998 Ga0207650_10071503
999 Ga0207650_10917125
1000 Ga0207659_10602032
1001 Ga0207700_10039541
1002 Ga0207700_10115361
1003 Ga0207700_10890707
1004 Ga0207700_11007313
1005 Ga0207664_10010885
1006 Ga0207644_10779124
1007 Ga0207690_10373345
1008 Ga0207706_10224620
1009 Ga0207706_11274325
1010 Ga0207686_10104506
1011 Ga0207709_10341571
1012 Ga0207709_11077358
1013 Ga0207670_10068713
1014 Ga0207670_10450696
1015 Ga0207670_11170717
1016 Ga0207704_10081486
1017 Ga0207704_11544481
1018 Ga0207691_10012757
1019 Ga0207691_10088136
1020 Ga0207691_10495715
1021 Ga0207691_10785349
1022 Ga0207711_10002774
1023 Ga0207711_10017684
1024 Ga0207711_10239728
1025 Ga0207711_10874508
1026 Ga0207689_10112243
1027 Ga0207689_10236160
1028 Ga0207689_10955552
1029 Ga0207661_10138674
1030 Ga0207679_10404350
1031 Ga0207679_10736922
1032 Ga0207667_10006766
1033 Ga0207667_10032589
1034 Ga0207667_10196152
1035 Ga0207651_10635303
1036 Ga0207651_10788474
1037 Ga0207712_10361701
1038 Ga0207712_11421562
1039 Ga0207668_10697694
1040 Ga0207668_10938554
1041 Ga0207640_11315849
1042 Ga0207658_10080956
1043 Ga0207677_12302499
1044 Ga0207703_10006854
1045 Ga0207703_10725396
1046 Ga0207639_10010649
1047 Ga0207639_10560950
1048 Ga0207639_10629854
1049 Ga0207678_10045297
1050 Ga0207678_10370164
1051 Ga0207708_10093490
1052 Ga0207708_10121398
1053 Ga0207708_10444631
1054 Ga0207702_10299726
1055 Ga0207702_11179514
1056 Ga0207702_11660645
1057 Ga0207641_10001309
1058 Ga0207648_10077040
1059 Ga0207648_10291836
1060 Ga0207648_11498393
1061 Ga0207676_10092742
1062 Ga0207676_10723427
1063 Ga0207676_11000144
1064 Ga0207674_10369706
1065 Ga0207674_10899295
1066 Ga0207674_11405644
1067 Ga0207675_100029102
1068 Ga0207675_100144334
1069 Ga0207675_100333938
1070 Ga0207675_100914358
1071 Ga0207675_101190071
1072 Ga0207675_101196799
1073 Ga0207675_102012866
1074 Ga0207683_10779743
1075 Ga0207698_10358976
1076 Ga0207698_11297270
1077 Ga0210002_1028042
1078 Ga0209971_1089858
1079 Ga0209998_10037335
1080 Ga0209813_10015184
1081 Ga0207428_10005536
1082 Ga0207428_10101725
1083 Ga0207428_10358698
1084 Ga0207428_10503235
1085 Ga0268266_10141235
1086 Ga0268265_10010082
1087 Ga0268265_10180990
1088 Ga0268265_11294425
1089 Ga0268265_11483583
1090 Ga0268265_11538017
1091 Ga0268265_12240330
1092 Ga0268264_10090888
1093 Ga0268264_10091188
1094 Ga0268264_12264553
1095 Ga0265318_10141642
1096 Ga0265330_10266975
1097 Ga0265332_10091968
1098 Ga0307408_100016751
1099 Ga0307408_100124303
1100 Ga0307408_100680199
1101 Ga0265313_10003726
1102 Ga0265314_10000216
1103 Ga0265314_10430005
1104 Ga0307405_10049922
1105 Ga0307405_10756850
1106 Ga0307405_10821789
1107 Ga0307413_10083477
1108 Ga0307410_10159552
1109 Ga0307410_10315662
1110 Ga0307410_10372515
1111 Ga0307406_10146007
1112 Ga0307407_10057792
1113 Ga0307407_10717982
1114 Ga0307412_10019274
1115 Ga0307412_11131413
1116 Ga0307409_100445536
1117 Ga0307409_101803558
1118 Ga0307416_100021100
1119 Ga0307416_100103958
1120 Ga0307416_100197469
1121 Ga0307416_100324934
1122 Ga0307411_10187960
1123 Ga0307411_10206396
1124 Ga0307411_10220855
1125 Ga0307415_100111173
1126 Ga0307415_100224485
1127 Ga0307415_100423945
1128 Ga0373930_0156184
1129 Ga0373926_0040041
1130 Ga0373949_0307143
1131 Ga0373939_0154383
1132 Ga0373941_0031811
1133 Ga0373941_0221269
1134 Ga0373954_0013040
1135 Ga0373943_0635499
1136 Ga0373962_0065421
1137 Ga0373962_0110671
1138 Ga0373931_0358231
1139 Ga0373933_0032750
1140 Ga0373933_0470912
1141 Ga0373947_0084425
1142 Ga0373937_0112709
1143 Ga0373937_0560998
1144 Ga0373937_0741624
1145 Ga0373937_1283977
1146 Ga0436364_0898853
1147 Ga0436365_0351660
1148 Ga0436365_0680683
1149 Ga0436365_0806459
1150 Ga0436362_0054859
1151 Ga0439453_0023731
1152 Ga0439461_0204124
1153 Ga0451853_3411573
1154 Ga0439443_050276
1155 Ga0439451_130210
1156 Ga0439434_0041188
1157 Ga0439435_0004792
1158 Ga0466970_0147849
1159 Ga0451576_1065507
1160 Ga0495590_0306204
1161 Ga0495638_0008641
1162 Ga0495580_0077268
1163 Ga0495580_0243992
1164 Ga0495584_0380911
1165 Ga0495586_0301465
1166 Ga0495656_0661645
1167 Ga0495656_0673821
1168 Ga0495625_0195751
1169 Ga0495647_0136594
1170 Ga0495581_0275234
1171 Ga0495604_1014415
1172 Ga0496104_0079636
1173 Ga0496104_0821284
1174 Ga0496104_0985665
1175 Ga0496106_1585107
1176 Ga0496108_0002608
1177 Ga0496109_0284217
1178 Ga0496110_0970358
1179 Ga0496112_0214102
1180 Ga0496112_0603350
1181 Ga0496113_0022633
1182 Ga0496114_0143922
1183 Ga0501291_096494
1184 Ga0501031_0062530
1185 Ga0501032_0001490
1186 Ga0501032_0010646
1187 Ga0501034_0008515
1188 Ga0501034_0036361
1189 Ga0501034_0227059
1190 Ga0501034_0296409
1191 Ga0501034_0518438
1192 Ga0501036_0004804
1193 Ga0501036_0276583
1194 Ga0501036_0410482
1195 Ga0501036_0616526
1196 Ga0501038_0004001
1197 Ga0501039_0016635
1198 Ga0501040_0107678
1199 Ga0501041_0347339
1200 Ga0501042_0219060
1201 Ga0501046_0035617
1202 Ga0501046_0804543
1203 Ga0501047_0002240
1204 Ga0501047_0003173
1205 Ga0501047_0052599
1206 Ga0501048_0073606
1207 Ga0501048_0207365
1208 Ga0501067_0784535
1209 Ga0501068_0002043
1210 Ga0501068_0003469
1211 Ga0501069_0021476
1212 Ga0501070_0069490
1213 Ga0501071_0137272
1214 Ga0501071_0689518
1215 Ga0501072_0081186
1216 Ga0501072_0109886
1217 Ga0501072_0635970
1218 Ga0501073_0010895
1219 Ga0501073_0213423
1220 Ga0501073_0438904
1221 Ga0501074_0026649
1222 Ga0501074_0127784
1223 Ga0501075_0098973
1224 Ga0501076_0046651
1225 Ga0501076_0548635
1226 Ga0501077_0412414
1227 Ga0501209_239376
1228 Ga0501217_007995
1229 Ga0501233_215381
1230 Ga0501235_118449
1231 Ga0501257_028976
1232 Ga0501258_032263
1233 Ga0501079_0401800
1234 Ga0501079_0445234
1235 Ga0501079_0688113
1236 Ga0501080_0003457
1237 Ga0501080_0144439
1238 Ga0501080_0357693
1239 Ga0501083_0033136
1240 Ga0501083_0054083
1241 Ga0501083_0159184
1242 Ga0501268_039851
1243 Ga0501273_057611
1244 Ga0501283_021651
1245 Ga0501283_106603
1246 Ga0501044_0005743
1247 Ga0501044_0158039
1248 Ga0501045_0142750
1249 nmdc:mga03683_304457_c1
1250 nmdc:mga00v17_546052_c1
1251 nmdc:mga00v17_95045_c1
1252 nmdc:mga0k408_344291_c1
1253 nmdc:mga06z11_111102_c1
1254 nmdc:mga06z11_123971_c1
1255 nmdc:mga04h51_150263_c1
1256 nmdc:mga05p37_36613_c1
1257 nmdc:mga05p37_41164_c1
1258 nmdc:mga05p37_521092_c1
1259 nmdc:mga05p37_579167_c2
1260 nmdc:mga05p37_8887_c1
1261 nmdc:mga09592_17324_c1
1262 nmdc:mga09592_725947_c1
1263 nmdc:mga09592_817808_c1
1264 nmdc:mga0qj67_121602_c1
1265 nmdc:mga0qj67_318047_c1
1266 nmdc:mga06r32_1353772_c1
1267 nmdc:mga06r32_329529_c1
1268 nmdc:mga06r32_4544_c1
1269 nmdc:mga06r32_92893_c1
1270 nmdc:mga08y16_12069_c1
1271 nmdc:mga08y16_14968_c1
1272 nmdc:mga08y16_1597836_c1
1273 nmdc:mga08y16_177584_c1
1274 nmdc:mga08y16_356116_c1
1275 nmdc:mga08y16_821787_c1
1276 nmdc:mga08y16_874205_c1
1277 nmdc:mga0n895_200221_c1
1278 nmdc:mga0n895_387735_c1
1279 nmdc:mga0n895_42764_c1
1280 nmdc:mga0n895_922455_c1
1281 nmdc:mga0rr50_28806_c1
1282 nmdc:mga0rr50_299234_c1
1283 nmdc:mga08x19_269225_c1
1284 nmdc:mga0a205_1052224_c1
1285 nmdc:mga0a205_19211_c1
1286 nmdc:mga0a205_20313_c1
1287 nmdc:mga0a205_368145_c1
1288 nmdc:mga0a205_559816_c1
1289 nmdc:mga0a205_974921_c1
1290 Ga0500592_011673
1291 Ga0501084_0002248
1292 Ga0501084_0497835
1293 Ga0501082_0030000
1294 Ga0501082_0044431
1295 Ga0501082_0049230
1296 Ga0530510_0184358

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

47

122

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9028 13 109
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9026 13 109
4ejo-assembly1.cif.gz_A-2 crystal structure of padr family transcriptional regulator from eggerthella lenta dsm 2243 0.9003 13 111
6abq-assembly1.cif.gz_B crystal structure of transcription factor from listeria monocytogenes 0.8948 12 115
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.8804 9 115
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9028 13 109 1.10.10.10
af_P32349_45_122_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8914 14 85 1.10.10.10
af_Q9C106_1_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8874 16 86 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8803 13 115 1.10.10.10
2mlgA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8717 16 85 1.10.10.10
ID Description Score Start End GO Terms
AF-W0RR40-F1-model_v4 Transcriptional regulator, PadR-family 0.9702 13 111
AF-A0A3N5ZCT3-F1-model_v4 PadR family transcriptional regulator 0.9649 13 111
AF-A0A3N5LS61-F1-model_v4 PadR family transcriptional regulator 0.9604 13 114
AF-A0A6B9YSR4-F1-model_v4 PadR family transcriptional regulator 0.9595 5 111
AF-W0RSI0-F1-model_v4 Transcriptional regulator, PadR-family 0.9564 13 111

Map