F472307
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 647 | 245 | 1294 | 82 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0332276|Ga0453684_0332276_273_524 |
| Length | 78 |
| Sequence | MTTLERIAGFEDLPLDIEVELDRKIMTSLEKGSVIRLSRSAGENIDLLVGGKVIGFGEIVIIEDAVGVRITDFNVEAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 89 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 90 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 138 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 142 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 143 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 146 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 147 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 148 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 149 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 150 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 152 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 154 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 155 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 156 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 157 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 160 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 166 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 167 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 168 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 169 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 172 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 173 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 177 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 178 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 179 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 180 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 181 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 182 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 183 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 184 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 185 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 186 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 231 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 232 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 233 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 234 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 235 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 236 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 237 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 238 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0.31 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.85 |
| Rhizosphere | 96.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 49.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0453684_0332276 | 3300044712 | Bacteria | 1718 |
| 2 | Ga0070658_10092279 | 3300005327 | Bacteria | 2497 |
| 3 | Ga0070676_10955581 | 3300005328 | Unclassified | 641 |
| 4 | Ga0070683_100000007 | 3300005329 | Bacteria | 342155 |
| 5 | Ga0070683_100063503 | 3300005329 | Bacteria | 3435 |
| 6 | Ga0070683_100112919 | 3300005329 | Bacteria | 2564 |
| 7 | Ga0070683_100273264 | 3300005329 | Bacteria | 1607 |
| 8 | Ga0070683_100364528 | 3300005329 | Unclassified | 1376 |
| 9 | Ga0070683_100481423 | 3300005329 | Bacteria | 1185 |
| 10 | Ga0070683_101000147 | 3300005329 | Unclassified | 803 |
| 11 | Ga0070683_101834220 | 3300005329 | Unclassified | 583 |
| 12 | Ga0070683_102276778 | 3300005329 | Unclassified | 520 |
| 13 | Ga0070683_102284710 | 3300005329 | Bacteria | 519 |
| 14 | Ga0070677_10578586 | 3300005333 | Unclassified | 619 |
| 15 | Ga0068869_100376750 | 3300005334 | Bacteria | 1162 |
| 16 | Ga0068869_101015314 | 3300005334 | Unclassified | 723 |
| 17 | Ga0068869_101852169 | 3300005334 | Unclassified | 540 |
| 18 | Ga0070666_10505070 | 3300005335 | Bacteria | 877 |
| 19 | Ga0070666_11144958 | 3300005335 | Unclassified | 579 |
| 20 | Ga0070666_11229500 | 3300005335 | Unclassified | 558 |
| 21 | Ga0070666_11349833 | 3300005335 | Bacteria | 532 |
| 22 | Ga0070680_100401142 | 3300005336 | Unclassified | 1169 |
| 23 | Ga0070682_100919349 | 3300005337 | Unclassified | 720 |
| 24 | Ga0068868_100658359 | 3300005338 | Unclassified | 933 |
| 25 | Ga0070660_100244123 | 3300005339 | Unclassified | 1463 |
| 26 | Ga0070689_101510057 | 3300005340 | Unclassified | 609 |
| 27 | Ga0070689_101517137 | 3300005340 | Bacteria | 607 |
| 28 | Ga0070687_100505587 | 3300005343 | Unclassified | 814 |
| 29 | Ga0070674_100446375 | 3300005356 | Bacteria | 1067 |
| 30 | Ga0070674_101193359 | 3300005356 | Unclassified | 675 |
| 31 | Ga0070673_100039361 | 3300005364 | Bacteria | 3617 |
| 32 | Ga0070673_100196798 | 3300005364 | Bacteria | 1734 |
| 33 | Ga0070673_100251400 | 3300005364 | Bacteria | 1541 |
| 34 | Ga0070659_100318858 | 3300005366 | Bacteria | 1299 |
| 35 | Ga0070659_100969049 | 3300005366 | Unclassified | 745 |
| 36 | Ga0070667_100155814 | 3300005367 | Unclassified | 2009 |
| 37 | Ga0070667_101091105 | 3300005367 | Unclassified | 746 |
| 38 | Ga0070667_102196161 | 3300005367 | Unclassified | 520 |
| 39 | Ga0070709_10668543 | 3300005434 | Bacteria | 806 |
| 40 | Ga0070714_100003990 | 3300005435 | Bacteria | 11093 |
| 41 | Ga0070714_100959761 | 3300005435 | Unclassified | 831 |
| 42 | Ga0070714_101053773 | 3300005435 | Unclassified | 792 |
| 43 | Ga0070714_101103336 | 3300005435 | Unclassified | 773 |
| 44 | Ga0070713_100122032 | 3300005436 | Bacteria | 2287 |
| 45 | Ga0070713_100373983 | 3300005436 | Unclassified | 1326 |
| 46 | Ga0070713_100612351 | 3300005436 | Unclassified | 1035 |
| 47 | Ga0070713_100663878 | 3300005436 | Bacteria | 993 |
| 48 | Ga0070713_100840429 | 3300005436 | Unclassified | 881 |
| 49 | Ga0070713_100865086 | 3300005436 | Unclassified | 868 |
| 50 | Ga0070713_101349848 | 3300005436 | Unclassified | 691 |
| 51 | Ga0070711_100006421 | 3300005439 | Bacteria | 7093 |
| 52 | Ga0070711_101983337 | 3300005439 | Unclassified | 512 |
| 53 | Ga0070663_100552656 | 3300005455 | Bacteria | 962 |
| 54 | Ga0070678_100626379 | 3300005456 | Bacteria | 963 |
| 55 | Ga0070678_101643094 | 3300005456 | Bacteria | 604 |
| 56 | Ga0070681_10195488 | 3300005458 | Bacteria | 1942 |
| 57 | Ga0070681_10898379 | 3300005458 | Unclassified | 804 |
| 58 | Ga0070681_11259805 | 3300005458 | Unclassified | 662 |
| 59 | Ga0070681_11900194 | 3300005458 | Unclassified | 523 |
| 60 | Ga0068867_101938154 | 3300005459 | Unclassified | 556 |
| 61 | Ga0068867_102283739 | 3300005459 | Unclassified | 514 |
| 62 | Ga0070685_10688618 | 3300005466 | Unclassified | 744 |
| 63 | Ga0070699_100185656 | 3300005518 | Bacteria | 1846 |
| 64 | Ga0070679_100166068 | 3300005530 | Bacteria | 2181 |
| 65 | Ga0070679_101348595 | 3300005530 | Unclassified | 659 |
| 66 | Ga0070684_100000028 | 3300005535 | Bacteria | 117820 |
| 67 | Ga0070684_100206050 | 3300005535 | Bacteria | 1792 |
| 68 | Ga0070684_100273716 | 3300005535 | Bacteria | 1546 |
| 69 | Ga0070684_100297338 | 3300005535 | Unclassified | 1481 |
| 70 | Ga0070684_100914008 | 3300005535 | Bacteria | 822 |
| 71 | Ga0070684_101639341 | 3300005535 | Unclassified | 607 |
| 72 | Ga0070684_101912344 | 3300005535 | Unclassified | 560 |
| 73 | Ga0068853_100547339 | 3300005539 | Unclassified | 1096 |
| 74 | Ga0068853_100634323 | 3300005539 | Bacteria | 1016 |
| 75 | Ga0070686_101484699 | 3300005544 | Unclassified | 571 |
| 76 | Ga0070665_100135437 | 3300005548 | Bacteria | 2465 |
| 77 | Ga0070665_100264066 | 3300005548 | Bacteria | 1723 |
| 78 | Ga0070665_100544078 | 3300005548 | Bacteria | 1173 |
| 79 | Ga0070665_100713785 | 3300005548 | Bacteria | 1016 |
| 80 | Ga0070665_101191975 | 3300005548 | Unclassified | 772 |
| 81 | Ga0070665_102230713 | 3300005548 | Unclassified | 551 |
| 82 | Ga0068855_100067135 | 3300005563 | Bacteria | 4180 |
| 83 | Ga0068855_100098298 | 3300005563 | Bacteria | 3372 |
| 84 | Ga0068855_101101547 | 3300005563 | Unclassified | 830 |
| 85 | Ga0068855_101105124 | 3300005563 | Unclassified | 828 |
| 86 | Ga0070664_101530916 | 3300005564 | Bacteria | 631 |
| 87 | Ga0068857_101101660 | 3300005577 | Unclassified | 767 |
| 88 | Ga0068857_101198530 | 3300005577 | Unclassified | 735 |
| 89 | Ga0068854_101742223 | 3300005578 | Unclassified | 570 |
| 90 | Ga0068856_100846892 | 3300005614 | Unclassified | 933 |
| 91 | Ga0068856_100884683 | 3300005614 | Unclassified | 912 |
| 92 | Ga0068856_101497416 | 3300005614 | Unclassified | 689 |
| 93 | Ga0068856_102429255 | 3300005614 | Unclassified | 531 |
| 94 | Ga0068852_100043346 | 3300005616 | Unclassified | 3816 |
| 95 | Ga0068852_100127477 | 3300005616 | Bacteria | 2339 |
| 96 | Ga0068852_101796827 | 3300005616 | Unclassified | 635 |
| 97 | Ga0068859_100296471 | 3300005617 | Bacteria | 1710 |
| 98 | Ga0068859_100362631 | 3300005617 | Bacteria | 1544 |
| 99 | Ga0068859_100837895 | 3300005617 | Bacteria | 1006 |
| 100 | Ga0068864_100520449 | 3300005618 | Bacteria | 1147 |
| 101 | Ga0068864_100779947 | 3300005618 | Bacteria | 938 |
| 102 | Ga0068864_100875682 | 3300005618 | Bacteria | 886 |
| 103 | Ga0068866_10684046 | 3300005718 | Bacteria | 702 |
| 104 | Ga0068861_102535488 | 3300005719 | Unclassified | 516 |
| 105 | Ga0068870_10439930 | 3300005840 | Bacteria | 857 |
| 106 | Ga0068863_100050036 | 3300005841 | Bacteria | 3963 |
| 107 | Ga0068863_100195555 | 3300005841 | Bacteria | 1944 |
| 108 | Ga0068863_100809803 | 3300005841 | Unclassified | 934 |
| 109 | Ga0068863_101040908 | 3300005841 | Unclassified | 822 |
| 110 | Ga0068863_101429264 | 3300005841 | Bacteria | 700 |
| 111 | Ga0068858_100191012 | 3300005842 | Bacteria | 1935 |
| 112 | Ga0068858_100943042 | 3300005842 | Bacteria | 845 |
| 113 | Ga0068858_101717136 | 3300005842 | Unclassified | 620 |
| 114 | Ga0068860_100552353 | 3300005843 | Bacteria | 1154 |
| 115 | Ga0068860_100866374 | 3300005843 | Bacteria | 918 |
| 116 | Ga0068860_101424981 | 3300005843 | Bacteria | 714 |
| 117 | Ga0068860_101616907 | 3300005843 | Bacteria | 670 |
| 118 | Ga0068862_100314553 | 3300005844 | Unclassified | 1444 |
| 119 | Ga0068862_100490016 | 3300005844 | Bacteria | 1165 |
| 120 | Ga0068862_102084174 | 3300005844 | Unclassified | 578 |
| 121 | Ga0070717_10037751 | 3300006028 | Bacteria | 3924 |
| 122 | Ga0070717_10148308 | 3300006028 | Bacteria | 2028 |
| 123 | Ga0070717_10528976 | 3300006028 | Bacteria | 1067 |
| 124 | Ga0070717_10683894 | 3300006028 | Unclassified | 932 |
| 125 | Ga0070717_10746336 | 3300006028 | Unclassified | 890 |
| 126 | Ga0070716_100186953 | 3300006173 | Unclassified | 1365 |
| 127 | Ga0070716_101222640 | 3300006173 | Unclassified | 604 |
| 128 | Ga0070712_100807333 | 3300006175 | Unclassified | 805 |
| 129 | Ga0097621_100269339 | 3300006237 | Bacteria | 1496 |
| 130 | Ga0097621_100607866 | 3300006237 | Bacteria | 1000 |
| 131 | Ga0097621_101218604 | 3300006237 | Unclassified | 709 |
| 132 | Ga0097621_101276795 | 3300006237 | Unclassified | 693 |
| 133 | Ga0097621_101440369 | 3300006237 | Unclassified | 653 |
| 134 | Ga0068871_100390499 | 3300006358 | Bacteria | 1238 |
| 135 | Ga0068871_101316841 | 3300006358 | Unclassified | 680 |
| 136 | Ga0068871_101655795 | 3300006358 | Unclassified | 606 |
| 137 | Ga0068871_101791059 | 3300006358 | Unclassified | 583 |
| 138 | Ga0068871_101847882 | 3300006358 | Bacteria | 574 |
| 139 | Ga0068871_101974720 | 3300006358 | Unclassified | 555 |
| 140 | Ga0068871_102031989 | 3300006358 | Unclassified | 547 |
| 141 | Ga0075431_100084334 | 3300006847 | Bacteria | 3280 |
| 142 | Ga0075433_11896109 | 3300006852 | Unclassified | 511 |
| 143 | Ga0075434_101173051 | 3300006871 | Bacteria | 780 |
| 144 | Ga0075429_100749688 | 3300006880 | Unclassified | 855 |
| 145 | Ga0068865_101665484 | 3300006881 | Unclassified | 574 |
| 146 | Ga0068865_101684364 | 3300006881 | Bacteria | 571 |
| 147 | Ga0075436_100264810 | 3300006914 | Bacteria | 1226 |
| 148 | Ga0097620_100296467 | 3300006931 | Bacteria | 1710 |
| 149 | Ga0097620_100362631 | 3300006931 | Bacteria | 1544 |
| 150 | Ga0097620_100837884 | 3300006931 | Bacteria | 1006 |
| 151 | Ga0105240_10000788 | 3300009093 | Bacteria | 57440 |
| 152 | Ga0105240_10007638 | 3300009093 | Bacteria | 15662 |
| 153 | Ga0105240_10524973 | 3300009093 | Unclassified | 1313 |
| 154 | Ga0105240_10730091 | 3300009093 | Unclassified | 1078 |
| 155 | Ga0105240_10992701 | 3300009093 | Bacteria | 898 |
| 156 | Ga0111539_11614867 | 3300009094 | Bacteria | 752 |
| 157 | Ga0105245_11189811 | 3300009098 | Unclassified | 810 |
| 158 | Ga0105245_11370162 | 3300009098 | Unclassified | 757 |
| 159 | Ga0105245_12989646 | 3300009098 | Unclassified | 524 |
| 160 | Ga0105247_10317298 | 3300009101 | Unclassified | 1086 |
| 161 | Ga0114129_10142097 | 3300009147 | Bacteria | 3289 |
| 162 | Ga0114129_10490507 | 3300009147 | Bacteria | 1606 |
| 163 | Ga0105241_10463885 | 3300009174 | Unclassified | 1123 |
| 164 | Ga0105241_11533508 | 3300009174 | Unclassified | 642 |
| 165 | Ga0105241_11654683 | 3300009174 | Unclassified | 621 |
| 166 | Ga0105241_12312191 | 3300009174 | Unclassified | 535 |
| 167 | Ga0105242_11017569 | 3300009176 | Unclassified | 837 |
| 168 | Ga0105242_11795480 | 3300009176 | Unclassified | 651 |
| 169 | Ga0105248_10006372 | 3300009177 | Bacteria | 12949 |
| 170 | Ga0105248_10053351 | 3300009177 | Bacteria | 4537 |
| 171 | Ga0105248_10085337 | 3300009177 | Unclassified | 3553 |
| 172 | Ga0105248_10166357 | 3300009177 | Unclassified | 2486 |
| 173 | Ga0105248_10189170 | 3300009177 | Unclassified | 2319 |
| 174 | Ga0105248_10843622 | 3300009177 | Bacteria | 1034 |
| 175 | Ga0105248_10942483 | 3300009177 | Bacteria | 975 |
| 176 | Ga0105248_11146068 | 3300009177 | Unclassified | 879 |
| 177 | Ga0105248_12886267 | 3300009177 | Bacteria | 548 |
| 178 | Ga0105237_10008360 | 3300009545 | Bacteria | 11220 |
| 179 | Ga0105237_10262495 | 3300009545 | Bacteria | 1730 |
| 180 | Ga0105237_10568159 | 3300009545 | Bacteria | 1141 |
| 181 | Ga0105237_10652138 | 3300009545 | Unclassified | 1059 |
| 182 | Ga0105237_11452983 | 3300009545 | Bacteria | 692 |
| 183 | Ga0105237_11899243 | 3300009545 | Bacteria | 603 |
| 184 | Ga0105237_12161826 | 3300009545 | Bacteria | 566 |
| 185 | Ga0105238_10125669 | 3300009551 | Bacteria | 2543 |
| 186 | Ga0105238_10129477 | 3300009551 | Bacteria | 2502 |
| 187 | Ga0105238_10198190 | 3300009551 | Bacteria | 1983 |
| 188 | Ga0105238_10257920 | 3300009551 | Bacteria | 1723 |
| 189 | Ga0105238_10637768 | 3300009551 | Unclassified | 1075 |
| 190 | Ga0105238_10712656 | 3300009551 | Bacteria | 1016 |
| 191 | Ga0105238_12232314 | 3300009551 | Unclassified | 582 |
| 192 | Ga0105238_12625332 | 3300009551 | Unclassified | 540 |
| 193 | Ga0105249_10027304 | 3300009553 | Bacteria | 5151 |
| 194 | Ga0105249_10145396 | 3300009553 | Bacteria | 2277 |
| 195 | Ga0105249_11884186 | 3300009553 | Bacteria | 671 |
| 196 | Ga0105249_13286652 | 3300009553 | Unclassified | 520 |
| 197 | Ga0105239_10044211 | 3300010375 | Bacteria | 4883 |
| 198 | Ga0105239_10832859 | 3300010375 | Unclassified | 1058 |
| 199 | Ga0105239_11020102 | 3300010375 | Bacteria | 951 |
| 200 | Ga0105239_12093732 | 3300010375 | Bacteria | 657 |
| 201 | Ga0105239_12838533 | 3300010375 | Unclassified | 565 |
| 202 | Ga0105239_12843079 | 3300010375 | Unclassified | 565 |
| 203 | Ga0105246_10968566 | 3300011119 | Unclassified | 768 |
| 204 | Ga0105246_11563288 | 3300011119 | Unclassified | 622 |
| 205 | Ga0105246_12387756 | 3300011119 | Unclassified | 518 |
| 206 | Ga0157373_10222192 | 3300013100 | Unclassified | 1333 |
| 207 | Ga0157371_10697784 | 3300013102 | Unclassified | 760 |
| 208 | Ga0157370_10048316 | 3300013104 | Unclassified | 4076 |
| 209 | Ga0157370_10059029 | 3300013104 | Bacteria | 3646 |
| 210 | Ga0157370_10367913 | 3300013104 | Bacteria | 1325 |
| 211 | Ga0157370_10416763 | 3300013104 | Bacteria | 1236 |
| 212 | Ga0157370_10557258 | 3300013104 | Bacteria | 1050 |
| 213 | Ga0157369_10310228 | 3300013105 | Bacteria | 1641 |
| 214 | Ga0157369_10582866 | 3300013105 | Bacteria | 1155 |
| 215 | Ga0157369_10726377 | 3300013105 | Unclassified | 1022 |
| 216 | Ga0157369_10886167 | 3300013105 | Bacteria | 915 |
| 217 | Ga0157369_11479595 | 3300013105 | Unclassified | 691 |
| 218 | Ga0157369_12045534 | 3300013105 | Unclassified | 581 |
| 219 | Ga0157374_10624446 | 3300013296 | Bacteria | 1088 |
| 220 | Ga0157374_10757940 | 3300013296 | Unclassified | 985 |
| 221 | Ga0157374_11428044 | 3300013296 | Bacteria | 715 |
| 222 | Ga0157374_12113727 | 3300013296 | Unclassified | 590 |
| 223 | Ga0157374_12244463 | 3300013296 | Unclassified | 573 |
| 224 | Ga0157374_12523805 | 3300013296 | Unclassified | 541 |
| 225 | Ga0157378_11314666 | 3300013297 | Unclassified | 764 |
| 226 | Ga0157378_11547852 | 3300013297 | Bacteria | 708 |
| 227 | Ga0157378_11554739 | 3300013297 | Bacteria | 707 |
| 228 | Ga0157378_12181142 | 3300013297 | Unclassified | 605 |
| 229 | Ga0157378_12620469 | 3300013297 | Unclassified | 557 |
| 230 | Ga0163162_10097276 | 3300013306 | Bacteria | 3032 |
| 231 | Ga0163162_10412126 | 3300013306 | Bacteria | 1484 |
| 232 | Ga0163162_11251635 | 3300013306 | Unclassified | 843 |
| 233 | Ga0163162_12536829 | 3300013306 | Unclassified | 590 |
| 234 | Ga0163162_12556791 | 3300013306 | Unclassified | 587 |
| 235 | Ga0163162_13155883 | 3300013306 | Unclassified | 529 |
| 236 | Ga0163162_13295073 | 3300013306 | Bacteria | 517 |
| 237 | Ga0157372_10113610 | 3300013307 | Bacteria | 3104 |
| 238 | Ga0157372_10569300 | 3300013307 | Unclassified | 1320 |
| 239 | Ga0157372_10686466 | 3300013307 | Bacteria | 1192 |
| 240 | Ga0157372_11497433 | 3300013307 | Bacteria | 777 |
| 241 | Ga0157372_11693863 | 3300013307 | Unclassified | 727 |
| 242 | Ga0157372_11821438 | 3300013307 | Bacteria | 700 |
| 243 | Ga0157375_10223470 | 3300013308 | Bacteria | 2042 |
| 244 | Ga0157375_10521450 | 3300013308 | Bacteria | 1351 |
| 245 | Ga0157375_10988238 | 3300013308 | Bacteria | 982 |
| 246 | Ga0157375_11272916 | 3300013308 | Bacteria | 864 |
| 247 | Ga0157375_11466538 | 3300013308 | Bacteria | 805 |
| 248 | Ga0157375_11474089 | 3300013308 | Bacteria | 803 |
| 249 | Ga0157375_12132157 | 3300013308 | Unclassified | 667 |
| 250 | Ga0157375_12967794 | 3300013308 | Unclassified | 566 |
| 251 | Ga0157375_12997298 | 3300013308 | Unclassified | 564 |
| 252 | Ga0163163_10120532 | 3300014325 | Bacteria | 2657 |
| 253 | Ga0163163_10228715 | 3300014325 | Bacteria | 1909 |
| 254 | Ga0163163_10574187 | 3300014325 | Bacteria | 1191 |
| 255 | Ga0163163_11477783 | 3300014325 | Bacteria | 741 |
| 256 | Ga0163163_12073190 | 3300014325 | Unclassified | 628 |
| 257 | Ga0163163_12243123 | 3300014325 | Unclassified | 605 |
| 258 | Ga0163163_12352714 | 3300014325 | Bacteria | 591 |
| 259 | Ga0157380_11271582 | 3300014326 | Unclassified | 782 |
| 260 | Ga0157380_11791242 | 3300014326 | Unclassified | 673 |
| 261 | Ga0157380_11944868 | 3300014326 | Bacteria | 649 |
| 262 | Ga0157380_12711752 | 3300014326 | Bacteria | 562 |
| 263 | Ga0157377_10355329 | 3300014745 | Unclassified | 984 |
| 264 | Ga0157377_10784991 | 3300014745 | Bacteria | 701 |
| 265 | Ga0157377_11428781 | 3300014745 | Unclassified | 547 |
| 266 | Ga0157379_12518593 | 3300014968 | Unclassified | 515 |
| 267 | Ga0157379_12603958 | 3300014968 | Unclassified | 507 |
| 268 | Ga0157376_10018940 | 3300014969 | Bacteria | 5293 |
| 269 | Ga0157376_10473001 | 3300014969 | Unclassified | 1227 |
| 270 | Ga0157376_10821695 | 3300014969 | Unclassified | 943 |
| 271 | Ga0157376_11527485 | 3300014969 | Unclassified | 701 |
| 272 | Ga0163161_12111884 | 3300017792 | Unclassified | 501 |
| 273 | Ga0213876_10044400 | 3300021384 | Bacteria | 2349 |
| 274 | Ga0213875_10101501 | 3300021388 | Unclassified | 1343 |
| 275 | Ga0213875_10259277 | 3300021388 | Unclassified | 820 |
| 276 | Ga0207642_10470265 | 3300025899 | Unclassified | 765 |
| 277 | Ga0207688_10587587 | 3300025901 | Unclassified | 701 |
| 278 | Ga0207699_10189961 | 3300025906 | Bacteria | 1385 |
| 279 | Ga0207699_10942993 | 3300025906 | Unclassified | 637 |
| 280 | Ga0207699_11061542 | 3300025906 | Bacteria | 599 |
| 281 | Ga0207699_11153426 | 3300025906 | Unclassified | 574 |
| 282 | Ga0207705_10340843 | 3300025909 | Bacteria | 1154 |
| 283 | Ga0207654_10676876 | 3300025911 | Unclassified | 740 |
| 284 | Ga0207654_10958931 | 3300025911 | Unclassified | 621 |
| 285 | Ga0207707_10063867 | 3300025912 | Bacteria | 3204 |
| 286 | Ga0207707_11005881 | 3300025912 | Bacteria | 684 |
| 287 | Ga0207707_11630285 | 3300025912 | Unclassified | 507 |
| 288 | Ga0207695_10013146 | 3300025913 | Bacteria | 9882 |
| 289 | Ga0207695_10092375 | 3300025913 | Unclassified | 3037 |
| 290 | Ga0207695_10941925 | 3300025913 | Unclassified | 743 |
| 291 | Ga0207695_11691043 | 3300025913 | Unclassified | 514 |
| 292 | Ga0207695_11737755 | 3300025913 | Unclassified | 505 |
| 293 | Ga0207671_10006171 | 3300025914 | Bacteria | 10768 |
| 294 | Ga0207671_10424161 | 3300025914 | Bacteria | 1058 |
| 295 | Ga0207671_11050053 | 3300025914 | Bacteria | 641 |
| 296 | Ga0207693_11017836 | 3300025915 | Unclassified | 632 |
| 297 | Ga0207663_10082261 | 3300025916 | Unclassified | 2111 |
| 298 | Ga0207649_10238792 | 3300025920 | Bacteria | 1303 |
| 299 | Ga0207649_10670189 | 3300025920 | Bacteria | 803 |
| 300 | Ga0207652_10316729 | 3300025921 | Unclassified | 1408 |
| 301 | Ga0207652_11101406 | 3300025921 | Unclassified | 695 |
| 302 | Ga0207652_11300992 | 3300025921 | Unclassified | 630 |
| 303 | Ga0207652_11625328 | 3300025921 | Unclassified | 550 |
| 304 | Ga0207694_10111043 | 3300025924 | Bacteria | 2181 |
| 305 | Ga0207694_10435034 | 3300025924 | Unclassified | 1094 |
| 306 | Ga0207694_10903273 | 3300025924 | Unclassified | 747 |
| 307 | Ga0207694_11023165 | 3300025924 | Bacteria | 699 |
| 308 | Ga0207650_10168288 | 3300025925 | Bacteria | 1740 |
| 309 | Ga0207650_10606506 | 3300025925 | Unclassified | 921 |
| 310 | Ga0207659_11716718 | 3300025926 | Unclassified | 534 |
| 311 | Ga0207687_11751010 | 3300025927 | Unclassified | 532 |
| 312 | Ga0207700_10383958 | 3300025928 | Unclassified | 1229 |
| 313 | Ga0207700_10541617 | 3300025928 | Unclassified | 1032 |
| 314 | Ga0207700_10870995 | 3300025928 | Unclassified | 806 |
| 315 | Ga0207664_10002136 | 3300025929 | Bacteria | 13012 |
| 316 | Ga0207644_10030423 | 3300025931 | Bacteria | 3755 |
| 317 | Ga0207644_10955361 | 3300025931 | Bacteria | 719 |
| 318 | Ga0207690_10608303 | 3300025932 | Bacteria | 893 |
| 319 | Ga0207686_11052711 | 3300025934 | Unclassified | 662 |
| 320 | Ga0207686_11272127 | 3300025934 | Unclassified | 603 |
| 321 | Ga0207670_10682368 | 3300025936 | Unclassified | 849 |
| 322 | Ga0207670_11351911 | 3300025936 | Unclassified | 604 |
| 323 | Ga0207669_11579181 | 3300025937 | Unclassified | 560 |
| 324 | Ga0207704_11540993 | 3300025938 | Bacteria | 571 |
| 325 | Ga0207665_10237450 | 3300025939 | Unclassified | 1342 |
| 326 | Ga0207691_11215607 | 3300025940 | Bacteria | 624 |
| 327 | Ga0207711_10026153 | 3300025941 | Bacteria | 4895 |
| 328 | Ga0207711_10063648 | 3300025941 | Bacteria | 3184 |
| 329 | Ga0207711_10392487 | 3300025941 | Unclassified | 1289 |
| 330 | Ga0207711_10922620 | 3300025941 | Unclassified | 811 |
| 331 | Ga0207711_10928784 | 3300025941 | Unclassified | 809 |
| 332 | Ga0207711_11078306 | 3300025941 | Bacteria | 744 |
| 333 | Ga0207711_11633585 | 3300025941 | Bacteria | 588 |
| 334 | Ga0207689_11044138 | 3300025942 | Unclassified | 689 |
| 335 | Ga0207661_10000010 | 3300025944 | Bacteria | 375338 |
| 336 | Ga0207661_10044366 | 3300025944 | Unclassified | 3514 |
| 337 | Ga0207661_10084647 | 3300025944 | Bacteria | 2627 |
| 338 | Ga0207661_10129439 | 3300025944 | Bacteria | 2160 |
| 339 | Ga0207661_10156554 | 3300025944 | Bacteria | 1974 |
| 340 | Ga0207661_10625141 | 3300025944 | Unclassified | 989 |
| 341 | Ga0207661_10661229 | 3300025944 | Unclassified | 960 |
| 342 | Ga0207661_11716972 | 3300025944 | Unclassified | 573 |
| 343 | Ga0207679_11347226 | 3300025945 | Bacteria | 655 |
| 344 | Ga0207667_10078201 | 3300025949 | Bacteria | 3429 |
| 345 | Ga0207667_11184019 | 3300025949 | Unclassified | 744 |
| 346 | Ga0207651_10096654 | 3300025960 | Unclassified | 2179 |
| 347 | Ga0207651_10652200 | 3300025960 | Unclassified | 924 |
| 348 | Ga0207712_10060743 | 3300025961 | Bacteria | 2680 |
| 349 | Ga0207658_10223333 | 3300025986 | Unclassified | 1586 |
| 350 | Ga0207658_10741790 | 3300025986 | Unclassified | 889 |
| 351 | Ga0207658_11236864 | 3300025986 | Unclassified | 683 |
| 352 | Ga0207658_11625872 | 3300025986 | Unclassified | 591 |
| 353 | Ga0207658_11655972 | 3300025986 | Bacteria | 585 |
| 354 | Ga0207658_11708156 | 3300025986 | Unclassified | 575 |
| 355 | Ga0207677_10438053 | 3300026023 | Unclassified | 1117 |
| 356 | Ga0207703_10572969 | 3300026035 | Unclassified | 1066 |
| 357 | Ga0207703_11898135 | 3300026035 | Unclassified | 572 |
| 358 | Ga0207703_12246590 | 3300026035 | Unclassified | 521 |
| 359 | Ga0207639_10128550 | 3300026041 | Bacteria | 2094 |
| 360 | Ga0207639_10702321 | 3300026041 | Unclassified | 938 |
| 361 | Ga0207678_10117026 | 3300026067 | Unclassified | 2274 |
| 362 | Ga0207708_11361320 | 3300026075 | Unclassified | 622 |
| 363 | Ga0207702_10126783 | 3300026078 | Unclassified | 2293 |
| 364 | Ga0207702_10685799 | 3300026078 | Unclassified | 1009 |
| 365 | Ga0207702_10819017 | 3300026078 | Bacteria | 921 |
| 366 | Ga0207641_10048412 | 3300026088 | Bacteria | 3588 |
| 367 | Ga0207641_10213318 | 3300026088 | Bacteria | 1786 |
| 368 | Ga0207641_12134220 | 3300026088 | Unclassified | 561 |
| 369 | Ga0207641_12275952 | 3300026088 | Bacteria | 542 |
| 370 | Ga0207648_10699346 | 3300026089 | Unclassified | 939 |
| 371 | Ga0207648_11102802 | 3300026089 | Unclassified | 744 |
| 372 | Ga0207648_12067908 | 3300026089 | Unclassified | 531 |
| 373 | Ga0207676_10210383 | 3300026095 | Bacteria | 1725 |
| 374 | Ga0207676_10349643 | 3300026095 | Unclassified | 1367 |
| 375 | Ga0207676_11658753 | 3300026095 | Bacteria | 637 |
| 376 | Ga0207674_11762372 | 3300026116 | Bacteria | 587 |
| 377 | Ga0207675_101844797 | 3300026118 | Bacteria | 623 |
| 378 | Ga0207683_10774433 | 3300026121 | Unclassified | 890 |
| 379 | Ga0207683_10879631 | 3300026121 | Unclassified | 832 |
| 380 | Ga0207683_12005123 | 3300026121 | Unclassified | 527 |
| 381 | Ga0207698_10893037 | 3300026142 | Bacteria | 895 |
| 382 | Ga0207698_11562977 | 3300026142 | Unclassified | 675 |
| 383 | Ga0207698_11581166 | 3300026142 | Bacteria | 671 |
| 384 | Ga0207428_11145540 | 3300027907 | Unclassified | 542 |
| 385 | Ga0268266_10431087 | 3300028379 | Bacteria | 1251 |
| 386 | Ga0268266_10460655 | 3300028379 | Unclassified | 1210 |
| 387 | Ga0268266_10544412 | 3300028379 | Bacteria | 1112 |
| 388 | Ga0268266_10592797 | 3300028379 | Bacteria | 1064 |
| 389 | Ga0268266_10967536 | 3300028379 | Unclassified | 824 |
| 390 | Ga0268266_11157115 | 3300028379 | Unclassified | 748 |
| 391 | Ga0268266_12254733 | 3300028379 | Unclassified | 516 |
| 392 | Ga0268265_10548497 | 3300028380 | Bacteria | 1097 |
| 393 | Ga0268265_11033578 | 3300028380 | Bacteria | 813 |
| 394 | Ga0268265_11995382 | 3300028380 | Unclassified | 587 |
| 395 | Ga0268264_11002879 | 3300028381 | Unclassified | 842 |
| 396 | Ga0268264_11559771 | 3300028381 | Bacteria | 671 |
| 397 | Ga0265323_10005587 | 3300028653 | Bacteria | 5335 |
| 398 | Ga0265323_10261343 | 3300028653 | Bacteria | 538 |
| 399 | Ga0265338_10439675 | 3300028800 | Bacteria | 925 |
| 400 | Ga0265338_11015929 | 3300028800 | Unclassified | 561 |
| 401 | Ga0265762_1067991 | 3300030760 | Unclassified | 743 |
| 402 | Ga0265770_1049992 | 3300030878 | Bacteria | 754 |
| 403 | Ga0265330_10379975 | 3300031235 | Bacteria | 597 |
| 404 | Ga0265325_10207622 | 3300031241 | Bacteria | 901 |
| 405 | Ga0265329_10309661 | 3300031242 | Unclassified | 535 |
| 406 | Ga0265329_10322959 | 3300031242 | Unclassified | 525 |
| 407 | Ga0265331_10043197 | 3300031250 | Unclassified | 2184 |
| 408 | Ga0265331_10077457 | 3300031250 | Bacteria | 1549 |
| 409 | Ga0265331_10194587 | 3300031250 | Unclassified | 914 |
| 410 | Ga0265316_10004540 | 3300031344 | Bacteria | 13796 |
| 411 | Ga0265316_10081778 | 3300031344 | Bacteria | 2476 |
| 412 | Ga0265316_10126153 | 3300031344 | Bacteria | 1930 |
| 413 | Ga0265316_10166490 | 3300031344 | Bacteria | 1646 |
| 414 | Ga0265316_10205343 | 3300031344 | Bacteria | 1459 |
| 415 | Ga0265316_10271128 | 3300031344 | Bacteria | 1242 |
| 416 | Ga0265316_10342774 | 3300031344 | Bacteria | 1083 |
| 417 | Ga0265316_10506192 | 3300031344 | Bacteria | 862 |
| 418 | Ga0265316_11156764 | 3300031344 | Unclassified | 536 |
| 419 | Ga0265313_10226113 | 3300031595 | Unclassified | 770 |
| 420 | Ga0307508_10556022 | 3300031616 | Unclassified | 746 |
| 421 | Ga0265314_10013424 | 3300031711 | Bacteria | 6616 |
| 422 | Ga0265314_10070164 | 3300031711 | Bacteria | 2349 |
| 423 | Ga0265342_10357405 | 3300031712 | Unclassified | 760 |
| 424 | Ga0265342_10373134 | 3300031712 | Unclassified | 740 |
| 425 | Ga0373926_0011971 | 3300035083 | Unclassified | 2928 |
| 426 | Ga0373926_0452674 | 3300035083 | Unclassified | 509 |
| 427 | Ga0373926_0457787 | 3300035083 | Unclassified | 507 |
| 428 | Ga0373934_0032185 | 3300035086 | Unclassified | 2056 |
| 429 | Ga0373934_0427870 | 3300035086 | Unclassified | 554 |
| 430 | Ga0373944_0401135 | 3300035089 | Bacteria | 529 |
| 431 | Ga0373923_0028901 | 3300035111 | Bacteria | 2220 |
| 432 | Ga0373923_0475347 | 3300035111 | Bacteria | 608 |
| 433 | Ga0373923_0657490 | 3300035111 | Unclassified | 519 |
| 434 | Ga0373932_0124729 | 3300035112 | Bacteria | 862 |
| 435 | Ga0373932_0197221 | 3300035112 | Unclassified | 714 |
| 436 | Ga0373936_0411074 | 3300035113 | Bacteria | 622 |
| 437 | Ga0373941_0332156 | 3300035115 | Bacteria | 614 |
| 438 | Ga0373953_0021893 | 3300035117 | Bacteria | 2404 |
| 439 | Ga0373953_0145775 | 3300035117 | Bacteria | 1014 |
| 440 | Ga0373953_0320624 | 3300035117 | Unclassified | 677 |
| 441 | Ga0373954_0078691 | 3300035118 | Bacteria | 1573 |
| 442 | Ga0373954_0626142 | 3300035118 | Bacteria | 533 |
| 443 | Ga0373956_0258738 | 3300035119 | Bacteria | 828 |
| 444 | Ga0373960_0150892 | 3300035121 | Unclassified | 794 |
| 445 | Ga0373943_0039997 | 3300035170 | Unclassified | 2262 |
| 446 | Ga0373943_0133435 | 3300035170 | Unclassified | 1331 |
| 447 | Ga0373943_0185372 | 3300035170 | Bacteria | 1146 |
| 448 | Ga0373943_0262931 | 3300035170 | Bacteria | 972 |
| 449 | Ga0373946_0292853 | 3300035171 | Bacteria | 803 |
| 450 | Ga0373955_0550639 | 3300035172 | Bacteria | 706 |
| 451 | Ga0373924_0200628 | 3300035410 | Unclassified | 880 |
| 452 | Ga0373924_0481952 | 3300035410 | Unclassified | 557 |
| 453 | Ga0373931_0477737 | 3300035691 | Unclassified | 801 |
| 454 | Ga0373935_0015720 | 3300035692 | Bacteria | 4577 |
| 455 | Ga0373935_0198623 | 3300035692 | Unclassified | 1385 |
| 456 | Ga0373935_0470263 | 3300035692 | Unclassified | 910 |
| 457 | Ga0373935_0958190 | 3300035692 | Bacteria | 635 |
| 458 | Ga0373927_0001372 | 3300035695 | Bacteria | 18341 |
| 459 | Ga0373927_0003200 | 3300035695 | Bacteria | 11797 |
| 460 | Ga0373927_0102501 | 3300035695 | Unclassified | 1862 |
| 461 | Ga0373927_0602541 | 3300035695 | Bacteria | 726 |
| 462 | Ga0373927_0930953 | 3300035695 | Unclassified | 573 |
| 463 | Ga0373933_0372846 | 3300035724 | Unclassified | 929 |
| 464 | Ga0373933_1065480 | 3300035724 | Unclassified | 532 |
| 465 | Ga0373947_0004278 | 3300035725 | Bacteria | 8382 |
| 466 | Ga0373947_0076866 | 3300035725 | Bacteria | 2058 |
| 467 | Ga0373947_0334148 | 3300035725 | Bacteria | 1015 |
| 468 | Ga0373947_0490827 | 3300035725 | Unclassified | 834 |
| 469 | Ga0373937_0026653 | 3300036401 | Bacteria | 5222 |
| 470 | Ga0373937_0063027 | 3300036401 | Bacteria | 3409 |
| 471 | Ga0373937_0110702 | 3300036401 | Bacteria | 2554 |
| 472 | Ga0373937_0189245 | 3300036401 | Unclassified | 1934 |
| 473 | Ga0373937_0196527 | 3300036401 | Bacteria | 1896 |
| 474 | Ga0373937_0227464 | 3300036401 | Bacteria | 1756 |
| 475 | Ga0373937_0459754 | 3300036401 | Bacteria | 1209 |
| 476 | Ga0373925_0000097 | 3300037068 | Bacteria | 94132 |
| 477 | Ga0373925_0016758 | 3300037068 | Bacteria | 5307 |
| 478 | Ga0373925_0508948 | 3300037068 | Unclassified | 989 |
| 479 | Ga0373925_0590772 | 3300037068 | Unclassified | 914 |
| 480 | Ga0373925_1037903 | 3300037068 | Bacteria | 675 |
| 481 | Ga0395900_1177766 | 3300037418 | Unclassified | 682 |
| 482 | Ga0395898_0129390 | 3300037466 | Bacteria | 2419 |
| 483 | Ga0436364_0749391 | 3300037853 | Bacteria | 2584 |
| 484 | Ga0436364_0946379 | 3300037853 | Bacteria | 3040 |
| 485 | Ga0436364_1502563 | 3300037853 | Bacteria | 705 |
| 486 | Ga0395901_0848024 | 3300038443 | Unclassified | 899 |
| 487 | Ga0436365_0231085 | 3300039437 | Bacteria | 5242 |
| 488 | Ga0436365_1144685 | 3300039437 | Unclassified | 4461 |
| 489 | Ga0451787_427022 | 3300041441 | Unclassified | 535 |
| 490 | Ga0451577_0852745 | 3300042876 | Bacteria | 822 |
| 491 | Ga0453684_0472617 | 3300044712 | Unclassified | 1392 |
| 492 | Ga0466959_0204016 | 3300045049 | Unclassified | 1376 |
| 493 | Ga0451576_0734549 | 3300045051 | Bacteria | 1037 |
| 494 | Ga0451576_1040482 | 3300045051 | Bacteria | 858 |
| 495 | Ga0451576_1973331 | 3300045051 | Unclassified | 601 |
| 496 | Ga0466958_0792033 | 3300045836 | Unclassified | 618 |
| 497 | Ga0495592_0012115 | 3300046454 | Bacteria | 6542 |
| 498 | Ga0495603_0891094 | 3300046455 | Bacteria | 506 |
| 499 | Ga0495629_0333156 | 3300046459 | Unclassified | 1037 |
| 500 | Ga0495629_0507956 | 3300046459 | Unclassified | 812 |
| 501 | Ga0495651_0007679 | 3300046462 | Bacteria | 8246 |
| 502 | Ga0495651_0061399 | 3300046462 | Bacteria | 2877 |
| 503 | Ga0495651_0126323 | 3300046462 | Unclassified | 1872 |
| 504 | Ga0495651_0140364 | 3300046462 | Bacteria | 1753 |
| 505 | Ga0495653_0209592 | 3300046463 | Bacteria | 1317 |
| 506 | Ga0495653_0282257 | 3300046463 | Bacteria | 1089 |
| 507 | Ga0495653_0383352 | 3300046463 | Unclassified | 897 |
| 508 | Ga0495653_0403455 | 3300046463 | Unclassified | 868 |
| 509 | Ga0495580_0000132 | 3300046472 | Bacteria | 52529 |
| 510 | Ga0495580_0003752 | 3300046472 | Bacteria | 12863 |
| 511 | Ga0495580_0113660 | 3300046472 | Bacteria | 1881 |
| 512 | Ga0495580_0246274 | 3300046472 | Unclassified | 1224 |
| 513 | Ga0495580_0321994 | 3300046472 | Unclassified | 1051 |
| 514 | Ga0495582_0240588 | 3300046473 | Unclassified | 1037 |
| 515 | Ga0495582_0379313 | 3300046473 | Unclassified | 815 |
| 516 | Ga0495639_0316956 | 3300046475 | Unclassified | 779 |
| 517 | Ga0495639_0473957 | 3300046475 | Unclassified | 637 |
| 518 | Ga0495662_0006722 | 3300046476 | Bacteria | 5730 |
| 519 | Ga0495662_0061880 | 3300046476 | Bacteria | 1809 |
| 520 | Ga0495662_0209409 | 3300046476 | Bacteria | 961 |
| 521 | Ga0495664_0005554 | 3300046477 | Bacteria | 6932 |
| 522 | Ga0495664_0017294 | 3300046477 | Bacteria | 4120 |
| 523 | Ga0495664_0572946 | 3300046477 | Bacteria | 672 |
| 524 | Ga0495594_0292404 | 3300046499 | Unclassified | 928 |
| 525 | Ga0495608_0094352 | 3300046511 | Bacteria | 1933 |
| 526 | Ga0495608_0527453 | 3300046511 | Unclassified | 713 |
| 527 | Ga0495628_0398606 | 3300046516 | Unclassified | 1005 |
| 528 | Ga0495628_0774402 | 3300046516 | Unclassified | 673 |
| 529 | Ga0495630_0182045 | 3300046517 | Bacteria | 1602 |
| 530 | Ga0495630_0254453 | 3300046517 | Bacteria | 1342 |
| 531 | Ga0495630_1423418 | 3300046517 | Unclassified | 521 |
| 532 | Ga0495642_0143623 | 3300046528 | Unclassified | 1031 |
| 533 | Ga0495652_0070499 | 3300046529 | Bacteria | 2921 |
| 534 | Ga0495652_0290749 | 3300046529 | Unclassified | 1192 |
| 535 | Ga0495652_0310783 | 3300046529 | Bacteria | 1142 |
| 536 | Ga0495652_0705402 | 3300046529 | Unclassified | 679 |
| 537 | Ga0495652_0791444 | 3300046529 | Bacteria | 632 |
| 538 | Ga0495665_0040345 | 3300046531 | Bacteria | 2486 |
| 539 | Ga0495665_0121273 | 3300046531 | Bacteria | 1369 |
| 540 | Ga0495665_0142718 | 3300046531 | Unclassified | 1251 |
| 541 | Ga0495665_0399536 | 3300046531 | Unclassified | 697 |
| 542 | Ga0495665_0553897 | 3300046531 | Bacteria | 577 |
| 543 | Ga0495640_0035052 | 3300046533 | Bacteria | 3554 |
| 544 | Ga0495640_0227845 | 3300046533 | Unclassified | 1173 |
| 545 | Ga0495640_0414923 | 3300046533 | Bacteria | 825 |
| 546 | Ga0495640_0615267 | 3300046533 | Unclassified | 655 |
| 547 | Ga0495586_0221773 | 3300046535 | Bacteria | 1075 |
| 548 | Ga0495586_0892201 | 3300046535 | Unclassified | 512 |
| 549 | Ga0495587_0028243 | 3300046536 | Bacteria | 3412 |
| 550 | Ga0495587_0040136 | 3300046536 | Bacteria | 2799 |
| 551 | Ga0495587_0435273 | 3300046536 | Unclassified | 727 |
| 552 | Ga0495587_0651993 | 3300046536 | Unclassified | 578 |
| 553 | Ga0495587_0664976 | 3300046536 | Unclassified | 572 |
| 554 | Ga0495621_0130932 | 3300046539 | Bacteria | 976 |
| 555 | Ga0495645_0003793 | 3300046543 | Bacteria | 10275 |
| 556 | Ga0495645_0006550 | 3300046543 | Bacteria | 8089 |
| 557 | Ga0495645_0193711 | 3300046543 | Bacteria | 1383 |
| 558 | Ga0495667_0011261 | 3300046559 | Bacteria | 6053 |
| 559 | Ga0495667_0017131 | 3300046559 | Bacteria | 4893 |
| 560 | Ga0495667_0115924 | 3300046559 | Unclassified | 1731 |
| 561 | Ga0495667_0293877 | 3300046559 | Bacteria | 1030 |
| 562 | Ga0495634_0013446 | 3300046642 | Bacteria | 5914 |
| 563 | Ga0495635_0010852 | 3300046663 | Bacteria | 6383 |
| 564 | Ga0495635_0114380 | 3300046663 | Bacteria | 1842 |
| 565 | Ga0495635_0287800 | 3300046663 | Unclassified | 1103 |
| 566 | Ga0495635_0625746 | 3300046663 | Unclassified | 701 |
| 567 | Ga0495635_0712962 | 3300046663 | Unclassified | 650 |
| 568 | Ga0495659_0285969 | 3300046664 | Unclassified | 694 |
| 569 | Ga0495657_0109425 | 3300046675 | Bacteria | 1752 |
| 570 | Ga0495657_0197520 | 3300046675 | Unclassified | 1227 |
| 571 | Ga0495657_0496106 | 3300046675 | Unclassified | 712 |
| 572 | Ga0495599_0002828 | 3300046678 | Bacteria | 10110 |
| 573 | Ga0495599_0376574 | 3300046678 | Unclassified | 848 |
| 574 | Ga0495623_0015318 | 3300046679 | Bacteria | 4955 |
| 575 | Ga0495623_0048904 | 3300046679 | Bacteria | 2680 |
| 576 | Ga0495623_0075642 | 3300046679 | Bacteria | 2090 |
| 577 | Ga0495623_0170902 | 3300046679 | Bacteria | 1270 |
| 578 | Ga0495623_0469048 | 3300046679 | Unclassified | 668 |
| 579 | Ga0495646_0026430 | 3300046680 | Bacteria | 3646 |
| 580 | Ga0495646_0411771 | 3300046680 | Bacteria | 702 |
| 581 | Ga0495669_0060538 | 3300046684 | Unclassified | 1712 |
| 582 | Ga0495613_0030300 | 3300046689 | Bacteria | 4019 |
| 583 | Ga0495613_0140504 | 3300046689 | Bacteria | 1725 |
| 584 | Ga0495613_0191760 | 3300046689 | Bacteria | 1444 |
| 585 | Ga0495600_0034467 | 3300046809 | Unclassified | 3286 |
| 586 | Ga0495600_0290479 | 3300046809 | Bacteria | 1033 |
| 587 | Ga0495600_0528100 | 3300046809 | Unclassified | 723 |
| 588 | Ga0495581_0175242 | 3300047315 | Unclassified | 1254 |
| 589 | Ga0495604_0054122 | 3300047317 | Bacteria | 3098 |
| 590 | Ga0495604_0228537 | 3300047317 | Unclassified | 1277 |
| 591 | Ga0495604_0279478 | 3300047317 | Unclassified | 1128 |
| 592 | Ga0495604_0580487 | 3300047317 | Unclassified | 720 |
| 593 | Ga0495604_0688737 | 3300047317 | Unclassified | 650 |
| 594 | Ga0495674_0031826 | 3300047319 | Bacteria | 4787 |
| 595 | Ga0495674_0035809 | 3300047319 | Unclassified | 4474 |
| 596 | Ga0495674_0128892 | 3300047319 | Bacteria | 2132 |
| 597 | Ga0495674_0289781 | 3300047319 | Bacteria | 1339 |
| 598 | Ga0495674_0355422 | 3300047319 | Unclassified | 1189 |
| 599 | Ga0495674_0808557 | 3300047319 | Unclassified | 729 |
| 600 | Ga0495674_1284208 | 3300047319 | Unclassified | 550 |
| 601 | Ga0495676_0265014 | 3300047321 | Unclassified | 1168 |
| 602 | Ga0495680_0021789 | 3300047322 | Bacteria | 5356 |
| 603 | Ga0495680_0369677 | 3300047322 | Unclassified | 995 |
| 604 | Ga0495680_0377350 | 3300047322 | Bacteria | 983 |
| 605 | Ga0495675_0030243 | 3300047444 | Bacteria | 3456 |
| 606 | Ga0495675_0055531 | 3300047444 | Unclassified | 2512 |
| 607 | Ga0495675_0096687 | 3300047444 | Bacteria | 1851 |
| 608 | Ga0495675_0177763 | 3300047444 | Unclassified | 1304 |
| 609 | Ga0495675_0344558 | 3300047444 | Unclassified | 877 |
| 610 | Ga0495684_0003399 | 3300047471 | Bacteria | 12487 |
| 611 | Ga0495684_0035212 | 3300047471 | Bacteria | 3840 |
| 612 | Ga0495684_0036949 | 3300047471 | Bacteria | 3744 |
| 613 | Ga0495684_0052008 | 3300047471 | Bacteria | 3126 |
| 614 | Ga0495684_0073401 | 3300047471 | Bacteria | 2599 |
| 615 | Ga0495684_0331506 | 3300047471 | Unclassified | 1085 |
| 616 | Ga0495684_0380722 | 3300047471 | Bacteria | 995 |
| 617 | Ga0495593_0348308 | 3300047673 | Unclassified | 740 |
| 618 | Ga0495602_0014264 | 3300048088 | Bacteria | 8073 |
| 619 | Ga0495602_0062196 | 3300048088 | Bacteria | 3240 |
| 620 | Ga0495602_0158232 | 3300048088 | Bacteria | 1772 |
| 621 | Ga0495602_0400491 | 3300048088 | Unclassified | 979 |
| 622 | Ga0495602_0660093 | 3300048088 | Bacteria | 713 |
| 623 | Ga0495602_0667201 | 3300048088 | Unclassified | 709 |
| 624 | Ga0495602_0709269 | 3300048088 | Bacteria | 682 |
| 625 | Ga0495614_0217268 | 3300048089 | Unclassified | 868 |
| 626 | Ga0496101_0605331 | 3300048904 | Unclassified | 866 |
| 627 | Ga0496101_1398149 | 3300048904 | Bacteria | 546 |
| 628 | Ga0496102_0796013 | 3300048905 | Bacteria | 868 |
| 629 | Ga0496104_1600578 | 3300048907 | Unclassified | 554 |
| 630 | Ga0496104_1606723 | 3300048907 | Unclassified | 553 |
| 631 | Ga0496105_0519576 | 3300048908 | Bacteria | 933 |
| 632 | Ga0496106_0595429 | 3300048909 | Unclassified | 886 |
| 633 | Ga0496111_0983002 | 3300048914 | Bacteria | 605 |
| 634 | Ga0496112_0983576 | 3300048915 | Bacteria | 764 |
| 635 | Ga0496114_1154375 | 3300048917 | Unclassified | 660 |
| 636 | Ga0496115_0179396 | 3300048918 | Bacteria | 1751 |
| 637 | nmdc:mga05p37_113979_c1 | 3300050507 | Bacteria | 3323 |
| 638 | nmdc:mga05p37_786713_c1 | 3300050507 | Bacteria | 1043 |
| 639 | nmdc:mga09592_556898_c1 | 3300050508 | Unclassified | 984 |
| 640 | nmdc:mga09592_677782_c1 | 3300050508 | Bacteria | 879 |
| 641 | nmdc:mga06r32_24497_c1 | 3300050510 | Bacteria | 5602 |
| 642 | nmdc:mga0n895_1059014_c1 | 3300050512 | Bacteria | 790 |
| 643 | nmdc:mga0n895_2093566_c1 | 3300050512 | Unclassified | 522 |
| 644 | nmdc:mga08x19_98273_c1 | 3300050514 | Unclassified | 1939 |
| 645 | nmdc:mga0a205_1439376_c1 | 3300050515 | Bacteria | 537 |
| 646 | Ga0495612_0301303 | 3300053078 | Bacteria | 719 |
| 647 | Ga0501082_0000067 | 3300060353 | Bacteria | 74904 |
| 648 | Ga0453684_0332276 | |||
| 649 | Ga0070658_10092279 | |||
| 650 | Ga0070676_10955581 | |||
| 651 | Ga0070683_100000007 | |||
| 652 | Ga0070683_100063503 | |||
| 653 | Ga0070683_100112919 | |||
| 654 | Ga0070683_100273264 | |||
| 655 | Ga0070683_100364528 | |||
| 656 | Ga0070683_100481423 | |||
| 657 | Ga0070683_101000147 | |||
| 658 | Ga0070683_101834220 | |||
| 659 | Ga0070683_102276778 | |||
| 660 | Ga0070683_102284710 | |||
| 661 | Ga0070677_10578586 | |||
| 662 | Ga0068869_100376750 | |||
| 663 | Ga0068869_101015314 | |||
| 664 | Ga0068869_101852169 | |||
| 665 | Ga0070666_10505070 | |||
| 666 | Ga0070666_11144958 | |||
| 667 | Ga0070666_11229500 | |||
| 668 | Ga0070666_11349833 | |||
| 669 | Ga0070680_100401142 | |||
| 670 | Ga0070682_100919349 | |||
| 671 | Ga0068868_100658359 | |||
| 672 | Ga0070660_100244123 | |||
| 673 | Ga0070689_101510057 | |||
| 674 | Ga0070689_101517137 | |||
| 675 | Ga0070687_100505587 | |||
| 676 | Ga0070674_100446375 | |||
| 677 | Ga0070674_101193359 | |||
| 678 | Ga0070673_100039361 | |||
| 679 | Ga0070673_100196798 | |||
| 680 | Ga0070673_100251400 | |||
| 681 | Ga0070659_100318858 | |||
| 682 | Ga0070659_100969049 | |||
| 683 | Ga0070667_100155814 | |||
| 684 | Ga0070667_101091105 | |||
| 685 | Ga0070667_102196161 | |||
| 686 | Ga0070709_10668543 | |||
| 687 | Ga0070714_100003990 | |||
| 688 | Ga0070714_100959761 | |||
| 689 | Ga0070714_101053773 | |||
| 690 | Ga0070714_101103336 | |||
| 691 | Ga0070713_100122032 | |||
| 692 | Ga0070713_100373983 | |||
| 693 | Ga0070713_100612351 | |||
| 694 | Ga0070713_100663878 | |||
| 695 | Ga0070713_100840429 | |||
| 696 | Ga0070713_100865086 | |||
| 697 | Ga0070713_101349848 | |||
| 698 | Ga0070711_100006421 | |||
| 699 | Ga0070711_101983337 | |||
| 700 | Ga0070663_100552656 | |||
| 701 | Ga0070678_100626379 | |||
| 702 | Ga0070678_101643094 | |||
| 703 | Ga0070681_10195488 | |||
| 704 | Ga0070681_10898379 | |||
| 705 | Ga0070681_11259805 | |||
| 706 | Ga0070681_11900194 | |||
| 707 | Ga0068867_101938154 | |||
| 708 | Ga0068867_102283739 | |||
| 709 | Ga0070685_10688618 | |||
| 710 | Ga0070699_100185656 | |||
| 711 | Ga0070679_100166068 | |||
| 712 | Ga0070679_101348595 | |||
| 713 | Ga0070684_100000028 | |||
| 714 | Ga0070684_100206050 | |||
| 715 | Ga0070684_100273716 | |||
| 716 | Ga0070684_100297338 | |||
| 717 | Ga0070684_100914008 | |||
| 718 | Ga0070684_101639341 | |||
| 719 | Ga0070684_101912344 | |||
| 720 | Ga0068853_100547339 | |||
| 721 | Ga0068853_100634323 | |||
| 722 | Ga0070686_101484699 | |||
| 723 | Ga0070665_100135437 | |||
| 724 | Ga0070665_100264066 | |||
| 725 | Ga0070665_100544078 | |||
| 726 | Ga0070665_100713785 | |||
| 727 | Ga0070665_101191975 | |||
| 728 | Ga0070665_102230713 | |||
| 729 | Ga0068855_100067135 | |||
| 730 | Ga0068855_100098298 | |||
| 731 | Ga0068855_101101547 | |||
| 732 | Ga0068855_101105124 | |||
| 733 | Ga0070664_101530916 | |||
| 734 | Ga0068857_101101660 | |||
| 735 | Ga0068857_101198530 | |||
| 736 | Ga0068854_101742223 | |||
| 737 | Ga0068856_100846892 | |||
| 738 | Ga0068856_100884683 | |||
| 739 | Ga0068856_101497416 | |||
| 740 | Ga0068856_102429255 | |||
| 741 | Ga0068852_100043346 | |||
| 742 | Ga0068852_100127477 | |||
| 743 | Ga0068852_101796827 | |||
| 744 | Ga0068859_100296471 | |||
| 745 | Ga0068859_100362631 | |||
| 746 | Ga0068859_100837895 | |||
| 747 | Ga0068864_100520449 | |||
| 748 | Ga0068864_100779947 | |||
| 749 | Ga0068864_100875682 | |||
| 750 | Ga0068866_10684046 | |||
| 751 | Ga0068861_102535488 | |||
| 752 | Ga0068870_10439930 | |||
| 753 | Ga0068863_100050036 | |||
| 754 | Ga0068863_100195555 | |||
| 755 | Ga0068863_100809803 | |||
| 756 | Ga0068863_101040908 | |||
| 757 | Ga0068863_101429264 | |||
| 758 | Ga0068858_100191012 | |||
| 759 | Ga0068858_100943042 | |||
| 760 | Ga0068858_101717136 | |||
| 761 | Ga0068860_100552353 | |||
| 762 | Ga0068860_100866374 | |||
| 763 | Ga0068860_101424981 | |||
| 764 | Ga0068860_101616907 | |||
| 765 | Ga0068862_100314553 | |||
| 766 | Ga0068862_100490016 | |||
| 767 | Ga0068862_102084174 | |||
| 768 | Ga0070717_10037751 | |||
| 769 | Ga0070717_10148308 | |||
| 770 | Ga0070717_10528976 | |||
| 771 | Ga0070717_10683894 | |||
| 772 | Ga0070717_10746336 | |||
| 773 | Ga0070716_100186953 | |||
| 774 | Ga0070716_101222640 | |||
| 775 | Ga0070712_100807333 | |||
| 776 | Ga0097621_100269339 | |||
| 777 | Ga0097621_100607866 | |||
| 778 | Ga0097621_101218604 | |||
| 779 | Ga0097621_101276795 | |||
| 780 | Ga0097621_101440369 | |||
| 781 | Ga0068871_100390499 | |||
| 782 | Ga0068871_101316841 | |||
| 783 | Ga0068871_101655795 | |||
| 784 | Ga0068871_101791059 | |||
| 785 | Ga0068871_101847882 | |||
| 786 | Ga0068871_101974720 | |||
| 787 | Ga0068871_102031989 | |||
| 788 | Ga0075431_100084334 | |||
| 789 | Ga0075433_11896109 | |||
| 790 | Ga0075434_101173051 | |||
| 791 | Ga0075429_100749688 | |||
| 792 | Ga0068865_101665484 | |||
| 793 | Ga0068865_101684364 | |||
| 794 | Ga0075436_100264810 | |||
| 795 | Ga0097620_100296467 | |||
| 796 | Ga0097620_100362631 | |||
| 797 | Ga0097620_100837884 | |||
| 798 | Ga0105240_10000788 | |||
| 799 | Ga0105240_10007638 | |||
| 800 | Ga0105240_10524973 | |||
| 801 | Ga0105240_10730091 | |||
| 802 | Ga0105240_10992701 | |||
| 803 | Ga0111539_11614867 | |||
| 804 | Ga0105245_11189811 | |||
| 805 | Ga0105245_11370162 | |||
| 806 | Ga0105245_12989646 | |||
| 807 | Ga0105247_10317298 | |||
| 808 | Ga0114129_10142097 | |||
| 809 | Ga0114129_10490507 | |||
| 810 | Ga0105241_10463885 | |||
| 811 | Ga0105241_11533508 | |||
| 812 | Ga0105241_11654683 | |||
| 813 | Ga0105241_12312191 | |||
| 814 | Ga0105242_11017569 | |||
| 815 | Ga0105242_11795480 | |||
| 816 | Ga0105248_10006372 | |||
| 817 | Ga0105248_10053351 | |||
| 818 | Ga0105248_10085337 | |||
| 819 | Ga0105248_10166357 | |||
| 820 | Ga0105248_10189170 | |||
| 821 | Ga0105248_10843622 | |||
| 822 | Ga0105248_10942483 | |||
| 823 | Ga0105248_11146068 | |||
| 824 | Ga0105248_12886267 | |||
| 825 | Ga0105237_10008360 | |||
| 826 | Ga0105237_10262495 | |||
| 827 | Ga0105237_10568159 | |||
| 828 | Ga0105237_10652138 | |||
| 829 | Ga0105237_11452983 | |||
| 830 | Ga0105237_11899243 | |||
| 831 | Ga0105237_12161826 | |||
| 832 | Ga0105238_10125669 | |||
| 833 | Ga0105238_10129477 | |||
| 834 | Ga0105238_10198190 | |||
| 835 | Ga0105238_10257920 | |||
| 836 | Ga0105238_10637768 | |||
| 837 | Ga0105238_10712656 | |||
| 838 | Ga0105238_12232314 | |||
| 839 | Ga0105238_12625332 | |||
| 840 | Ga0105249_10027304 | |||
| 841 | Ga0105249_10145396 | |||
| 842 | Ga0105249_11884186 | |||
| 843 | Ga0105249_13286652 | |||
| 844 | Ga0105239_10044211 | |||
| 845 | Ga0105239_10832859 | |||
| 846 | Ga0105239_11020102 | |||
| 847 | Ga0105239_12093732 | |||
| 848 | Ga0105239_12838533 | |||
| 849 | Ga0105239_12843079 | |||
| 850 | Ga0105246_10968566 | |||
| 851 | Ga0105246_11563288 | |||
| 852 | Ga0105246_12387756 | |||
| 853 | Ga0157373_10222192 | |||
| 854 | Ga0157371_10697784 | |||
| 855 | Ga0157370_10048316 | |||
| 856 | Ga0157370_10059029 | |||
| 857 | Ga0157370_10367913 | |||
| 858 | Ga0157370_10416763 | |||
| 859 | Ga0157370_10557258 | |||
| 860 | Ga0157369_10310228 | |||
| 861 | Ga0157369_10582866 | |||
| 862 | Ga0157369_10726377 | |||
| 863 | Ga0157369_10886167 | |||
| 864 | Ga0157369_11479595 | |||
| 865 | Ga0157369_12045534 | |||
| 866 | Ga0157374_10624446 | |||
| 867 | Ga0157374_10757940 | |||
| 868 | Ga0157374_11428044 | |||
| 869 | Ga0157374_12113727 | |||
| 870 | Ga0157374_12244463 | |||
| 871 | Ga0157374_12523805 | |||
| 872 | Ga0157378_11314666 | |||
| 873 | Ga0157378_11547852 | |||
| 874 | Ga0157378_11554739 | |||
| 875 | Ga0157378_12181142 | |||
| 876 | Ga0157378_12620469 | |||
| 877 | Ga0163162_10097276 | |||
| 878 | Ga0163162_10412126 | |||
| 879 | Ga0163162_11251635 | |||
| 880 | Ga0163162_12536829 | |||
| 881 | Ga0163162_12556791 | |||
| 882 | Ga0163162_13155883 | |||
| 883 | Ga0163162_13295073 | |||
| 884 | Ga0157372_10113610 | |||
| 885 | Ga0157372_10569300 | |||
| 886 | Ga0157372_10686466 | |||
| 887 | Ga0157372_11497433 | |||
| 888 | Ga0157372_11693863 | |||
| 889 | Ga0157372_11821438 | |||
| 890 | Ga0157375_10223470 | |||
| 891 | Ga0157375_10521450 | |||
| 892 | Ga0157375_10988238 | |||
| 893 | Ga0157375_11272916 | |||
| 894 | Ga0157375_11466538 | |||
| 895 | Ga0157375_11474089 | |||
| 896 | Ga0157375_12132157 | |||
| 897 | Ga0157375_12967794 | |||
| 898 | Ga0157375_12997298 | |||
| 899 | Ga0163163_10120532 | |||
| 900 | Ga0163163_10228715 | |||
| 901 | Ga0163163_10574187 | |||
| 902 | Ga0163163_11477783 | |||
| 903 | Ga0163163_12073190 | |||
| 904 | Ga0163163_12243123 | |||
| 905 | Ga0163163_12352714 | |||
| 906 | Ga0157380_11271582 | |||
| 907 | Ga0157380_11791242 | |||
| 908 | Ga0157380_11944868 | |||
| 909 | Ga0157380_12711752 | |||
| 910 | Ga0157377_10355329 | |||
| 911 | Ga0157377_10784991 | |||
| 912 | Ga0157377_11428781 | |||
| 913 | Ga0157379_12518593 | |||
| 914 | Ga0157379_12603958 | |||
| 915 | Ga0157376_10018940 | |||
| 916 | Ga0157376_10473001 | |||
| 917 | Ga0157376_10821695 | |||
| 918 | Ga0157376_11527485 | |||
| 919 | Ga0163161_12111884 | |||
| 920 | Ga0213876_10044400 | |||
| 921 | Ga0213875_10101501 | |||
| 922 | Ga0213875_10259277 | |||
| 923 | Ga0207642_10470265 | |||
| 924 | Ga0207688_10587587 | |||
| 925 | Ga0207699_10189961 | |||
| 926 | Ga0207699_10942993 | |||
| 927 | Ga0207699_11061542 | |||
| 928 | Ga0207699_11153426 | |||
| 929 | Ga0207705_10340843 | |||
| 930 | Ga0207654_10676876 | |||
| 931 | Ga0207654_10958931 | |||
| 932 | Ga0207707_10063867 | |||
| 933 | Ga0207707_11005881 | |||
| 934 | Ga0207707_11630285 | |||
| 935 | Ga0207695_10013146 | |||
| 936 | Ga0207695_10092375 | |||
| 937 | Ga0207695_10941925 | |||
| 938 | Ga0207695_11691043 | |||
| 939 | Ga0207695_11737755 | |||
| 940 | Ga0207671_10006171 | |||
| 941 | Ga0207671_10424161 | |||
| 942 | Ga0207671_11050053 | |||
| 943 | Ga0207693_11017836 | |||
| 944 | Ga0207663_10082261 | |||
| 945 | Ga0207649_10238792 | |||
| 946 | Ga0207649_10670189 | |||
| 947 | Ga0207652_10316729 | |||
| 948 | Ga0207652_11101406 | |||
| 949 | Ga0207652_11300992 | |||
| 950 | Ga0207652_11625328 | |||
| 951 | Ga0207694_10111043 | |||
| 952 | Ga0207694_10435034 | |||
| 953 | Ga0207694_10903273 | |||
| 954 | Ga0207694_11023165 | |||
| 955 | Ga0207650_10168288 | |||
| 956 | Ga0207650_10606506 | |||
| 957 | Ga0207659_11716718 | |||
| 958 | Ga0207687_11751010 | |||
| 959 | Ga0207700_10383958 | |||
| 960 | Ga0207700_10541617 | |||
| 961 | Ga0207700_10870995 | |||
| 962 | Ga0207664_10002136 | |||
| 963 | Ga0207644_10030423 | |||
| 964 | Ga0207644_10955361 | |||
| 965 | Ga0207690_10608303 | |||
| 966 | Ga0207686_11052711 | |||
| 967 | Ga0207686_11272127 | |||
| 968 | Ga0207670_10682368 | |||
| 969 | Ga0207670_11351911 | |||
| 970 | Ga0207669_11579181 | |||
| 971 | Ga0207704_11540993 | |||
| 972 | Ga0207665_10237450 | |||
| 973 | Ga0207691_11215607 | |||
| 974 | Ga0207711_10026153 | |||
| 975 | Ga0207711_10063648 | |||
| 976 | Ga0207711_10392487 | |||
| 977 | Ga0207711_10922620 | |||
| 978 | Ga0207711_10928784 | |||
| 979 | Ga0207711_11078306 | |||
| 980 | Ga0207711_11633585 | |||
| 981 | Ga0207689_11044138 | |||
| 982 | Ga0207661_10000010 | |||
| 983 | Ga0207661_10044366 | |||
| 984 | Ga0207661_10084647 | |||
| 985 | Ga0207661_10129439 | |||
| 986 | Ga0207661_10156554 | |||
| 987 | Ga0207661_10625141 | |||
| 988 | Ga0207661_10661229 | |||
| 989 | Ga0207661_11716972 | |||
| 990 | Ga0207679_11347226 | |||
| 991 | Ga0207667_10078201 | |||
| 992 | Ga0207667_11184019 | |||
| 993 | Ga0207651_10096654 | |||
| 994 | Ga0207651_10652200 | |||
| 995 | Ga0207712_10060743 | |||
| 996 | Ga0207658_10223333 | |||
| 997 | Ga0207658_10741790 | |||
| 998 | Ga0207658_11236864 | |||
| 999 | Ga0207658_11625872 | |||
| 1000 | Ga0207658_11655972 | |||
| 1001 | Ga0207658_11708156 | |||
| 1002 | Ga0207677_10438053 | |||
| 1003 | Ga0207703_10572969 | |||
| 1004 | Ga0207703_11898135 | |||
| 1005 | Ga0207703_12246590 | |||
| 1006 | Ga0207639_10128550 | |||
| 1007 | Ga0207639_10702321 | |||
| 1008 | Ga0207678_10117026 | |||
| 1009 | Ga0207708_11361320 | |||
| 1010 | Ga0207702_10126783 | |||
| 1011 | Ga0207702_10685799 | |||
| 1012 | Ga0207702_10819017 | |||
| 1013 | Ga0207641_10048412 | |||
| 1014 | Ga0207641_10213318 | |||
| 1015 | Ga0207641_12134220 | |||
| 1016 | Ga0207641_12275952 | |||
| 1017 | Ga0207648_10699346 | |||
| 1018 | Ga0207648_11102802 | |||
| 1019 | Ga0207648_12067908 | |||
| 1020 | Ga0207676_10210383 | |||
| 1021 | Ga0207676_10349643 | |||
| 1022 | Ga0207676_11658753 | |||
| 1023 | Ga0207674_11762372 | |||
| 1024 | Ga0207675_101844797 | |||
| 1025 | Ga0207683_10774433 | |||
| 1026 | Ga0207683_10879631 | |||
| 1027 | Ga0207683_12005123 | |||
| 1028 | Ga0207698_10893037 | |||
| 1029 | Ga0207698_11562977 | |||
| 1030 | Ga0207698_11581166 | |||
| 1031 | Ga0207428_11145540 | |||
| 1032 | Ga0268266_10431087 | |||
| 1033 | Ga0268266_10460655 | |||
| 1034 | Ga0268266_10544412 | |||
| 1035 | Ga0268266_10592797 | |||
| 1036 | Ga0268266_10967536 | |||
| 1037 | Ga0268266_11157115 | |||
| 1038 | Ga0268266_12254733 | |||
| 1039 | Ga0268265_10548497 | |||
| 1040 | Ga0268265_11033578 | |||
| 1041 | Ga0268265_11995382 | |||
| 1042 | Ga0268264_11002879 | |||
| 1043 | Ga0268264_11559771 | |||
| 1044 | Ga0265323_10005587 | |||
| 1045 | Ga0265323_10261343 | |||
| 1046 | Ga0265338_10439675 | |||
| 1047 | Ga0265338_11015929 | |||
| 1048 | Ga0265762_1067991 | |||
| 1049 | Ga0265770_1049992 | |||
| 1050 | Ga0265330_10379975 | |||
| 1051 | Ga0265325_10207622 | |||
| 1052 | Ga0265329_10309661 | |||
| 1053 | Ga0265329_10322959 | |||
| 1054 | Ga0265331_10043197 | |||
| 1055 | Ga0265331_10077457 | |||
| 1056 | Ga0265331_10194587 | |||
| 1057 | Ga0265316_10004540 | |||
| 1058 | Ga0265316_10081778 | |||
| 1059 | Ga0265316_10126153 | |||
| 1060 | Ga0265316_10166490 | |||
| 1061 | Ga0265316_10205343 | |||
| 1062 | Ga0265316_10271128 | |||
| 1063 | Ga0265316_10342774 | |||
| 1064 | Ga0265316_10506192 | |||
| 1065 | Ga0265316_11156764 | |||
| 1066 | Ga0265313_10226113 | |||
| 1067 | Ga0307508_10556022 | |||
| 1068 | Ga0265314_10013424 | |||
| 1069 | Ga0265314_10070164 | |||
| 1070 | Ga0265342_10357405 | |||
| 1071 | Ga0265342_10373134 | |||
| 1072 | Ga0373926_0011971 | |||
| 1073 | Ga0373926_0452674 | |||
| 1074 | Ga0373926_0457787 | |||
| 1075 | Ga0373934_0032185 | |||
| 1076 | Ga0373934_0427870 | |||
| 1077 | Ga0373944_0401135 | |||
| 1078 | Ga0373923_0028901 | |||
| 1079 | Ga0373923_0475347 | |||
| 1080 | Ga0373923_0657490 | |||
| 1081 | Ga0373932_0124729 | |||
| 1082 | Ga0373932_0197221 | |||
| 1083 | Ga0373936_0411074 | |||
| 1084 | Ga0373941_0332156 | |||
| 1085 | Ga0373953_0021893 | |||
| 1086 | Ga0373953_0145775 | |||
| 1087 | Ga0373953_0320624 | |||
| 1088 | Ga0373954_0078691 | |||
| 1089 | Ga0373954_0626142 | |||
| 1090 | Ga0373956_0258738 | |||
| 1091 | Ga0373960_0150892 | |||
| 1092 | Ga0373943_0039997 | |||
| 1093 | Ga0373943_0133435 | |||
| 1094 | Ga0373943_0185372 | |||
| 1095 | Ga0373943_0262931 | |||
| 1096 | Ga0373946_0292853 | |||
| 1097 | Ga0373955_0550639 | |||
| 1098 | Ga0373924_0200628 | |||
| 1099 | Ga0373924_0481952 | |||
| 1100 | Ga0373931_0477737 | |||
| 1101 | Ga0373935_0015720 | |||
| 1102 | Ga0373935_0198623 | |||
| 1103 | Ga0373935_0470263 | |||
| 1104 | Ga0373935_0958190 | |||
| 1105 | Ga0373927_0001372 | |||
| 1106 | Ga0373927_0003200 | |||
| 1107 | Ga0373927_0102501 | |||
| 1108 | Ga0373927_0602541 | |||
| 1109 | Ga0373927_0930953 | |||
| 1110 | Ga0373933_0372846 | |||
| 1111 | Ga0373933_1065480 | |||
| 1112 | Ga0373947_0004278 | |||
| 1113 | Ga0373947_0076866 | |||
| 1114 | Ga0373947_0334148 | |||
| 1115 | Ga0373947_0490827 | |||
| 1116 | Ga0373937_0026653 | |||
| 1117 | Ga0373937_0063027 | |||
| 1118 | Ga0373937_0110702 | |||
| 1119 | Ga0373937_0189245 | |||
| 1120 | Ga0373937_0196527 | |||
| 1121 | Ga0373937_0227464 | |||
| 1122 | Ga0373937_0459754 | |||
| 1123 | Ga0373925_0000097 | |||
| 1124 | Ga0373925_0016758 | |||
| 1125 | Ga0373925_0508948 | |||
| 1126 | Ga0373925_0590772 | |||
| 1127 | Ga0373925_1037903 | |||
| 1128 | Ga0395900_1177766 | |||
| 1129 | Ga0395898_0129390 | |||
| 1130 | Ga0436364_0749391 | |||
| 1131 | Ga0436364_0946379 | |||
| 1132 | Ga0436364_1502563 | |||
| 1133 | Ga0395901_0848024 | |||
| 1134 | Ga0436365_0231085 | |||
| 1135 | Ga0436365_1144685 | |||
| 1136 | Ga0451787_427022 | |||
| 1137 | Ga0451577_0852745 | |||
| 1138 | Ga0453684_0472617 | |||
| 1139 | Ga0466959_0204016 | |||
| 1140 | Ga0451576_0734549 | |||
| 1141 | Ga0451576_1040482 | |||
| 1142 | Ga0451576_1973331 | |||
| 1143 | Ga0466958_0792033 | |||
| 1144 | Ga0495592_0012115 | |||
| 1145 | Ga0495603_0891094 | |||
| 1146 | Ga0495629_0333156 | |||
| 1147 | Ga0495629_0507956 | |||
| 1148 | Ga0495651_0007679 | |||
| 1149 | Ga0495651_0061399 | |||
| 1150 | Ga0495651_0126323 | |||
| 1151 | Ga0495651_0140364 | |||
| 1152 | Ga0495653_0209592 | |||
| 1153 | Ga0495653_0282257 | |||
| 1154 | Ga0495653_0383352 | |||
| 1155 | Ga0495653_0403455 | |||
| 1156 | Ga0495580_0000132 | |||
| 1157 | Ga0495580_0003752 | |||
| 1158 | Ga0495580_0113660 | |||
| 1159 | Ga0495580_0246274 | |||
| 1160 | Ga0495580_0321994 | |||
| 1161 | Ga0495582_0240588 | |||
| 1162 | Ga0495582_0379313 | |||
| 1163 | Ga0495639_0316956 | |||
| 1164 | Ga0495639_0473957 | |||
| 1165 | Ga0495662_0006722 | |||
| 1166 | Ga0495662_0061880 | |||
| 1167 | Ga0495662_0209409 | |||
| 1168 | Ga0495664_0005554 | |||
| 1169 | Ga0495664_0017294 | |||
| 1170 | Ga0495664_0572946 | |||
| 1171 | Ga0495594_0292404 | |||
| 1172 | Ga0495608_0094352 | |||
| 1173 | Ga0495608_0527453 | |||
| 1174 | Ga0495628_0398606 | |||
| 1175 | Ga0495628_0774402 | |||
| 1176 | Ga0495630_0182045 | |||
| 1177 | Ga0495630_0254453 | |||
| 1178 | Ga0495630_1423418 | |||
| 1179 | Ga0495642_0143623 | |||
| 1180 | Ga0495652_0070499 | |||
| 1181 | Ga0495652_0290749 | |||
| 1182 | Ga0495652_0310783 | |||
| 1183 | Ga0495652_0705402 | |||
| 1184 | Ga0495652_0791444 | |||
| 1185 | Ga0495665_0040345 | |||
| 1186 | Ga0495665_0121273 | |||
| 1187 | Ga0495665_0142718 | |||
| 1188 | Ga0495665_0399536 | |||
| 1189 | Ga0495665_0553897 | |||
| 1190 | Ga0495640_0035052 | |||
| 1191 | Ga0495640_0227845 | |||
| 1192 | Ga0495640_0414923 | |||
| 1193 | Ga0495640_0615267 | |||
| 1194 | Ga0495586_0221773 | |||
| 1195 | Ga0495586_0892201 | |||
| 1196 | Ga0495587_0028243 | |||
| 1197 | Ga0495587_0040136 | |||
| 1198 | Ga0495587_0435273 | |||
| 1199 | Ga0495587_0651993 | |||
| 1200 | Ga0495587_0664976 | |||
| 1201 | Ga0495621_0130932 | |||
| 1202 | Ga0495645_0003793 | |||
| 1203 | Ga0495645_0006550 | |||
| 1204 | Ga0495645_0193711 | |||
| 1205 | Ga0495667_0011261 | |||
| 1206 | Ga0495667_0017131 | |||
| 1207 | Ga0495667_0115924 | |||
| 1208 | Ga0495667_0293877 | |||
| 1209 | Ga0495634_0013446 | |||
| 1210 | Ga0495635_0010852 | |||
| 1211 | Ga0495635_0114380 | |||
| 1212 | Ga0495635_0287800 | |||
| 1213 | Ga0495635_0625746 | |||
| 1214 | Ga0495635_0712962 | |||
| 1215 | Ga0495659_0285969 | |||
| 1216 | Ga0495657_0109425 | |||
| 1217 | Ga0495657_0197520 | |||
| 1218 | Ga0495657_0496106 | |||
| 1219 | Ga0495599_0002828 | |||
| 1220 | Ga0495599_0376574 | |||
| 1221 | Ga0495623_0015318 | |||
| 1222 | Ga0495623_0048904 | |||
| 1223 | Ga0495623_0075642 | |||
| 1224 | Ga0495623_0170902 | |||
| 1225 | Ga0495623_0469048 | |||
| 1226 | Ga0495646_0026430 | |||
| 1227 | Ga0495646_0411771 | |||
| 1228 | Ga0495669_0060538 | |||
| 1229 | Ga0495613_0030300 | |||
| 1230 | Ga0495613_0140504 | |||
| 1231 | Ga0495613_0191760 | |||
| 1232 | Ga0495600_0034467 | |||
| 1233 | Ga0495600_0290479 | |||
| 1234 | Ga0495600_0528100 | |||
| 1235 | Ga0495581_0175242 | |||
| 1236 | Ga0495604_0054122 | |||
| 1237 | Ga0495604_0228537 | |||
| 1238 | Ga0495604_0279478 | |||
| 1239 | Ga0495604_0580487 | |||
| 1240 | Ga0495604_0688737 | |||
| 1241 | Ga0495674_0031826 | |||
| 1242 | Ga0495674_0035809 | |||
| 1243 | Ga0495674_0128892 | |||
| 1244 | Ga0495674_0289781 | |||
| 1245 | Ga0495674_0355422 | |||
| 1246 | Ga0495674_0808557 | |||
| 1247 | Ga0495674_1284208 | |||
| 1248 | Ga0495676_0265014 | |||
| 1249 | Ga0495680_0021789 | |||
| 1250 | Ga0495680_0369677 | |||
| 1251 | Ga0495680_0377350 | |||
| 1252 | Ga0495675_0030243 | |||
| 1253 | Ga0495675_0055531 | |||
| 1254 | Ga0495675_0096687 | |||
| 1255 | Ga0495675_0177763 | |||
| 1256 | Ga0495675_0344558 | |||
| 1257 | Ga0495684_0003399 | |||
| 1258 | Ga0495684_0035212 | |||
| 1259 | Ga0495684_0036949 | |||
| 1260 | Ga0495684_0052008 | |||
| 1261 | Ga0495684_0073401 | |||
| 1262 | Ga0495684_0331506 | |||
| 1263 | Ga0495684_0380722 | |||
| 1264 | Ga0495593_0348308 | |||
| 1265 | Ga0495602_0014264 | |||
| 1266 | Ga0495602_0062196 | |||
| 1267 | Ga0495602_0158232 | |||
| 1268 | Ga0495602_0400491 | |||
| 1269 | Ga0495602_0660093 | |||
| 1270 | Ga0495602_0667201 | |||
| 1271 | Ga0495602_0709269 | |||
| 1272 | Ga0495614_0217268 | |||
| 1273 | Ga0496101_0605331 | |||
| 1274 | Ga0496101_1398149 | |||
| 1275 | Ga0496102_0796013 | |||
| 1276 | Ga0496104_1600578 | |||
| 1277 | Ga0496104_1606723 | |||
| 1278 | Ga0496105_0519576 | |||
| 1279 | Ga0496106_0595429 | |||
| 1280 | Ga0496111_0983002 | |||
| 1281 | Ga0496112_0983576 | |||
| 1282 | Ga0496114_1154375 | |||
| 1283 | Ga0496115_0179396 | |||
| 1284 | nmdc:mga05p37_113979_c1 | |||
| 1285 | nmdc:mga05p37_786713_c1 | |||
| 1286 | nmdc:mga09592_556898_c1 | |||
| 1287 | nmdc:mga09592_677782_c1 | |||
| 1288 | nmdc:mga06r32_24497_c1 | |||
| 1289 | nmdc:mga0n895_1059014_c1 | |||
| 1290 | nmdc:mga0n895_2093566_c1 | |||
| 1291 | nmdc:mga08x19_98273_c1 | |||
| 1292 | nmdc:mga0a205_1439376_c1 | |||
| 1293 | Ga0495612_0301303 | |||
| 1294 | Ga0501082_0000067 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xrw-assembly1.cif.gz_C | crystal structure of flagellar motor switch complex from h. pylori | 0.7158 | 13 | 81 |
| 5xrw-assembly2.cif.gz_B | crystal structure of flagellar motor switch complex from h. pylori | 0.708 | 16 | 81 |
| 1o9y-assembly1.cif.gz_B | crystal structure of the c-terminal domain of the hrcqb protein from pseudomonas syringae pv. phaseolicola | 0.6867 | 12 | 79 |
| 1o6a-assembly1.cif.gz_B | crystal structure of a c-terminal fragment of the putative flagellar motor switch protein flin (tm0680) from thermotoga maritima at 1.85 a resolution | 0.6783 | 11 | 81 |
| 3uep-assembly1.cif.gz_B | crystal structure of yscq-c from yersinia pseudotuberculosis | 0.6693 | 1 | 82 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O13810_285_387_2.30.130.10 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain | 0.7598 | 44 | 64 | 2.30.130.10 |
| 5xrwC00 | Mainly Beta;Roll;Surface presentation of antigens (SPOA);SpoA-like | 0.7158 | 13 | 81 | 2.30.330.10 |
| 5xrwB00 | Mainly Beta;Roll;Surface presentation of antigens (SPOA);SpoA-like | 0.708 | 16 | 81 | 2.30.330.10 |
| af_B8JJX2_81_394_2.130.10.120 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Prolyl oligopeptidase, N-terminal domain | 0.7003 | 49 | 81 | 2.130.10.120 |
| af_Q8C167_116_425_2.130.10.120 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Prolyl oligopeptidase, N-terminal domain | 0.6918 | 49 | 81 | 2.130.10.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y6UD91-F1-model_v4 | FliM/FliN family flagellar motor switch protein | 0.8676 | 2 | 82 |
GO:0050918
GO:0071978 |
| AF-A0A7Y5FCZ6-F1-model_v4 | FliM/FliN family flagellar motor switch protein | 0.8627 | 7 | 82 |
GO:0003774
GO:0005886 GO:0006935 GO:0009425 GO:0071973 |
| AF-A0A3M2DW73-F1-model_v4 | Flagellar motor switch protein FliM | 0.859 | 3 | 78 |
GO:0005886
GO:0050918 GO:0071978 |
| AF-A0A2V8MSC5-F1-model_v4 | Flagellar motor switch protein FliM | 0.855 | 3 | 81 |
GO:0003774
GO:0005886 GO:0009425 GO:0050918 GO:0071978 |
| AF-A0A7Y6UD91-F1-model_v4 | FliM/FliN family flagellar motor switch protein | 0.8489 | 2 | 82 |
GO:0050918
GO:0071978 |