F472305
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 647 | 260 | 640 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300041503|Ga0451847_0132680|Ga0451847_0132680_348_890 |
| Length | 180 |
| Sequence | MAAASCALLPRRSRRAMIELAQAELSMRSVNDWFGSYSADHQNPTNRLIHWICVPAILWAVVALLWLLPVPPSIGRAGLWCAFVMIGALSFYWRLSRPLGAAMFVVFVLLALLTEWLYRTLGGQPLLWLAIGVFVIAWIGQFVGHVIEGRRPSFFTDLAYLLIGPAWLTGKIMRKVGVAY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 3 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 4 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 5 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 6 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 7 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 8 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 9 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 10 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 13 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 14 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 15 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 16 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 18 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 19 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 20 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 21 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 22 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 84 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 99 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 113 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 114 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 165 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 166 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 171 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 173 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 178 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 179 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 180 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 181 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 182 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 183 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 184 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 185 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 186 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 187 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 188 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 189 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 190 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 191 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 192 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 193 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 194 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 195 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 196 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 197 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 198 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 199 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 200 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 209 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 210 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 211 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 212 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 213 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 214 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 215 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 216 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 217 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 218 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 219 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 254 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 255 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 256 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 257 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 260 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.84 |
| Metatranscriptomes | 0.93 |
| Isolates | 1.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.36 |
| Nodule | 0 |
| Rhizoplane | 3.25 |
| Rhizosphere | 78.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10009154 | 3300001979 | Bacteria | 3893 |
| 2 | JGI24739J22299_10000870 | 3300001989 | Bacteria | 11155 |
| 3 | JGI24739J22299_10157449 | 3300001989 | Bacteria | 671 |
| 4 | JGI24737J22298_10005793 | 3300001990 | Bacteria | 4257 |
| 5 | JGI24737J22298_10090807 | 3300001990 | Bacteria | 906 |
| 6 | JGI24735J21928_10000330 | 3300002067 | Bacteria | 16497 |
| 7 | JGI25162J39368_1000837 | 3300002737 | Bacteria | 20279 |
| 8 | JGI25162J39368_1001075 | 3300002737 | Bacteria | 16659 |
| 9 | JGI25157J39369_1000177 | 3300002741 | Bacteria | 53890 |
| 10 | JGI25157J39369_1000501 | 3300002741 | Bacteria | 24125 |
| 11 | JGI25157J39369_1004503 | 3300002741 | Bacteria | 2504 |
| 12 | JGI25163J39215_1002314 | 3300002771 | Bacteria | 2049 |
| 13 | JGI25164J39214_1000024 | 3300002772 | Bacteria | 165608 |
| 14 | JGI25164J39214_1000159 | 3300002772 | Bacteria | 63983 |
| 15 | JGI25165J46597_1000287 | 3300003214 | Bacteria | 64000 |
| 16 | JGI25165J46597_1000446 | 3300003214 | Bacteria | 41610 |
| 17 | JGI25165J46597_1003141 | 3300003214 | Bacteria | 4403 |
| 18 | JGI25153J46596_10013051 | 3300003215 | Bacteria | 3539 |
| 19 | rootH1_10057966 | 3300003316 | Bacteria | 1516 |
| 20 | rootH1_10057966 | 3300003323 | Bacteria | 6154 |
| 21 | rootH2_10010398 | 3300003320 | Bacteria | 3132 |
| 22 | Ga0006562J51391_1016472 | 3300003578 | Bacteria | 7310 |
| 23 | Ga0006562J51391_1016473 | 3300003578 | Bacteria | 3930 |
| 24 | Ga0055538_1001479 | 3300003751 | Bacteria | 4461 |
| 25 | Ga0055533_1000621 | 3300003756 | Bacteria | 11966 |
| 26 | Ga0055527_1000126 | 3300003760 | Bacteria | 53492 |
| 27 | Ga0055535_1000284 | 3300003761 | Bacteria | 53480 |
| 28 | Ga0055535_1000329 | 3300003761 | Bacteria | 47890 |
| 29 | Ga0055535_1000758 | 3300003761 | Bacteria | 24017 |
| 30 | Ga0055535_1001377 | 3300003761 | Bacteria | 12655 |
| 31 | Ga0055542_1000279 | 3300003762 | Bacteria | 57233 |
| 32 | Ga0055542_1000310 | 3300003762 | Bacteria | 53492 |
| 33 | Ga0055542_1000531 | 3300003762 | Bacteria | 33988 |
| 34 | Ga0055542_1000547 | 3300003762 | Bacteria | 33443 |
| 35 | Ga0055542_1000733 | 3300003762 | Bacteria | 25465 |
| 36 | Ga0055529_1000108 | 3300003763 | Bacteria | 122223 |
| 37 | Ga0055529_1000120 | 3300003763 | Bacteria | 115533 |
| 38 | Ga0055529_1000325 | 3300003763 | Bacteria | 53492 |
| 39 | Ga0070658_10056111 | 3300005327 | Bacteria | 3201 |
| 40 | Ga0070658_10692495 | 3300005327 | Bacteria | 884 |
| 41 | Ga0070676_10332751 | 3300005328 | Bacteria | 1039 |
| 42 | Ga0070670_100361288 | 3300005331 | Bacteria | 1277 |
| 43 | Ga0068869_101075893 | 3300005334 | Bacteria | 703 |
| 44 | Ga0070666_10057963 | 3300005335 | Bacteria | 2618 |
| 45 | Ga0070666_10099798 | 3300005335 | Bacteria | 1999 |
| 46 | Ga0070682_100024425 | 3300005337 | Bacteria | 3597 |
| 47 | Ga0070682_100314597 | 3300005337 | Bacteria | 1154 |
| 48 | Ga0070682_101235436 | 3300005337 | Bacteria | 632 |
| 49 | Ga0068868_100076880 | 3300005338 | Bacteria | 2669 |
| 50 | Ga0070660_100457366 | 3300005339 | Bacteria | 1059 |
| 51 | Ga0070660_101042721 | 3300005339 | Bacteria | 691 |
| 52 | Ga0070660_101173520 | 3300005339 | Bacteria | 651 |
| 53 | Ga0070691_10215119 | 3300005341 | Bacteria | 1016 |
| 54 | Ga0070661_100028400 | 3300005344 | Bacteria | 4035 |
| 55 | Ga0070661_100028468 | 3300005344 | Bacteria | 4030 |
| 56 | Ga0070661_100168671 | 3300005344 | Bacteria | 1661 |
| 57 | Ga0070661_100277416 | 3300005344 | Bacteria | 1299 |
| 58 | Ga0070661_100384553 | 3300005344 | Bacteria | 1107 |
| 59 | Ga0070661_100441298 | 3300005344 | Bacteria | 1034 |
| 60 | Ga0070692_10013248 | 3300005345 | Bacteria | 3840 |
| 61 | Ga0070692_10017159 | 3300005345 | Bacteria | 3457 |
| 62 | Ga0070692_10153253 | 3300005345 | Bacteria | 1314 |
| 63 | Ga0070668_100048132 | 3300005347 | Bacteria | 3279 |
| 64 | Ga0070668_100621448 | 3300005347 | Bacteria | 947 |
| 65 | Ga0070668_102194901 | 3300005347 | Bacteria | 510 |
| 66 | Ga0070671_100084270 | 3300005355 | Bacteria | 2658 |
| 67 | Ga0070671_100862100 | 3300005355 | Bacteria | 790 |
| 68 | Ga0070674_100205078 | 3300005356 | Bacteria | 1525 |
| 69 | Ga0070673_100103345 | 3300005364 | Bacteria | 2351 |
| 70 | Ga0070688_100357274 | 3300005365 | Bacteria | 1071 |
| 71 | Ga0070659_100001431 | 3300005366 | Bacteria | 17216 |
| 72 | Ga0070659_100074854 | 3300005366 | Bacteria | 2698 |
| 73 | Ga0070659_100356007 | 3300005366 | Bacteria | 1229 |
| 74 | Ga0070667_100000243 | 3300005367 | Bacteria | 61793 |
| 75 | Ga0070667_100007499 | 3300005367 | Bacteria | 9049 |
| 76 | Ga0070667_100021449 | 3300005367 | Bacteria | 5363 |
| 77 | Ga0070667_100067079 | 3300005367 | Bacteria | 3050 |
| 78 | Ga0070667_100331525 | 3300005367 | Bacteria | 1375 |
| 79 | Ga0070667_100674261 | 3300005367 | Bacteria | 955 |
| 80 | Ga0070709_10669666 | 3300005434 | Bacteria | 805 |
| 81 | Ga0070714_100000070 | 3300005435 | Bacteria | 92555 |
| 82 | Ga0070694_100203539 | 3300005444 | Bacteria | 1477 |
| 83 | Ga0070663_100014022 | 3300005455 | Bacteria | 5133 |
| 84 | Ga0070663_100055413 | 3300005455 | Bacteria | 2838 |
| 85 | Ga0070663_100640920 | 3300005455 | Bacteria | 898 |
| 86 | Ga0070663_101767430 | 3300005455 | Bacteria | 554 |
| 87 | Ga0070662_100284473 | 3300005457 | Bacteria | 1339 |
| 88 | Ga0070681_10000799 | 3300005458 | Bacteria | 26246 |
| 89 | Ga0070681_10042888 | 3300005458 | Bacteria | 4533 |
| 90 | Ga0070681_10650872 | 3300005458 | Bacteria | 969 |
| 91 | Ga0070685_10011582 | 3300005466 | Bacteria | 4619 |
| 92 | Ga0070685_10849339 | 3300005466 | Bacteria | 676 |
| 93 | Ga0070684_100148945 | 3300005535 | Bacteria | 2119 |
| 94 | Ga0070684_100331999 | 3300005535 | Bacteria | 1397 |
| 95 | Ga0070684_100446831 | 3300005535 | Bacteria | 1195 |
| 96 | Ga0068853_100001964 | 3300005539 | Bacteria | 15151 |
| 97 | Ga0068853_100018102 | 3300005539 | Bacteria | 5826 |
| 98 | Ga0068853_100018189 | 3300005539 | Bacteria | 5813 |
| 99 | Ga0068853_100034791 | 3300005539 | Bacteria | 4277 |
| 100 | Ga0068853_100047092 | 3300005539 | Bacteria | 3700 |
| 101 | Ga0068853_100182912 | 3300005539 | Bacteria | 1901 |
| 102 | Ga0068853_100194108 | 3300005539 | Bacteria | 1846 |
| 103 | Ga0068853_101540344 | 3300005539 | Bacteria | 644 |
| 104 | Ga0070696_100145366 | 3300005546 | Bacteria | 1736 |
| 105 | Ga0070693_100050344 | 3300005547 | Bacteria | 2380 |
| 106 | Ga0070693_100365341 | 3300005547 | Bacteria | 991 |
| 107 | Ga0070665_100000126 | 3300005548 | Bacteria | 146495 |
| 108 | Ga0070665_100016275 | 3300005548 | Bacteria | 7462 |
| 109 | Ga0070665_100052121 | 3300005548 | Bacteria | 4105 |
| 110 | Ga0070665_100096902 | 3300005548 | Bacteria | 2954 |
| 111 | Ga0070665_100772577 | 3300005548 | Bacteria | 974 |
| 112 | Ga0070665_101182220 | 3300005548 | Bacteria | 776 |
| 113 | Ga0068855_100026134 | 3300005563 | Bacteria | 6984 |
| 114 | Ga0068855_100128818 | 3300005563 | Bacteria | 2891 |
| 115 | Ga0068855_100229325 | 3300005563 | Bacteria | 2080 |
| 116 | Ga0068855_100333763 | 3300005563 | Bacteria | 1673 |
| 117 | Ga0068855_100336141 | 3300005563 | Bacteria | 1666 |
| 118 | Ga0068855_100377635 | 3300005563 | Bacteria | 1557 |
| 119 | Ga0068855_100575517 | 3300005563 | Bacteria | 1217 |
| 120 | Ga0068855_101515468 | 3300005563 | Bacteria | 688 |
| 121 | Ga0068855_101860799 | 3300005563 | Bacteria | 610 |
| 122 | Ga0070664_100037916 | 3300005564 | Bacteria | 4054 |
| 123 | Ga0068857_100000379 | 3300005577 | Bacteria | 31170 |
| 124 | Ga0068857_100098116 | 3300005577 | Bacteria | 2627 |
| 125 | Ga0068857_100148003 | 3300005577 | Bacteria | 2126 |
| 126 | Ga0068857_100414861 | 3300005577 | Bacteria | 1254 |
| 127 | Ga0068854_100353302 | 3300005578 | Bacteria | 1204 |
| 128 | Ga0068854_100814373 | 3300005578 | Bacteria | 815 |
| 129 | Ga0068854_100843916 | 3300005578 | Bacteria | 801 |
| 130 | Ga0068856_100059168 | 3300005614 | Bacteria | 3784 |
| 131 | Ga0068856_100194594 | 3300005614 | Bacteria | 2042 |
| 132 | Ga0068856_100442611 | 3300005614 | Bacteria | 1320 |
| 133 | Ga0068856_100770724 | 3300005614 | Bacteria | 982 |
| 134 | Ga0068852_100176686 | 3300005616 | Bacteria | 2005 |
| 135 | Ga0068852_100310026 | 3300005616 | Bacteria | 1530 |
| 136 | Ga0068852_100597119 | 3300005616 | Bacteria | 1108 |
| 137 | Ga0068852_100673144 | 3300005616 | Bacteria | 1044 |
| 138 | Ga0068859_100000374 | 3300005617 | Bacteria | 44673 |
| 139 | Ga0068864_100292612 | 3300005618 | Bacteria | 1522 |
| 140 | Ga0068864_100380406 | 3300005618 | Bacteria | 1338 |
| 141 | Ga0068861_100021160 | 3300005719 | Bacteria | 4674 |
| 142 | Ga0068851_10007468 | 3300005834 | Bacteria | 5020 |
| 143 | Ga0068851_10096668 | 3300005834 | Bacteria | 1562 |
| 144 | Ga0068863_100013853 | 3300005841 | Bacteria | 7772 |
| 145 | Ga0068863_100041607 | 3300005841 | Bacteria | 4370 |
| 146 | Ga0068863_100123462 | 3300005841 | Bacteria | 2470 |
| 147 | Ga0068858_100067218 | 3300005842 | Bacteria | 3320 |
| 148 | Ga0068858_100309999 | 3300005842 | Bacteria | 1507 |
| 149 | Ga0068860_100108360 | 3300005843 | Bacteria | 2655 |
| 150 | Ga0068862_100000144 | 3300005844 | Bacteria | 80630 |
| 151 | Ga0068862_100069457 | 3300005844 | Bacteria | 3041 |
| 152 | Ga0068862_100399261 | 3300005844 | Bacteria | 1286 |
| 153 | Ga0081455_10111456 | 3300005937 | Bacteria | 2174 |
| 154 | Ga0081540_1004609 | 3300005983 | Bacteria | 10434 |
| 155 | Ga0097621_100023103 | 3300006237 | Bacteria | 4836 |
| 156 | Ga0097621_100034619 | 3300006237 | Bacteria | 4030 |
| 157 | Ga0097621_100082453 | 3300006237 | Bacteria | 2678 |
| 158 | Ga0068871_100078781 | 3300006358 | Bacteria | 2725 |
| 159 | Ga0068871_100682698 | 3300006358 | Bacteria | 940 |
| 160 | Ga0097620_100000374 | 3300006931 | Bacteria | 44673 |
| 161 | Ga0105240_10145612 | 3300009093 | Bacteria | 2827 |
| 162 | Ga0105240_10223859 | 3300009093 | Bacteria | 2190 |
| 163 | Ga0105240_10698903 | 3300009093 | Bacteria | 1107 |
| 164 | Ga0105247_10313483 | 3300009101 | Bacteria | 1092 |
| 165 | Ga0105237_10000011 | 3300009545 | Bacteria | 307361 |
| 166 | Ga0105237_10000318 | 3300009545 | Bacteria | 67535 |
| 167 | Ga0105237_10093432 | 3300009545 | Bacteria | 2997 |
| 168 | Ga0105237_10159201 | 3300009545 | Bacteria | 2256 |
| 169 | Ga0105237_10339705 | 3300009545 | Bacteria | 1506 |
| 170 | Ga0105237_10455940 | 3300009545 | Bacteria | 1284 |
| 171 | Ga0105237_11843911 | 3300009545 | Bacteria | 612 |
| 172 | Ga0105238_10012695 | 3300009551 | Bacteria | 8501 |
| 173 | Ga0105238_10035681 | 3300009551 | Bacteria | 5054 |
| 174 | Ga0105238_10125267 | 3300009551 | Bacteria | 2548 |
| 175 | Ga0105238_10305686 | 3300009551 | Bacteria | 1574 |
| 176 | Ga0105238_10572334 | 3300009551 | Bacteria | 1135 |
| 177 | Ga0105238_11075410 | 3300009551 | Bacteria | 827 |
| 178 | Ga0105238_11624025 | 3300009551 | Bacteria | 677 |
| 179 | Ga0105249_10024522 | 3300009553 | Bacteria | 5422 |
| 180 | Ga0105239_10083550 | 3300010375 | Bacteria | 3517 |
| 181 | Ga0105239_10133783 | 3300010375 | Bacteria | 2760 |
| 182 | Ga0105239_10172476 | 3300010375 | Bacteria | 2419 |
| 183 | Ga0105239_10212246 | 3300010375 | Bacteria | 2170 |
| 184 | Ga0105239_10244488 | 3300010375 | Bacteria | 2014 |
| 185 | Ga0105239_11223471 | 3300010375 | Bacteria | 866 |
| 186 | Ga0157322_1007219 | 3300012490 | Bacteria | 818 |
| 187 | Ga0157314_1000597 | 3300012500 | Bacteria | 3295 |
| 188 | Ga0157373_10101344 | 3300013100 | Bacteria | 2026 |
| 189 | Ga0157371_10085131 | 3300013102 | Bacteria | 2240 |
| 190 | Ga0157371_10749137 | 3300013102 | Bacteria | 733 |
| 191 | Ga0157371_10823309 | 3300013102 | Bacteria | 701 |
| 192 | Ga0157371_10935835 | 3300013102 | Bacteria | 658 |
| 193 | Ga0157370_10171695 | 3300013104 | Bacteria | 2015 |
| 194 | Ga0157370_10174310 | 3300013104 | Bacteria | 1999 |
| 195 | Ga0157370_10295008 | 3300013104 | Bacteria | 1497 |
| 196 | Ga0157370_10406359 | 3300013104 | Bacteria | 1253 |
| 197 | Ga0157369_10106798 | 3300013105 | Bacteria | 2979 |
| 198 | Ga0157369_10115805 | 3300013105 | Bacteria | 2847 |
| 199 | Ga0157374_10429564 | 3300013296 | Bacteria | 1321 |
| 200 | Ga0157374_10701725 | 3300013296 | Bacteria | 1025 |
| 201 | Ga0157372_10011446 | 3300013307 | Bacteria | 9431 |
| 202 | Ga0157372_10032397 | 3300013307 | Bacteria | 5731 |
| 203 | Ga0157372_10057339 | 3300013307 | Bacteria | 4353 |
| 204 | Ga0157372_10218999 | 3300013307 | Bacteria | 2206 |
| 205 | Ga0157372_11747357 | 3300013307 | Bacteria | 715 |
| 206 | Ga0157372_11801917 | 3300013307 | Bacteria | 704 |
| 207 | Ga0157375_10289862 | 3300013308 | Bacteria | 1800 |
| 208 | Ga0163163_10035757 | 3300014325 | Bacteria | 4821 |
| 209 | Ga0182008_10558257 | 3300014497 | Bacteria | 637 |
| 210 | Ga0157379_10085790 | 3300014968 | Bacteria | 2822 |
| 211 | Ga0157379_10843614 | 3300014968 | Bacteria | 867 |
| 212 | Ga0157376_10290210 | 3300014969 | Bacteria | 1544 |
| 213 | Ga0157376_10455104 | 3300014969 | Bacteria | 1249 |
| 214 | Ga0157376_11071284 | 3300014969 | Bacteria | 831 |
| 215 | Ga0157376_11552913 | 3300014969 | Unclassified | 696 |
| 216 | Ga0182006_1191793 | 3300015261 | Bacteria | 679 |
| 217 | Ga0182007_10053649 | 3300015262 | Bacteria | 1327 |
| 218 | Ga0182007_10194687 | 3300015262 | Bacteria | 706 |
| 219 | Ga0182007_10208623 | 3300015262 | Bacteria | 686 |
| 220 | Ga0182007_10211161 | 3300015262 | Bacteria | 682 |
| 221 | Ga0182007_10247961 | 3300015262 | Bacteria | 638 |
| 222 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 223 | Ga0206356_10126730 | 3300020070 | Bacteria | 6649 |
| 224 | Ga0206350_10185836 | 3300020080 | Bacteria | 1424 |
| 225 | Ga0206353_10150174 | 3300020082 | Bacteria | 6346 |
| 226 | Ga0154015_1137588 | 3300020610 | Bacteria | 1387 |
| 227 | Ga0209435_107095 | 3300025206 | Bacteria | 1243 |
| 228 | Ga0209760_100925 | 3300025207 | Bacteria | 3634 |
| 229 | Ga0209784_100076 | 3300025224 | Bacteria | 139766 |
| 230 | Ga0209566_102527 | 3300025225 | Bacteria | 3325 |
| 231 | Ga0209674_100033 | 3300025226 | Bacteria | 423450 |
| 232 | Ga0209674_100127 | 3300025226 | Bacteria | 123030 |
| 233 | Ga0209674_100449 | 3300025226 | Bacteria | 18818 |
| 234 | Ga0209672_100022 | 3300025228 | Bacteria | 374313 |
| 235 | Ga0209672_100203 | 3300025228 | Bacteria | 47041 |
| 236 | Ga0209672_101389 | 3300025228 | Bacteria | 8954 |
| 237 | Ga0209672_110225 | 3300025228 | Bacteria | 1279 |
| 238 | Ga0207427_100058 | 3300025231 | Bacteria | 192979 |
| 239 | Ga0207427_100097 | 3300025231 | Bacteria | 122973 |
| 240 | Ga0207427_102604 | 3300025231 | Bacteria | 4631 |
| 241 | Ga0209437_100116 | 3300025233 | Bacteria | 209449 |
| 242 | Ga0209437_100141 | 3300025233 | Bacteria | 166553 |
| 243 | Ga0209437_100142 | 3300025233 | Bacteria | 165628 |
| 244 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 245 | Ga0209258_100122 | 3300025242 | Bacteria | 180314 |
| 246 | Ga0209258_100158 | 3300025242 | Bacteria | 156881 |
| 247 | Ga0209258_100214 | 3300025242 | Bacteria | 115049 |
| 248 | Ga0209258_101254 | 3300025242 | Bacteria | 9712 |
| 249 | Ga0209258_103818 | 3300025242 | Bacteria | 3081 |
| 250 | Ga0209646_1000512 | 3300025246 | Bacteria | 17395 |
| 251 | Ga0209646_1001430 | 3300025246 | Bacteria | 6423 |
| 252 | Ga0209026_1000087 | 3300025250 | Bacteria | 184044 |
| 253 | Ga0209026_1000152 | 3300025250 | Bacteria | 110285 |
| 254 | Ga0209026_1000346 | 3300025250 | Bacteria | 44154 |
| 255 | Ga0209026_1004424 | 3300025250 | Bacteria | 4161 |
| 256 | Ga0209677_103470 | 3300025253 | Bacteria | 5096 |
| 257 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 258 | Ga0209148_1000047 | 3300025254 | Bacteria | 434369 |
| 259 | Ga0209148_1000053 | 3300025254 | Bacteria | 373506 |
| 260 | Ga0209148_1000062 | 3300025254 | Bacteria | 347704 |
| 261 | Ga0209148_1000362 | 3300025254 | Bacteria | 57285 |
| 262 | Ga0209759_1000477 | 3300025256 | Bacteria | 44647 |
| 263 | Ga0209759_1000602 | 3300025256 | Bacteria | 34775 |
| 264 | Ga0209759_1000894 | 3300025256 | Bacteria | 22283 |
| 265 | Ga0209759_1002664 | 3300025256 | Bacteria | 7645 |
| 266 | Ga0209233_1000100 | 3300025261 | Bacteria | 293905 |
| 267 | Ga0209233_1000141 | 3300025261 | Bacteria | 192978 |
| 268 | Ga0209233_1024946 | 3300025261 | Bacteria | 1487 |
| 269 | Ga0209455_1000007 | 3300025272 | Bacteria | 1157983 |
| 270 | Ga0209455_1000040 | 3300025272 | Bacteria | 430197 |
| 271 | Ga0209455_1000056 | 3300025272 | Bacteria | 349821 |
| 272 | Ga0209455_1008009 | 3300025272 | Bacteria | 2920 |
| 273 | Ga0209455_1010019 | 3300025272 | Bacteria | 2440 |
| 274 | Ga0209758_1000301 | 3300025297 | Bacteria | 96998 |
| 275 | Ga0209051_1031958 | 3300025303 | Bacteria | 2016 |
| 276 | Ga0207656_10189696 | 3300025321 | Bacteria | 989 |
| 277 | Ga0207710_10217492 | 3300025900 | Bacteria | 948 |
| 278 | Ga0207680_10024378 | 3300025903 | Bacteria | 3320 |
| 279 | Ga0207680_10038708 | 3300025903 | Bacteria | 2762 |
| 280 | Ga0207680_10393423 | 3300025903 | Bacteria | 979 |
| 281 | Ga0207647_10001467 | 3300025904 | Bacteria | 18124 |
| 282 | Ga0207647_10012275 | 3300025904 | Bacteria | 5970 |
| 283 | Ga0207647_10014847 | 3300025904 | Bacteria | 5356 |
| 284 | Ga0207647_10017557 | 3300025904 | Bacteria | 4863 |
| 285 | Ga0207647_10367630 | 3300025904 | Bacteria | 813 |
| 286 | Ga0207645_10044128 | 3300025907 | Bacteria | 2853 |
| 287 | Ga0207705_10112912 | 3300025909 | Bacteria | 2009 |
| 288 | Ga0207705_11422709 | 3300025909 | Bacteria | 527 |
| 289 | Ga0207707_10000626 | 3300025912 | Bacteria | 35036 |
| 290 | Ga0207707_10000976 | 3300025912 | Bacteria | 27495 |
| 291 | Ga0207707_10047538 | 3300025912 | Bacteria | 3737 |
| 292 | Ga0207707_10084557 | 3300025912 | Bacteria | 2771 |
| 293 | Ga0207707_10762238 | 3300025912 | Bacteria | 808 |
| 294 | Ga0207695_10000802 | 3300025913 | Bacteria | 58681 |
| 295 | Ga0207695_10108915 | 3300025913 | Bacteria | 2753 |
| 296 | Ga0207695_10137764 | 3300025913 | Bacteria | 2393 |
| 297 | Ga0207695_10668430 | 3300025913 | Bacteria | 919 |
| 298 | Ga0207671_10000011 | 3300025914 | Bacteria | 530349 |
| 299 | Ga0207671_10000618 | 3300025914 | Bacteria | 46890 |
| 300 | Ga0207671_10397320 | 3300025914 | Bacteria | 1096 |
| 301 | Ga0207660_10005591 | 3300025917 | Bacteria | 8162 |
| 302 | Ga0207660_10364093 | 3300025917 | Bacteria | 1160 |
| 303 | Ga0207649_10008623 | 3300025920 | Bacteria | 5566 |
| 304 | Ga0207649_10011831 | 3300025920 | Bacteria | 4827 |
| 305 | Ga0207649_10041309 | 3300025920 | Bacteria | 2807 |
| 306 | Ga0207649_10056315 | 3300025920 | Bacteria | 2455 |
| 307 | Ga0207649_10181318 | 3300025920 | Bacteria | 1474 |
| 308 | Ga0207652_10022193 | 3300025921 | Bacteria | 5247 |
| 309 | Ga0207652_10144803 | 3300025921 | Bacteria | 2126 |
| 310 | Ga0207652_10332329 | 3300025921 | Bacteria | 1372 |
| 311 | Ga0207694_10802159 | 3300025924 | Bacteria | 795 |
| 312 | Ga0207650_10061491 | 3300025925 | Bacteria | 2804 |
| 313 | Ga0207664_10000068 | 3300025929 | Bacteria | 107432 |
| 314 | Ga0207644_10592008 | 3300025931 | Bacteria | 920 |
| 315 | Ga0207690_10002033 | 3300025932 | Bacteria | 12404 |
| 316 | Ga0207690_10009636 | 3300025932 | Bacteria | 5734 |
| 317 | Ga0207690_10201926 | 3300025932 | Bacteria | 1510 |
| 318 | Ga0207690_10328491 | 3300025932 | Bacteria | 1204 |
| 319 | Ga0207690_10617374 | 3300025932 | Bacteria | 886 |
| 320 | Ga0207706_10010243 | 3300025933 | Bacteria | 8572 |
| 321 | Ga0207706_10036589 | 3300025933 | Bacteria | 4360 |
| 322 | Ga0207706_10269614 | 3300025933 | Bacteria | 1485 |
| 323 | Ga0207709_10400340 | 3300025935 | Bacteria | 1049 |
| 324 | Ga0207704_10140526 | 3300025938 | Bacteria | 1688 |
| 325 | Ga0207704_10920183 | 3300025938 | Bacteria | 736 |
| 326 | Ga0207691_10038146 | 3300025940 | Bacteria | 4445 |
| 327 | Ga0207711_10229881 | 3300025941 | Bacteria | 1698 |
| 328 | Ga0207689_10050054 | 3300025942 | Bacteria | 3446 |
| 329 | Ga0207689_10164296 | 3300025942 | Bacteria | 1829 |
| 330 | Ga0207689_10822388 | 3300025942 | Bacteria | 784 |
| 331 | Ga0207661_10054030 | 3300025944 | Bacteria | 3216 |
| 332 | Ga0207679_10162058 | 3300025945 | Bacteria | 1832 |
| 333 | Ga0207667_10000331 | 3300025949 | Bacteria | 65208 |
| 334 | Ga0207667_10006296 | 3300025949 | Bacteria | 14394 |
| 335 | Ga0207667_10085064 | 3300025949 | Bacteria | 3274 |
| 336 | Ga0207667_10088020 | 3300025949 | Bacteria | 3212 |
| 337 | Ga0207667_10110806 | 3300025949 | Bacteria | 2831 |
| 338 | Ga0207667_10198618 | 3300025949 | Bacteria | 2058 |
| 339 | Ga0207667_10219471 | 3300025949 | Bacteria | 1948 |
| 340 | Ga0207667_10314674 | 3300025949 | Bacteria | 1599 |
| 341 | Ga0207651_10836456 | 3300025960 | Bacteria | 817 |
| 342 | Ga0207712_10103347 | 3300025961 | Bacteria | 2123 |
| 343 | Ga0207668_10290679 | 3300025972 | Bacteria | 1344 |
| 344 | Ga0207668_10593870 | 3300025972 | Bacteria | 964 |
| 345 | Ga0207668_10864123 | 3300025972 | Bacteria | 804 |
| 346 | Ga0207640_10002859 | 3300025981 | Bacteria | 9263 |
| 347 | Ga0207640_10163170 | 3300025981 | Bacteria | 1651 |
| 348 | Ga0207640_10351592 | 3300025981 | Bacteria | 1184 |
| 349 | Ga0207640_11240346 | 3300025981 | Bacteria | 664 |
| 350 | Ga0207658_10000203 | 3300025986 | Bacteria | 61802 |
| 351 | Ga0207658_10003606 | 3300025986 | Bacteria | 10942 |
| 352 | Ga0207658_10078415 | 3300025986 | Bacteria | 2524 |
| 353 | Ga0207658_10174133 | 3300025986 | Bacteria | 1776 |
| 354 | Ga0207658_10274036 | 3300025986 | Bacteria | 1444 |
| 355 | Ga0207658_10324280 | 3300025986 | Bacteria | 1334 |
| 356 | Ga0207658_10383942 | 3300025986 | Bacteria | 1231 |
| 357 | Ga0207658_10522496 | 3300025986 | Bacteria | 1059 |
| 358 | Ga0207703_10194733 | 3300026035 | Bacteria | 1797 |
| 359 | Ga0207703_10776926 | 3300026035 | Bacteria | 913 |
| 360 | Ga0207639_10001623 | 3300026041 | Bacteria | 15128 |
| 361 | Ga0207639_10012389 | 3300026041 | Bacteria | 5938 |
| 362 | Ga0207639_10065784 | 3300026041 | Bacteria | 2815 |
| 363 | Ga0207639_10395498 | 3300026041 | Bacteria | 1244 |
| 364 | Ga0207639_10473616 | 3300026041 | Bacteria | 1140 |
| 365 | Ga0207639_10703982 | 3300026041 | Bacteria | 937 |
| 366 | Ga0207639_11225729 | 3300026041 | Bacteria | 704 |
| 367 | Ga0207639_11381209 | 3300026041 | Bacteria | 661 |
| 368 | Ga0207678_10037867 | 3300026067 | Bacteria | 4194 |
| 369 | Ga0207678_10318187 | 3300026067 | Bacteria | 1338 |
| 370 | Ga0207678_10682002 | 3300026067 | Bacteria | 904 |
| 371 | Ga0207678_10862460 | 3300026067 | Bacteria | 800 |
| 372 | Ga0207702_10093136 | 3300026078 | Bacteria | 2642 |
| 373 | Ga0207702_10653983 | 3300026078 | Bacteria | 1034 |
| 374 | Ga0207702_10664739 | 3300026078 | Bacteria | 1025 |
| 375 | Ga0207641_10285513 | 3300026088 | Bacteria | 1554 |
| 376 | Ga0207641_10554748 | 3300026088 | Bacteria | 1121 |
| 377 | Ga0207641_10944359 | 3300026088 | Bacteria | 857 |
| 378 | Ga0207676_10818263 | 3300026095 | Bacteria | 909 |
| 379 | Ga0207676_11513143 | 3300026095 | Bacteria | 668 |
| 380 | Ga0207674_10003674 | 3300026116 | Bacteria | 18726 |
| 381 | Ga0207674_10065273 | 3300026116 | Bacteria | 3669 |
| 382 | Ga0207674_10081340 | 3300026116 | Bacteria | 3241 |
| 383 | Ga0207674_10259572 | 3300026116 | Bacteria | 1685 |
| 384 | Ga0207675_100024396 | 3300026118 | Bacteria | 5623 |
| 385 | Ga0207698_10009630 | 3300026142 | Bacteria | 6170 |
| 386 | Ga0207698_10116776 | 3300026142 | Bacteria | 2249 |
| 387 | Ga0207698_10348760 | 3300026142 | Bacteria | 1397 |
| 388 | Ga0207698_10483344 | 3300026142 | Bacteria | 1202 |
| 389 | Ga0207698_11396527 | 3300026142 | Bacteria | 715 |
| 390 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 391 | Ga0268266_10022419 | 3300028379 | Bacteria | 5383 |
| 392 | Ga0268266_10284693 | 3300028379 | Bacteria | 1538 |
| 393 | Ga0268266_10373674 | 3300028379 | Bacteria | 1343 |
| 394 | Ga0268266_10387444 | 3300028379 | Bacteria | 1319 |
| 395 | Ga0268266_10810107 | 3300028379 | Bacteria | 905 |
| 396 | Ga0268266_11513682 | 3300028379 | Bacteria | 646 |
| 397 | Ga0268265_10000703 | 3300028380 | Bacteria | 32896 |
| 398 | Ga0268265_10027017 | 3300028380 | Bacteria | 4091 |
| 399 | Ga0268264_10071750 | 3300028381 | Bacteria | 2935 |
| 400 | Ga0268264_11015805 | 3300028381 | Bacteria | 836 |
| 401 | Ga0268264_11129888 | 3300028381 | Bacteria | 792 |
| 402 | Ga0307411_10445242 | 3300032005 | Bacteria | 1082 |
| 403 | Ga0373959_0025597 | 3300034820 | Bacteria | 1161 |
| 404 | Ga0395899_0256992 | 3300037312 | Bacteria | 1196 |
| 405 | Ga0395899_0317517 | 3300037312 | Bacteria | 1050 |
| 406 | Ga0395900_0099515 | 3300037418 | Bacteria | 2987 |
| 407 | Ga0395898_0000023 | 3300037466 | Bacteria | 379477 |
| 408 | Ga0395898_0000110 | 3300037466 | Bacteria | 217100 |
| 409 | Ga0395898_0593756 | 3300037466 | Bacteria | 1050 |
| 410 | Ga0395901_0002089 | 3300038443 | Bacteria | 20494 |
| 411 | Ga0395901_0109855 | 3300038443 | Bacteria | 2895 |
| 412 | Ga0395901_0167904 | 3300038443 | Bacteria | 2303 |
| 413 | Ga0451787_314151 | 3300041441 | Bacteria | 908 |
| 414 | Ga0451791_0664256 | 3300041451 | Bacteria | 2707 |
| 415 | Ga0451791_0696030 | 3300041451 | Bacteria | 3454 |
| 416 | Ga0451791_0831041 | 3300041451 | Bacteria | 942 |
| 417 | Ga0451791_1533604 | 3300041451 | Bacteria | 703 |
| 418 | Ga0451793_1514598 | 3300041452 | Bacteria | 609 |
| 419 | Ga0451795_1696294 | 3300041456 | Bacteria | 945 |
| 420 | Ga0451800_1313995 | 3300041459 | Bacteria | 1077 |
| 421 | Ga0451802_2085149 | 3300041460 | Bacteria | 3630 |
| 422 | Ga0451807_0271974 | 3300041486 | Bacteria | 980 |
| 423 | Ga0451807_0982744 | 3300041486 | Bacteria | 1317 |
| 424 | Ga0451837_0222153 | 3300041494 | Bacteria | 3374 |
| 425 | Ga0451847_0132680 | 3300041503 | Bacteria | 1030 |
| 426 | Ga0451849_1115349 | 3300041505 | Bacteria | 683 |
| 427 | Ga0451855_0855629 | 3300041511 | Bacteria | 978 |
| 428 | Ga0451855_1988188 | 3300041511 | Bacteria | 581 |
| 429 | Ga0451853_0551252 | 3300041512 | Bacteria | 622 |
| 430 | Ga0451853_1922382 | 3300041512 | Bacteria | 3699 |
| 431 | Ga0451853_2076092 | 3300041512 | Bacteria | 531 |
| 432 | Ga0451853_3257288 | 3300041512 | Bacteria | 706 |
| 433 | Ga0451853_3508447 | 3300041512 | Bacteria | 885 |
| 434 | Ga0451853_3583829 | 3300041512 | Unclassified | 988 |
| 435 | Ga0439437_009814 | 3300042000 | Bacteria | 1086 |
| 436 | Ga0439448_0001496 | 3300042005 | Bacteria | 6082 |
| 437 | Ga0466969_0049636 | 3300044656 | Bacteria | 2070 |
| 438 | Ga0466972_0002707 | 3300044658 | Bacteria | 8765 |
| 439 | Ga0466972_0017986 | 3300044658 | Bacteria | 3534 |
| 440 | Ga0466982_0000001 | 3300044672 | Bacteria | 514662 |
| 441 | Ga0466965_0008397 | 3300044683 | Bacteria | 4778 |
| 442 | Ga0466965_0052174 | 3300044683 | Bacteria | 2030 |
| 443 | Ga0466966_0002088 | 3300044684 | Bacteria | 12972 |
| 444 | Ga0466961_0010861 | 3300044693 | Bacteria | 5815 |
| 445 | Ga0466961_0014132 | 3300044693 | Bacteria | 5121 |
| 446 | Ga0466963_0134503 | 3300044694 | Bacteria | 1710 |
| 447 | Ga0466964_0003492 | 3300044706 | Bacteria | 5738 |
| 448 | Ga0466964_0071947 | 3300044706 | Bacteria | 1464 |
| 449 | Ga0466971_0009001 | 3300044719 | Bacteria | 4363 |
| 450 | Ga0466968_0033047 | 3300044735 | Bacteria | 2154 |
| 451 | Ga0466970_0002027 | 3300044765 | Bacteria | 9804 |
| 452 | Ga0466970_0059811 | 3300044765 | Bacteria | 2040 |
| 453 | Ga0466970_0301613 | 3300044765 | Bacteria | 903 |
| 454 | Ga0466957_0026653 | 3300044842 | Bacteria | 3430 |
| 455 | Ga0466957_0105204 | 3300044842 | Bacteria | 1783 |
| 456 | Ga0466957_0181326 | 3300044842 | Bacteria | 1375 |
| 457 | Ga0466960_0005888 | 3300044901 | Bacteria | 4886 |
| 458 | Ga0466959_0000213 | 3300045049 | Bacteria | 37533 |
| 459 | Ga0466959_0037803 | 3300045049 | Bacteria | 3567 |
| 460 | Ga0466959_0118473 | 3300045049 | Bacteria | 1884 |
| 461 | Ga0466959_0469096 | 3300045049 | Unclassified | 852 |
| 462 | Ga0466958_0004650 | 3300045836 | Bacteria | 7282 |
| 463 | Ga0466958_0009099 | 3300045836 | Bacteria | 5520 |
| 464 | Ga0466967_0506219 | 3300045976 | Bacteria | 1186 |
| 465 | Ga0466967_0764481 | 3300045976 | Bacteria | 958 |
| 466 | Ga0495638_0000201 | 3300046460 | Bacteria | 85006 |
| 467 | Ga0495638_0000208 | 3300046460 | Bacteria | 83214 |
| 468 | Ga0495650_0000112 | 3300046471 | Bacteria | 197339 |
| 469 | Ga0495606_0002080 | 3300046507 | Bacteria | 24428 |
| 470 | Ga0495622_0042981 | 3300046557 | Bacteria | 2101 |
| 471 | Ga0495625_0236545 | 3300046660 | Bacteria | 1191 |
| 472 | Ga0495649_0003176 | 3300046694 | Bacteria | 11231 |
| 473 | Ga0495686_0001992 | 3300047472 | Bacteria | 20283 |
| 474 | Ga0496101_0099998 | 3300048904 | Bacteria | 2169 |
| 475 | Ga0496102_0321823 | 3300048905 | Bacteria | 1457 |
| 476 | Ga0496103_0008538 | 3300048906 | Bacteria | 6088 |
| 477 | Ga0496104_0387725 | 3300048907 | Bacteria | 1309 |
| 478 | Ga0496115_0000008 | 3300048918 | Bacteria | 237485 |
| 479 | Ga0496115_0000135 | 3300048918 | Bacteria | 67733 |
| 480 | Ga0496115_0007937 | 3300048918 | Bacteria | 7831 |
| 481 | Ga0496115_0075498 | 3300048918 | Bacteria | 2738 |
| 482 | Ga0496115_0715633 | 3300048918 | Bacteria | 786 |
| 483 | Ga0496115_0747981 | 3300048918 | Bacteria | 765 |
| 484 | Ga0496117_0123689 | 3300048920 | Bacteria | 1583 |
| 485 | Ga0496117_0159391 | 3300048920 | Bacteria | 1324 |
| 486 | Ga0496118_0000673 | 3300048921 | Bacteria | 55557 |
| 487 | Ga0496118_0001581 | 3300048921 | Bacteria | 33785 |
| 488 | Ga0496118_0047452 | 3300048921 | Bacteria | 3328 |
| 489 | Ga0496121_0056975 | 3300048924 | Bacteria | 3242 |
| 490 | Ga0496122_0000142 | 3300048925 | Bacteria | 168391 |
| 491 | Ga0496123_0000148 | 3300048926 | Bacteria | 143265 |
| 492 | Ga0496123_0129923 | 3300048926 | Bacteria | 1398 |
| 493 | Ga0496125_0000118 | 3300048928 | Bacteria | 176551 |
| 494 | Ga0496125_0542479 | 3300048928 | Bacteria | 646 |
| 495 | Ga0496126_0038468 | 3300048929 | Bacteria | 4451 |
| 496 | Ga0496126_0046614 | 3300048929 | Bacteria | 3973 |
| 497 | Ga0496126_0065365 | 3300048929 | Bacteria | 3255 |
| 498 | Ga0496126_0093601 | 3300048929 | Bacteria | 2638 |
| 499 | Ga0496126_0262078 | 3300048929 | Bacteria | 1437 |
| 500 | Ga0495678_050868 | 3300049459 | Bacteria | 1604 |
| 501 | Ga0495682_0004030 | 3300049460 | Bacteria | 6392 |
| 502 | Ga0501031_0001060 | 3300049568 | Bacteria | 16696 |
| 503 | Ga0501031_0278876 | 3300049568 | Bacteria | 1084 |
| 504 | Ga0501031_0322752 | 3300049568 | Bacteria | 1000 |
| 505 | Ga0501031_0638302 | 3300049568 | Bacteria | 684 |
| 506 | Ga0501032_0001781 | 3300049569 | Bacteria | 17001 |
| 507 | Ga0501032_0356729 | 3300049569 | Bacteria | 941 |
| 508 | Ga0501033_0000434 | 3300049570 | Bacteria | 40122 |
| 509 | Ga0501033_0001474 | 3300049570 | Bacteria | 20818 |
| 510 | Ga0501033_0003824 | 3300049570 | Bacteria | 12251 |
| 511 | Ga0501033_0058978 | 3300049570 | Bacteria | 2834 |
| 512 | Ga0501033_1150443 | 3300049570 | Bacteria | 515 |
| 513 | Ga0501034_0002026 | 3300049571 | Bacteria | 25507 |
| 514 | Ga0501034_0002668 | 3300049571 | Bacteria | 21100 |
| 515 | Ga0501034_0017272 | 3300049571 | Bacteria | 7401 |
| 516 | Ga0501034_0263291 | 3300049571 | Bacteria | 1666 |
| 517 | Ga0501036_0029504 | 3300049572 | Bacteria | 4633 |
| 518 | Ga0501036_0055506 | 3300049572 | Bacteria | 3356 |
| 519 | Ga0501037_0002612 | 3300049573 | Bacteria | 13005 |
| 520 | Ga0501037_0005859 | 3300049573 | Bacteria | 8976 |
| 521 | Ga0501037_0010840 | 3300049573 | Bacteria | 6697 |
| 522 | Ga0501037_0054755 | 3300049573 | Bacteria | 2917 |
| 523 | Ga0501037_0092872 | 3300049573 | Bacteria | 2182 |
| 524 | Ga0501037_0105001 | 3300049573 | Bacteria | 2036 |
| 525 | Ga0501037_0268311 | 3300049573 | Bacteria | 1191 |
| 526 | Ga0501037_0308036 | 3300049573 | Bacteria | 1098 |
| 527 | Ga0501038_0003449 | 3300049574 | Bacteria | 14741 |
| 528 | Ga0501038_0003529 | 3300049574 | Bacteria | 14564 |
| 529 | Ga0501038_0103647 | 3300049574 | Bacteria | 2365 |
| 530 | Ga0501038_0661486 | 3300049574 | Bacteria | 785 |
| 531 | Ga0501039_0005510 | 3300049575 | Bacteria | 9573 |
| 532 | Ga0501039_0015618 | 3300049575 | Bacteria | 5810 |
| 533 | Ga0501039_0021639 | 3300049575 | Bacteria | 4933 |
| 534 | Ga0501039_0477963 | 3300049575 | Bacteria | 978 |
| 535 | Ga0501040_0168695 | 3300049576 | Bacteria | 1549 |
| 536 | Ga0501040_0271467 | 3300049576 | Bacteria | 1211 |
| 537 | Ga0501040_0379058 | 3300049576 | Bacteria | 1015 |
| 538 | Ga0501041_0948722 | 3300049577 | Bacteria | 553 |
| 539 | Ga0501042_0222785 | 3300049578 | Bacteria | 1360 |
| 540 | Ga0501042_0417959 | 3300049578 | Bacteria | 972 |
| 541 | Ga0501043_0005793 | 3300049579 | Bacteria | 9940 |
| 542 | Ga0501043_0017023 | 3300049579 | Bacteria | 5699 |
| 543 | Ga0501043_0022297 | 3300049579 | Bacteria | 4968 |
| 544 | Ga0501043_0033076 | 3300049579 | Bacteria | 4067 |
| 545 | Ga0501043_0056992 | 3300049579 | Bacteria | 3068 |
| 546 | Ga0501043_0172790 | 3300049579 | Bacteria | 1685 |
| 547 | Ga0501043_0230232 | 3300049579 | Bacteria | 1431 |
| 548 | Ga0501043_0512250 | 3300049579 | Bacteria | 895 |
| 549 | Ga0501046_0000433 | 3300049580 | Bacteria | 41959 |
| 550 | Ga0501046_0009071 | 3300049580 | Bacteria | 8624 |
| 551 | Ga0501046_0026664 | 3300049580 | Bacteria | 4719 |
| 552 | Ga0501046_0046193 | 3300049580 | Bacteria | 3457 |
| 553 | Ga0501047_0004697 | 3300049581 | Bacteria | 12841 |
| 554 | Ga0501047_0008200 | 3300049581 | Bacteria | 9868 |
| 555 | Ga0501047_0009306 | 3300049581 | Bacteria | 9277 |
| 556 | Ga0501047_0029664 | 3300049581 | Bacteria | 5273 |
| 557 | Ga0501047_0045586 | 3300049581 | Bacteria | 4240 |
| 558 | Ga0501047_0183158 | 3300049581 | Bacteria | 1960 |
| 559 | Ga0501047_0419035 | 3300049581 | Bacteria | 1170 |
| 560 | Ga0501048_0000620 | 3300049582 | Bacteria | 25293 |
| 561 | Ga0501048_0082913 | 3300049582 | Bacteria | 2261 |
| 562 | Ga0501048_0275379 | 3300049582 | Bacteria | 1196 |
| 563 | Ga0501048_0519801 | 3300049582 | Bacteria | 854 |
| 564 | Ga0501067_0016177 | 3300049583 | Bacteria | 4123 |
| 565 | Ga0501067_0339388 | 3300049583 | Bacteria | 837 |
| 566 | Ga0501068_0102322 | 3300049584 | Bacteria | 1776 |
| 567 | Ga0501068_0263945 | 3300049584 | Bacteria | 1098 |
| 568 | Ga0501068_0596574 | 3300049584 | Bacteria | 719 |
| 569 | Ga0501069_0019734 | 3300049585 | Bacteria | 3647 |
| 570 | Ga0501069_0155938 | 3300049585 | Bacteria | 1313 |
| 571 | Ga0501069_0615707 | 3300049585 | Bacteria | 652 |
| 572 | Ga0501070_0000863 | 3300049586 | Bacteria | 27570 |
| 573 | Ga0501070_0004345 | 3300049586 | Bacteria | 12184 |
| 574 | Ga0501070_0008384 | 3300049586 | Bacteria | 8731 |
| 575 | Ga0501070_0013645 | 3300049586 | Bacteria | 6845 |
| 576 | Ga0501070_0114267 | 3300049586 | Bacteria | 2230 |
| 577 | Ga0501070_0509434 | 3300049586 | Bacteria | 966 |
| 578 | Ga0501070_0555767 | 3300049586 | Unclassified | 918 |
| 579 | Ga0501071_0038372 | 3300049587 | Bacteria | 3423 |
| 580 | Ga0501071_0057565 | 3300049587 | Bacteria | 2809 |
| 581 | Ga0501072_0008627 | 3300049588 | Bacteria | 7735 |
| 582 | Ga0501072_0575694 | 3300049588 | Bacteria | 888 |
| 583 | Ga0501073_0001668 | 3300049589 | Bacteria | 16442 |
| 584 | Ga0501073_0082937 | 3300049589 | Bacteria | 2230 |
| 585 | Ga0501073_0090000 | 3300049589 | Bacteria | 2133 |
| 586 | Ga0501073_0181467 | 3300049589 | Bacteria | 1457 |
| 587 | Ga0501073_0209392 | 3300049589 | Bacteria | 1347 |
| 588 | Ga0501074_0005670 | 3300049590 | Bacteria | 8996 |
| 589 | Ga0501074_0431608 | 3300049590 | Bacteria | 934 |
| 590 | Ga0501074_0433414 | 3300049590 | Bacteria | 932 |
| 591 | Ga0501074_0500736 | 3300049590 | Bacteria | 860 |
| 592 | Ga0501075_0687908 | 3300049591 | Bacteria | 779 |
| 593 | Ga0501077_0131792 | 3300049593 | Bacteria | 1585 |
| 594 | Ga0501077_0727377 | 3300049593 | Bacteria | 638 |
| 595 | Ga0501079_0031326 | 3300049741 | Bacteria | 4086 |
| 596 | Ga0501079_0060312 | 3300049741 | Bacteria | 2926 |
| 597 | Ga0501079_0283889 | 3300049741 | Bacteria | 1294 |
| 598 | Ga0501080_0004884 | 3300049742 | Bacteria | 11947 |
| 599 | Ga0501080_0032486 | 3300049742 | Bacteria | 4868 |
| 600 | Ga0501080_0034312 | 3300049742 | Bacteria | 4735 |
| 601 | Ga0501080_0052219 | 3300049742 | Bacteria | 3804 |
| 602 | Ga0501080_0125324 | 3300049742 | Bacteria | 2379 |
| 603 | Ga0501080_0249279 | 3300049742 | Bacteria | 1619 |
| 604 | Ga0501080_0504057 | 3300049742 | Bacteria | 1081 |
| 605 | Ga0501080_0648742 | 3300049742 | Bacteria | 934 |
| 606 | Ga0501080_1062275 | 3300049742 | Bacteria | 700 |
| 607 | Ga0501081_0023882 | 3300049743 | Bacteria | 4101 |
| 608 | Ga0501083_0007573 | 3300049744 | Bacteria | 7693 |
| 609 | Ga0501083_0138335 | 3300049744 | Bacteria | 1595 |
| 610 | Ga0501035_0004461 | 3300049822 | Bacteria | 13279 |
| 611 | Ga0501035_0017079 | 3300049822 | Bacteria | 6686 |
| 612 | Ga0501035_0055982 | 3300049822 | Bacteria | 3520 |
| 613 | Ga0501035_0078712 | 3300049822 | Bacteria | 2911 |
| 614 | Ga0501035_0215692 | 3300049822 | Bacteria | 1640 |
| 615 | Ga0501035_0323369 | 3300049822 | Bacteria | 1295 |
| 616 | Ga0501035_0505282 | 3300049822 | Bacteria | 994 |
| 617 | Ga0501035_1028799 | 3300049822 | Bacteria | 646 |
| 618 | Ga0501044_0007108 | 3300049823 | Bacteria | 12314 |
| 619 | Ga0501044_0016825 | 3300049823 | Bacteria | 7846 |
| 620 | Ga0501044_0023397 | 3300049823 | Bacteria | 6571 |
| 621 | Ga0501044_0029647 | 3300049823 | Bacteria | 5768 |
| 622 | Ga0501044_0040555 | 3300049823 | Bacteria | 4851 |
| 623 | Ga0501044_0063782 | 3300049823 | Unclassified | 3762 |
| 624 | Ga0501044_0076307 | 3300049823 | Bacteria | 3402 |
| 625 | Ga0501044_0095864 | 3300049823 | Bacteria | 2989 |
| 626 | Ga0501044_0272952 | 3300049823 | Bacteria | 1626 |
| 627 | Ga0501044_0584437 | 3300049823 | Bacteria | 1011 |
| 628 | Ga0501045_0003570 | 3300049824 | Bacteria | 10679 |
| 629 | Ga0500610_0022773 | 3300053079 | Bacteria | 3093 |
| 630 | Ga0500651_0003648 | 3300053093 | Bacteria | 8464 |
| 631 | Ga0500651_0250831 | 3300053093 | Bacteria | 1029 |
| 632 | Ga0500559_0348853 | 3300053136 | Bacteria | 692 |
| 633 | Ga0500620_078199 | 3300053155 | Bacteria | 1144 |
| 634 | Ga0501084_0019087 | 3300054114 | Bacteria | 5710 |
| 635 | Ga0501084_0765875 | 3300054114 | Bacteria | 813 |
| 636 | Ga0501082_0004943 | 3300060353 | Bacteria | 11630 |
| 637 | Ga0501082_0053049 | 3300060353 | Bacteria | 3496 |
| 638 | Ga0501082_0218912 | 3300060353 | Bacteria | 1656 |
| 639 | Ga0466962_0002437 | 3300061719 | Bacteria | 8823 |
| 640 | Ga0530510_0330197 | 3300061734 | Bacteria | 1144 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005539 | Ga0068853_100034791 | Ga0068853_1000347914 | 135 |
| 2 | 3300026041 | Ga0207639_11225729 | Ga0207639_112257292 | 135 |
| 3 | 3300049570 | Ga0501033_1150443 | Ga0501033_1150443_26_496 | 135 |
| 4 | 3300049571 | Ga0501034_0017272 | Ga0501034_0017272_6255_6725 | 135 |
| 5 | 3300049572 | Ga0501036_0055506 | Ga0501036_0055506_556_1026 | 135 |
| 6 | 3300049573 | Ga0501037_0010840 | Ga0501037_0010840_1748_2218 | 135 |
| 7 | 3300049579 | Ga0501043_0033076 | Ga0501043_0033076_2092_2562 | 135 |
| 8 | 3300049586 | Ga0501070_0008384 | Ga0501070_0008384_2867_3337 | 135 |
| 9 | 3300049593 | Ga0501077_0131792 | Ga0501077_0131792_159_629 | 135 |
| 10 | 3300049822 | Ga0501035_0017079 | Ga0501035_0017079_3668_4138 | 135 |
| 11 | 3300049823 | Ga0501044_0076307 | Ga0501044_0076307_2300_2770 | 135 |
| 12 | 3300005341 | Ga0070691_10215119 | Ga0070691_102151192 | 137 |
| 13 | 3300005366 | Ga0070659_100074854 | Ga0070659_1000748544 | 137 |
| 14 | 3300005563 | Ga0068855_100229325 | Ga0068855_1002293254 | 137 |
| 15 | 3300009551 | Ga0105238_10125267 | Ga0105238_101252672 | 137 |
| 16 | 3300013100 | Ga0157373_10101344 | Ga0157373_101013443 | 137 |
| 17 | 3300013102 | Ga0157371_10085131 | Ga0157371_100851314 | 137 |
| 18 | 3300013104 | Ga0157370_10171695 | Ga0157370_101716952 | 137 |
| 19 | 3300013307 | Ga0157372_10011446 | Ga0157372_100114462 | 137 |
| 20 | 3300025932 | Ga0207690_10201926 | Ga0207690_102019262 | 137 |
| 21 | 3300026041 | Ga0207639_10065784 | Ga0207639_100657844 | 137 |
| 22 | 3300005335 | Ga0070666_10099798 | Ga0070666_100997982 | 140 |
| 23 | 3300005548 | Ga0070665_100016275 | Ga0070665_1000162758 | 140 |
| 24 | 3300025903 | Ga0207680_10393423 | Ga0207680_103934232 | 140 |
| 25 | 3300025986 | Ga0207658_10324280 | Ga0207658_103242801 | 140 |
| 26 | 3300028379 | Ga0268266_10022419 | Ga0268266_100224193 | 140 |
| 27 | 3300005327 | Ga0070658_10692495 | Ga0070658_106924951 | 143 |
| 28 | 3300005339 | Ga0070660_100457366 | Ga0070660_1004573662 | 143 |
| 29 | 3300005339 | Ga0070660_101042721 | Ga0070660_1010427212 | 143 |
| 30 | 3300005344 | Ga0070661_100028468 | Ga0070661_1000284683 | 143 |
| 31 | 3300005345 | Ga0070692_10017159 | Ga0070692_100171595 | 143 |
| 32 | 3300005435 | Ga0070714_100000070 | Ga0070714_10000007041 | 143 |
| 33 | 3300005444 | Ga0070694_100203539 | Ga0070694_1002035392 | 143 |
| 34 | 3300005563 | Ga0068855_101860799 | Ga0068855_1018607991 | 143 |
| 35 | 3300005614 | Ga0068856_100059168 | Ga0068856_1000591684 | 143 |
| 36 | 3300005616 | Ga0068852_100597119 | Ga0068852_1005971191 | 143 |
| 37 | 3300009551 | Ga0105238_10305686 | Ga0105238_103056862 | 143 |
| 38 | 3300009551 | Ga0105238_11075410 | Ga0105238_110754102 | 143 |
| 39 | 3300010375 | Ga0105239_10172476 | Ga0105239_101724761 | 143 |
| 40 | 3300010375 | Ga0105239_10244488 | Ga0105239_102444884 | 143 |
| 41 | 3300013102 | Ga0157371_10749137 | Ga0157371_107491372 | 143 |
| 42 | 3300013102 | Ga0157371_10935835 | Ga0157371_109358352 | 143 |
| 43 | 3300013307 | Ga0157372_11801917 | Ga0157372_118019171 | 143 |
| 44 | 3300014497 | Ga0182008_10558257 | Ga0182008_105582571 | 143 |
| 45 | 3300015261 | Ga0182006_1191793 | Ga0182006_11917931 | 143 |
| 46 | 3300015262 | Ga0182007_10194687 | Ga0182007_101946872 | 143 |
| 47 | 3300015262 | Ga0182007_10247961 | Ga0182007_102479612 | 143 |
| 48 | 3300025904 | Ga0207647_10014847 | Ga0207647_100148478 | 143 |
| 49 | 3300025929 | Ga0207664_10000068 | Ga0207664_1000006840 | 143 |
| 50 | 3300025932 | Ga0207690_10009636 | Ga0207690_100096362 | 143 |
| 51 | 3300025932 | Ga0207690_10328491 | Ga0207690_103284912 | 143 |
| 52 | 3300025933 | Ga0207706_10010243 | Ga0207706_100102436 | 143 |
| 53 | 3300025949 | Ga0207667_10110806 | Ga0207667_101108062 | 143 |
| 54 | 3300026041 | Ga0207639_11381209 | Ga0207639_113812091 | 143 |
| 55 | 3300026078 | Ga0207702_10093136 | Ga0207702_100931363 | 143 |
| 56 | 3300049586 | Ga0501070_0509434 | Ga0501070_0509434_480_941 | 143 |
| 57 | 3300013104 | Ga0157370_10295008 | Ga0157370_102950082 | 144 |
| 58 | 3300015262 | Ga0182007_10053649 | Ga0182007_100536492 | 144 |
| 59 | 3300015262 | Ga0182007_10208623 | Ga0182007_102086232 | 144 |
| 60 | 3300015262 | Ga0182007_10211161 | Ga0182007_102111612 | 144 |
| 61 | 3300038443 | Ga0395901_0109855 | Ga0395901_0109855_83_553 | 144 |
| 62 | 3300046471 | Ga0495650_0000112 | Ga0495650_0000112_127208_127678 | 144 |
| 63 | 3300005337 | Ga0070682_101235436 | Ga0070682_1012354361 | 145 |
| 64 | 3300005344 | Ga0070661_100028400 | Ga0070661_1000284005 | 145 |
| 65 | 3300005458 | Ga0070681_10000799 | Ga0070681_1000079925 | 145 |
| 66 | 3300005843 | Ga0068860_100108360 | Ga0068860_1001083604 | 145 |
| 67 | 3300005844 | Ga0068862_100069457 | Ga0068862_1000694573 | 145 |
| 68 | 3300009551 | Ga0105238_10035681 | Ga0105238_100356813 | 145 |
| 69 | 3300025909 | Ga0207705_11422709 | Ga0207705_114227091 | 145 |
| 70 | 3300025912 | Ga0207707_10000626 | Ga0207707_1000062620 | 145 |
| 71 | 3300025920 | Ga0207649_10041309 | Ga0207649_100413094 | 145 |
| 72 | 3300025986 | Ga0207658_10383942 | Ga0207658_103839421 | 145 |
| 73 | 3300026067 | Ga0207678_10862460 | Ga0207678_108624601 | 145 |
| 74 | 3300028381 | Ga0268264_11129888 | Ga0268264_111298882 | 145 |
| 75 | 3300046460 | Ga0495638_0000201 | Ga0495638_0000201_39496_39966 | 145 |
| 76 | 3300048918 | Ga0496115_0007937 | Ga0496115_0007937_2031_2501 | 145 |
| 77 | 3300048928 | Ga0496125_0542479 | Ga0496125_0542479_106_576 | 145 |
| 78 | 3300048929 | Ga0496126_0038468 | Ga0496126_0038468_328_798 | 145 |
| 79 | 3300049573 | Ga0501037_0268311 | Ga0501037_0268311_64_528 | 145 |
| 80 | 3300049590 | Ga0501074_0431608 | Ga0501074_0431608_39_503 | 145 |
| 81 | 3300049742 | Ga0501080_0125324 | Ga0501080_0125324_1885_2349 | 145 |
| 82 | 3300049822 | Ga0501035_1028799 | Ga0501035_1028799_30_494 | 145 |
| 83 | 3300049823 | Ga0501044_0023397 | Ga0501044_0023397_3634_4098 | 145 |
| 84 | 3300005337 | Ga0070682_100024425 | Ga0070682_1000244255 | 146 |
| 85 | 3300005366 | Ga0070659_100001431 | Ga0070659_10000143114 | 146 |
| 86 | 3300005458 | Ga0070681_10042888 | Ga0070681_100428884 | 146 |
| 87 | 3300009551 | Ga0105238_11624025 | Ga0105238_116240251 | 146 |
| 88 | 3300013307 | Ga0157372_10057339 | Ga0157372_100573392 | 146 |
| 89 | 3300025912 | Ga0207707_10047538 | Ga0207707_100475382 | 146 |
| 90 | 3300025921 | Ga0207652_10144803 | Ga0207652_101448033 | 146 |
| 91 | 3300025932 | Ga0207690_10002033 | Ga0207690_100020337 | 146 |
| 92 | 3300038443 | Ga0395901_0167904 | Ga0395901_0167904_312_782 | 146 |
| 93 | 3300042000 | Ga0439437_009814 | Ga0439437_009814_174_644 | 146 |
| 94 | 3300048918 | Ga0496115_0715633 | Ga0496115_0715633_116_592 | 146 |
| 95 | 3300049568 | Ga0501031_0278876 | Ga0501031_0278876_280_750 | 146 |
| 96 | 3300049568 | Ga0501031_0638302 | Ga0501031_0638302_53_523 | 146 |
| 97 | 3300049569 | Ga0501032_0356729 | Ga0501032_0356729_163_633 | 146 |
| 98 | 3300049570 | Ga0501033_0000434 | Ga0501033_0000434_30248_30718 | 146 |
| 99 | 3300049573 | Ga0501037_0054755 | Ga0501037_0054755_315_785 | 146 |
| 100 | 3300049573 | Ga0501037_0092872 | Ga0501037_0092872_575_1045 | 146 |
| 101 | 3300049574 | Ga0501038_0103647 | Ga0501038_0103647_1098_1568 | 146 |
| 102 | 3300049574 | Ga0501038_0661486 | Ga0501038_0661486_278_748 | 146 |
| 103 | 3300049575 | Ga0501039_0477963 | Ga0501039_0477963_309_779 | 146 |
| 104 | 3300049576 | Ga0501040_0379058 | Ga0501040_0379058_163_633 | 146 |
| 105 | 3300049577 | Ga0501041_0948722 | Ga0501041_0948722_32_502 | 146 |
| 106 | 3300049578 | Ga0501042_0417959 | Ga0501042_0417959_157_627 | 146 |
| 107 | 3300049579 | Ga0501043_0022297 | Ga0501043_0022297_2749_3219 | 146 |
| 108 | 3300049579 | Ga0501043_0230232 | Ga0501043_0230232_561_1031 | 146 |
| 109 | 3300049580 | Ga0501046_0026664 | Ga0501046_0026664_446_916 | 146 |
| 110 | 3300049581 | Ga0501047_0004697 | Ga0501047_0004697_7871_8341 | 146 |
| 111 | 3300049581 | Ga0501047_0419035 | Ga0501047_0419035_17_487 | 146 |
| 112 | 3300049582 | Ga0501048_0275379 | Ga0501048_0275379_518_988 | 146 |
| 113 | 3300049589 | Ga0501073_0181467 | Ga0501073_0181467_590_1060 | 146 |
| 114 | 3300049742 | Ga0501080_0504057 | Ga0501080_0504057_414_884 | 146 |
| 115 | 3300049822 | Ga0501035_0055982 | Ga0501035_0055982_357_827 | 146 |
| 116 | 3300049822 | Ga0501035_0323369 | Ga0501035_0323369_14_484 | 146 |
| 117 | 3300049823 | Ga0501044_0007108 | Ga0501044_0007108_4404_4874 | 146 |
| 118 | 3300049823 | Ga0501044_0272952 | Ga0501044_0272952_410_880 | 146 |
| 119 | 3300005455 | Ga0070663_100055413 | Ga0070663_1000554133 | 147 |
| 120 | 3300009545 | Ga0105237_10093432 | Ga0105237_100934322 | 147 |
| 121 | 3300025272 | Ga0209455_1008009 | Ga0209455_10080092 | 147 |
| 122 | 3300037312 | Ga0395899_0317517 | Ga0395899_0317517_239_709 | 147 |
| 123 | 3300037418 | Ga0395900_0099515 | Ga0395900_0099515_1294_1764 | 147 |
| 124 | 3300037466 | Ga0395898_0593756 | Ga0395898_0593756_340_810 | 147 |
| 125 | 3300038443 | Ga0395901_0002089 | Ga0395901_0002089_19063_19533 | 147 |
| 126 | 3300048929 | Ga0496126_0065365 | Ga0496126_0065365_1846_2322 | 147 |
| 127 | 3300046460 | Ga0495638_0000208 | Ga0495638_0000208_51957_52433 | 148 |
| 128 | 3300046507 | Ga0495606_0002080 | Ga0495606_0002080_3294_3770 | 148 |
| 129 | 3300046557 | Ga0495622_0042981 | Ga0495622_0042981_1530_2006 | 148 |
| 130 | 3300046694 | Ga0495649_0003176 | Ga0495649_0003176_7303_7779 | 148 |
| 131 | 3300048918 | Ga0496115_0000135 | Ga0496115_0000135_31240_31716 | 148 |
| 132 | 3300048929 | Ga0496126_0046614 | Ga0496126_0046614_1846_2322 | 148 |
| 133 | 3300049459 | Ga0495678_050868 | Ga0495678_050868_530_1006 | 148 |
| 134 | 3300049460 | Ga0495682_0004030 | Ga0495682_0004030_2856_3332 | 148 |
| 135 | 3300002737 | JGI25162J39368_1000837 | JGI25162J39368_10008375 | 149 |
| 136 | 3300002741 | JGI25157J39369_1000177 | JGI25157J39369_100017738 | 149 |
| 137 | 3300002771 | JGI25163J39215_1002314 | JGI25163J39215_10023142 | 149 |
| 138 | 3300002772 | JGI25164J39214_1000159 | JGI25164J39214_100015927 | 149 |
| 139 | 3300003214 | JGI25165J46597_1000287 | JGI25165J46597_100028727 | 149 |
| 140 | 3300003751 | Ga0055538_1001479 | Ga0055538_10014792 | 149 |
| 141 | 3300003761 | Ga0055535_1000329 | Ga0055535_100032921 | 149 |
| 142 | 3300003762 | Ga0055542_1000547 | Ga0055542_10005475 | 149 |
| 143 | 3300003763 | Ga0055529_1000108 | Ga0055529_100010827 | 149 |
| 144 | 3300025206 | Ga0209435_107095 | Ga0209435_1070951 | 149 |
| 145 | 3300025207 | Ga0209760_100925 | Ga0209760_1009255 | 149 |
| 146 | 3300025224 | Ga0209784_100076 | Ga0209784_10007641 | 149 |
| 147 | 3300025225 | Ga0209566_102527 | Ga0209566_1025272 | 149 |
| 148 | 3300025228 | Ga0209672_110225 | Ga0209672_1102253 | 149 |
| 149 | 3300025231 | Ga0207427_100097 | Ga0207427_10009727 | 149 |
| 150 | 3300025233 | Ga0209437_100116 | Ga0209437_10011694 | 149 |
| 151 | 3300025242 | Ga0209258_100214 | Ga0209258_10021427 | 149 |
| 152 | 3300025246 | Ga0209646_1000512 | Ga0209646_100051212 | 149 |
| 153 | 3300025250 | Ga0209026_1000152 | Ga0209026_100015293 | 149 |
| 154 | 3300025254 | Ga0209148_1000047 | Ga0209148_1000047170 | 149 |
| 155 | 3300025256 | Ga0209759_1000477 | Ga0209759_100047738 | 149 |
| 156 | 3300025256 | Ga0209759_1002664 | Ga0209759_10026648 | 149 |
| 157 | 3300025261 | Ga0209233_1000100 | Ga0209233_1000100100 | 149 |
| 158 | 3300025261 | Ga0209233_1024946 | Ga0209233_10249462 | 149 |
| 159 | 3300025272 | Ga0209455_1000056 | Ga0209455_100005694 | 149 |
| 160 | iso_pu_bacteria | 2537561836 | 2538833666 | 152 |
| 161 | iso_pu_bacteria | 2643221577 | 2643896516 | 152 |
| 162 | iso_pu_bacteria | 2643221685 | 2644478727 | 152 |
| 163 | iso_pu_bacteria | 2895395659 | 2895398237 | 152 |
| 164 | iso_pu_bacteria | 2939611941 | 2939613168 | 152 |
| 165 | 3300044683 | Ga0466965_0008397 | Ga0466965_0008397_3726_4187 | 153 |
| 166 | 3300044842 | Ga0466957_0026653 | Ga0466957_0026653_12_473 | 153 |
| 167 | 3300044842 | Ga0466957_0105204 | Ga0466957_0105204_315_776 | 153 |
| 168 | 3300045049 | Ga0466959_0469096 | Ga0466959_0469096_201_662 | 153 |
| 169 | 3300045836 | Ga0466958_0009099 | Ga0466958_0009099_3844_4305 | 153 |
| 170 | 3300005327 | Ga0070658_10056111 | Ga0070658_100561113 | 154 |
| 171 | 3300005328 | Ga0070676_10332751 | Ga0070676_103327512 | 154 |
| 172 | 3300005331 | Ga0070670_100361288 | Ga0070670_1003612881 | 154 |
| 173 | 3300005334 | Ga0068869_101075893 | Ga0068869_1010758931 | 154 |
| 174 | 3300005335 | Ga0070666_10057963 | Ga0070666_100579632 | 154 |
| 175 | 3300005337 | Ga0070682_100314597 | Ga0070682_1003145972 | 154 |
| 176 | 3300005338 | Ga0068868_100076880 | Ga0068868_1000768803 | 154 |
| 177 | 3300005339 | Ga0070660_101173520 | Ga0070660_1011735201 | 154 |
| 178 | 3300005344 | Ga0070661_100168671 | Ga0070661_1001686712 | 154 |
| 179 | 3300005344 | Ga0070661_100277416 | Ga0070661_1002774162 | 154 |
| 180 | 3300005344 | Ga0070661_100384553 | Ga0070661_1003845532 | 154 |
| 181 | 3300005344 | Ga0070661_100441298 | Ga0070661_1004412982 | 154 |
| 182 | 3300005345 | Ga0070692_10013248 | Ga0070692_100132483 | 154 |
| 183 | 3300005345 | Ga0070692_10153253 | Ga0070692_101532532 | 154 |
| 184 | 3300005347 | Ga0070668_100048132 | Ga0070668_1000481322 | 154 |
| 185 | 3300005347 | Ga0070668_100621448 | Ga0070668_1006214482 | 154 |
| 186 | 3300005347 | Ga0070668_102194901 | Ga0070668_1021949011 | 154 |
| 187 | 3300005355 | Ga0070671_100084270 | Ga0070671_1000842703 | 154 |
| 188 | 3300005355 | Ga0070671_100862100 | Ga0070671_1008621001 | 154 |
| 189 | 3300005356 | Ga0070674_100205078 | Ga0070674_1002050782 | 154 |
| 190 | 3300005364 | Ga0070673_100103345 | Ga0070673_1001033452 | 154 |
| 191 | 3300005366 | Ga0070659_100356007 | Ga0070659_1003560072 | 154 |
| 192 | 3300005367 | Ga0070667_100000243 | Ga0070667_1000002433 | 154 |
| 193 | 3300005367 | Ga0070667_100007499 | Ga0070667_10000749910 | 154 |
| 194 | 3300005367 | Ga0070667_100021449 | Ga0070667_1000214494 | 154 |
| 195 | 3300005367 | Ga0070667_100067079 | Ga0070667_1000670792 | 154 |
| 196 | 3300005367 | Ga0070667_100331525 | Ga0070667_1003315252 | 154 |
| 197 | 3300005367 | Ga0070667_100674261 | Ga0070667_1006742613 | 154 |
| 198 | 3300005434 | Ga0070709_10669666 | Ga0070709_106696662 | 154 |
| 199 | 3300005455 | Ga0070663_100640920 | Ga0070663_1006409201 | 154 |
| 200 | 3300005455 | Ga0070663_101767430 | Ga0070663_1017674301 | 154 |
| 201 | 3300005458 | Ga0070681_10650872 | Ga0070681_106508722 | 154 |
| 202 | 3300005466 | Ga0070685_10849339 | Ga0070685_108493391 | 154 |
| 203 | 3300005535 | Ga0070684_100148945 | Ga0070684_1001489453 | 154 |
| 204 | 3300005535 | Ga0070684_100331999 | Ga0070684_1003319992 | 154 |
| 205 | 3300005535 | Ga0070684_100446831 | Ga0070684_1004468313 | 154 |
| 206 | 3300005539 | Ga0068853_100001964 | Ga0068853_10000196410 | 154 |
| 207 | 3300005539 | Ga0068853_100018102 | Ga0068853_1000181029 | 154 |
| 208 | 3300005539 | Ga0068853_100018189 | Ga0068853_1000181896 | 154 |
| 209 | 3300005539 | Ga0068853_100047092 | Ga0068853_1000470924 | 154 |
| 210 | 3300005539 | Ga0068853_100182912 | Ga0068853_1001829123 | 154 |
| 211 | 3300005539 | Ga0068853_100194108 | Ga0068853_1001941082 | 154 |
| 212 | 3300005539 | Ga0068853_101540344 | Ga0068853_1015403441 | 154 |
| 213 | 3300005546 | Ga0070696_100145366 | Ga0070696_1001453662 | 154 |
| 214 | 3300005547 | Ga0070693_100050344 | Ga0070693_1000503443 | 154 |
| 215 | 3300005548 | Ga0070665_100000126 | Ga0070665_100000126120 | 154 |
| 216 | 3300005548 | Ga0070665_100052121 | Ga0070665_1000521213 | 154 |
| 217 | 3300005548 | Ga0070665_100096902 | Ga0070665_1000969024 | 154 |
| 218 | 3300005548 | Ga0070665_100772577 | Ga0070665_1007725772 | 154 |
| 219 | 3300005548 | Ga0070665_101182220 | Ga0070665_1011822202 | 154 |
| 220 | 3300005563 | Ga0068855_100026134 | Ga0068855_1000261348 | 154 |
| 221 | 3300005563 | Ga0068855_100128818 | Ga0068855_1001288182 | 154 |
| 222 | 3300005563 | Ga0068855_100336141 | Ga0068855_1003361411 | 154 |
| 223 | 3300005563 | Ga0068855_100377635 | Ga0068855_1003776353 | 154 |
| 224 | 3300005563 | Ga0068855_100575517 | Ga0068855_1005755173 | 154 |
| 225 | 3300005563 | Ga0068855_101515468 | Ga0068855_1015154682 | 154 |
| 226 | 3300005564 | Ga0070664_100037916 | Ga0070664_1000379163 | 154 |
| 227 | 3300005577 | Ga0068857_100098116 | Ga0068857_1000981162 | 154 |
| 228 | 3300005577 | Ga0068857_100148003 | Ga0068857_1001480032 | 154 |
| 229 | 3300005577 | Ga0068857_100414861 | Ga0068857_1004148611 | 154 |
| 230 | 3300005578 | Ga0068854_100353302 | Ga0068854_1003533023 | 154 |
| 231 | 3300005578 | Ga0068854_100814373 | Ga0068854_1008143732 | 154 |
| 232 | 3300005614 | Ga0068856_100194594 | Ga0068856_1001945943 | 154 |
| 233 | 3300005614 | Ga0068856_100770724 | Ga0068856_1007707242 | 154 |
| 234 | 3300005616 | Ga0068852_100176686 | Ga0068852_1001766863 | 154 |
| 235 | 3300005616 | Ga0068852_100310026 | Ga0068852_1003100262 | 154 |
| 236 | 3300005617 | Ga0068859_100000374 | Ga0068859_10000037434 | 154 |
| 237 | 3300005618 | Ga0068864_100292612 | Ga0068864_1002926122 | 154 |
| 238 | 3300005618 | Ga0068864_100380406 | Ga0068864_1003804062 | 154 |
| 239 | 3300005719 | Ga0068861_100021160 | Ga0068861_1000211602 | 154 |
| 240 | 3300005834 | Ga0068851_10007468 | Ga0068851_100074684 | 154 |
| 241 | 3300005834 | Ga0068851_10096668 | Ga0068851_100966682 | 154 |
| 242 | 3300005841 | Ga0068863_100013853 | Ga0068863_1000138538 | 154 |
| 243 | 3300005841 | Ga0068863_100041607 | Ga0068863_1000416072 | 154 |
| 244 | 3300005841 | Ga0068863_100123462 | Ga0068863_1001234624 | 154 |
| 245 | 3300005842 | Ga0068858_100067218 | Ga0068858_1000672182 | 154 |
| 246 | 3300005844 | Ga0068862_100000144 | Ga0068862_10000014480 | 154 |
| 247 | 3300005844 | Ga0068862_100399261 | Ga0068862_1003992612 | 154 |
| 248 | 3300005937 | Ga0081455_10111456 | Ga0081455_101114563 | 154 |
| 249 | 3300005983 | Ga0081540_1004609 | Ga0081540_10046099 | 154 |
| 250 | 3300006237 | Ga0097621_100023103 | Ga0097621_1000231034 | 154 |
| 251 | 3300006237 | Ga0097621_100034619 | Ga0097621_1000346193 | 154 |
| 252 | 3300006237 | Ga0097621_100082453 | Ga0097621_1000824532 | 154 |
| 253 | 3300006358 | Ga0068871_100078781 | Ga0068871_1000787814 | 154 |
| 254 | 3300006358 | Ga0068871_100682698 | Ga0068871_1006826982 | 154 |
| 255 | 3300006931 | Ga0097620_100000374 | Ga0097620_10000037434 | 154 |
| 256 | 3300009093 | Ga0105240_10223859 | Ga0105240_102238593 | 154 |
| 257 | 3300009101 | Ga0105247_10313483 | Ga0105247_103134832 | 154 |
| 258 | 3300009545 | Ga0105237_10000318 | Ga0105237_1000031841 | 154 |
| 259 | 3300009545 | Ga0105237_10159201 | Ga0105237_101592012 | 154 |
| 260 | 3300009545 | Ga0105237_10339705 | Ga0105237_103397053 | 154 |
| 261 | 3300009545 | Ga0105237_10455940 | Ga0105237_104559402 | 154 |
| 262 | 3300009545 | Ga0105237_11843911 | Ga0105237_118439111 | 154 |
| 263 | 3300009551 | Ga0105238_10012695 | Ga0105238_100126952 | 154 |
| 264 | 3300009551 | Ga0105238_10572334 | Ga0105238_105723343 | 154 |
| 265 | 3300009553 | Ga0105249_10024522 | Ga0105249_100245222 | 154 |
| 266 | 3300010375 | Ga0105239_10083550 | Ga0105239_100835504 | 154 |
| 267 | 3300010375 | Ga0105239_10212246 | Ga0105239_102122462 | 154 |
| 268 | 3300010375 | Ga0105239_11223471 | Ga0105239_112234711 | 154 |
| 269 | 3300013104 | Ga0157370_10174310 | Ga0157370_101743102 | 154 |
| 270 | 3300013104 | Ga0157370_10406359 | Ga0157370_104063592 | 154 |
| 271 | 3300013296 | Ga0157374_10429564 | Ga0157374_104295643 | 154 |
| 272 | 3300013296 | Ga0157374_10701725 | Ga0157374_107017252 | 154 |
| 273 | 3300013307 | Ga0157372_10032397 | Ga0157372_100323974 | 154 |
| 274 | 3300013307 | Ga0157372_10218999 | Ga0157372_102189992 | 154 |
| 275 | 3300013307 | Ga0157372_11747357 | Ga0157372_117473571 | 154 |
| 276 | 3300013308 | Ga0157375_10289862 | Ga0157375_102898621 | 154 |
| 277 | 3300014325 | Ga0163163_10035757 | Ga0163163_100357575 | 154 |
| 278 | 3300014968 | Ga0157379_10085790 | Ga0157379_100857904 | 154 |
| 279 | 3300014968 | Ga0157379_10843614 | Ga0157379_108436142 | 154 |
| 280 | 3300014969 | Ga0157376_10290210 | Ga0157376_102902102 | 154 |
| 281 | 3300014969 | Ga0157376_10455104 | Ga0157376_104551042 | 154 |
| 282 | 3300014969 | Ga0157376_11071284 | Ga0157376_110712841 | 154 |
| 283 | 3300014969 | Ga0157376_11552913 | Ga0157376_115529131 | 154 |
| 284 | 3300020070 | Ga0206356_10126730 | Ga0206356_101267307 | 154 |
| 285 | 3300020080 | Ga0206350_10185836 | Ga0206350_101858363 | 154 |
| 286 | 3300020082 | Ga0206353_10150174 | Ga0206353_101501741 | 154 |
| 287 | 3300020610 | Ga0154015_1137588 | Ga0154015_11375882 | 154 |
| 288 | 3300025303 | Ga0209051_1031958 | Ga0209051_10319582 | 154 |
| 289 | 3300025321 | Ga0207656_10189696 | Ga0207656_101896962 | 154 |
| 290 | 3300025900 | Ga0207710_10217492 | Ga0207710_102174922 | 154 |
| 291 | 3300025903 | Ga0207680_10024378 | Ga0207680_100243784 | 154 |
| 292 | 3300025903 | Ga0207680_10038708 | Ga0207680_100387083 | 154 |
| 293 | 3300025904 | Ga0207647_10001467 | Ga0207647_100014674 | 154 |
| 294 | 3300025904 | Ga0207647_10367630 | Ga0207647_103676302 | 154 |
| 295 | 3300025907 | Ga0207645_10044128 | Ga0207645_100441284 | 154 |
| 296 | 3300025909 | Ga0207705_10112912 | Ga0207705_101129122 | 154 |
| 297 | 3300025912 | Ga0207707_10000976 | Ga0207707_1000097627 | 154 |
| 298 | 3300025912 | Ga0207707_10084557 | Ga0207707_100845573 | 154 |
| 299 | 3300025912 | Ga0207707_10762238 | Ga0207707_107622382 | 154 |
| 300 | 3300025913 | Ga0207695_10137764 | Ga0207695_101377643 | 154 |
| 301 | 3300025913 | Ga0207695_10668430 | Ga0207695_106684301 | 154 |
| 302 | 3300025914 | Ga0207671_10000618 | Ga0207671_1000061816 | 154 |
| 303 | 3300025914 | Ga0207671_10397320 | Ga0207671_103973201 | 154 |
| 304 | 3300025917 | Ga0207660_10005591 | Ga0207660_100055912 | 154 |
| 305 | 3300025917 | Ga0207660_10364093 | Ga0207660_103640932 | 154 |
| 306 | 3300025920 | Ga0207649_10008623 | Ga0207649_100086232 | 154 |
| 307 | 3300025920 | Ga0207649_10011831 | Ga0207649_100118312 | 154 |
| 308 | 3300025920 | Ga0207649_10056315 | Ga0207649_100563152 | 154 |
| 309 | 3300025920 | Ga0207649_10181318 | Ga0207649_101813182 | 154 |
| 310 | 3300025921 | Ga0207652_10022193 | Ga0207652_100221937 | 154 |
| 311 | 3300025921 | Ga0207652_10332329 | Ga0207652_103323291 | 154 |
| 312 | 3300025924 | Ga0207694_10802159 | Ga0207694_108021592 | 154 |
| 313 | 3300025925 | Ga0207650_10061491 | Ga0207650_100614911 | 154 |
| 314 | 3300025931 | Ga0207644_10592008 | Ga0207644_105920081 | 154 |
| 315 | 3300025932 | Ga0207690_10617374 | Ga0207690_106173742 | 154 |
| 316 | 3300025933 | Ga0207706_10269614 | Ga0207706_102696141 | 154 |
| 317 | 3300025935 | Ga0207709_10400340 | Ga0207709_104003401 | 154 |
| 318 | 3300025938 | Ga0207704_10140526 | Ga0207704_101405262 | 154 |
| 319 | 3300025938 | Ga0207704_10920183 | Ga0207704_109201832 | 154 |
| 320 | 3300025940 | Ga0207691_10038146 | Ga0207691_100381464 | 154 |
| 321 | 3300025941 | Ga0207711_10229881 | Ga0207711_102298811 | 154 |
| 322 | 3300025942 | Ga0207689_10050054 | Ga0207689_100500545 | 154 |
| 323 | 3300025942 | Ga0207689_10164296 | Ga0207689_101642963 | 154 |
| 324 | 3300025942 | Ga0207689_10822388 | Ga0207689_108223881 | 154 |
| 325 | 3300025944 | Ga0207661_10054030 | Ga0207661_100540303 | 154 |
| 326 | 3300025945 | Ga0207679_10162058 | Ga0207679_101620581 | 154 |
| 327 | 3300025949 | Ga0207667_10006296 | Ga0207667_1000629610 | 154 |
| 328 | 3300025949 | Ga0207667_10085064 | Ga0207667_100850641 | 154 |
| 329 | 3300025949 | Ga0207667_10088020 | Ga0207667_100880202 | 154 |
| 330 | 3300025949 | Ga0207667_10198618 | Ga0207667_101986182 | 154 |
| 331 | 3300025949 | Ga0207667_10219471 | Ga0207667_102194712 | 154 |
| 332 | 3300025949 | Ga0207667_10314674 | Ga0207667_103146742 | 154 |
| 333 | 3300025960 | Ga0207651_10836456 | Ga0207651_108364562 | 154 |
| 334 | 3300025961 | Ga0207712_10103347 | Ga0207712_101033472 | 154 |
| 335 | 3300025972 | Ga0207668_10290679 | Ga0207668_102906792 | 154 |
| 336 | 3300025972 | Ga0207668_10593870 | Ga0207668_105938702 | 154 |
| 337 | 3300025972 | Ga0207668_10864123 | Ga0207668_108641231 | 154 |
| 338 | 3300025981 | Ga0207640_10163170 | Ga0207640_101631702 | 154 |
| 339 | 3300025981 | Ga0207640_10351592 | Ga0207640_103515922 | 154 |
| 340 | 3300025981 | Ga0207640_11240346 | Ga0207640_112403462 | 154 |
| 341 | 3300025986 | Ga0207658_10000203 | Ga0207658_100002033 | 154 |
| 342 | 3300025986 | Ga0207658_10003606 | Ga0207658_1000360611 | 154 |
| 343 | 3300025986 | Ga0207658_10078415 | Ga0207658_100784152 | 154 |
| 344 | 3300025986 | Ga0207658_10174133 | Ga0207658_101741332 | 154 |
| 345 | 3300025986 | Ga0207658_10274036 | Ga0207658_102740362 | 154 |
| 346 | 3300025986 | Ga0207658_10522496 | Ga0207658_105224961 | 154 |
| 347 | 3300026035 | Ga0207703_10776926 | Ga0207703_107769261 | 154 |
| 348 | 3300026041 | Ga0207639_10001623 | Ga0207639_1000162310 | 154 |
| 349 | 3300026041 | Ga0207639_10012389 | Ga0207639_100123898 | 154 |
| 350 | 3300026041 | Ga0207639_10395498 | Ga0207639_103954981 | 154 |
| 351 | 3300026041 | Ga0207639_10473616 | Ga0207639_104736161 | 154 |
| 352 | 3300026041 | Ga0207639_10703982 | Ga0207639_107039821 | 154 |
| 353 | 3300026067 | Ga0207678_10318187 | Ga0207678_103181871 | 154 |
| 354 | 3300026067 | Ga0207678_10682002 | Ga0207678_106820021 | 154 |
| 355 | 3300026078 | Ga0207702_10653983 | Ga0207702_106539832 | 154 |
| 356 | 3300026078 | Ga0207702_10664739 | Ga0207702_106647391 | 154 |
| 357 | 3300026088 | Ga0207641_10285513 | Ga0207641_102855132 | 154 |
| 358 | 3300026088 | Ga0207641_10554748 | Ga0207641_105547482 | 154 |
| 359 | 3300026088 | Ga0207641_10944359 | Ga0207641_109443591 | 154 |
| 360 | 3300026095 | Ga0207676_10818263 | Ga0207676_108182631 | 154 |
| 361 | 3300026095 | Ga0207676_11513143 | Ga0207676_115131431 | 154 |
| 362 | 3300026116 | Ga0207674_10065273 | Ga0207674_100652733 | 154 |
| 363 | 3300026116 | Ga0207674_10081340 | Ga0207674_100813403 | 154 |
| 364 | 3300026116 | Ga0207674_10259572 | Ga0207674_102595721 | 154 |
| 365 | 3300026118 | Ga0207675_100024396 | Ga0207675_1000243967 | 154 |
| 366 | 3300026142 | Ga0207698_10009630 | Ga0207698_100096307 | 154 |
| 367 | 3300026142 | Ga0207698_10116776 | Ga0207698_101167762 | 154 |
| 368 | 3300026142 | Ga0207698_10483344 | Ga0207698_104833442 | 154 |
| 369 | 3300026142 | Ga0207698_11396527 | Ga0207698_113965271 | 154 |
| 370 | 3300028379 | Ga0268266_10000001 | Ga0268266_10000001562 | 154 |
| 371 | 3300028379 | Ga0268266_10284693 | Ga0268266_102846932 | 154 |
| 372 | 3300028379 | Ga0268266_10373674 | Ga0268266_103736742 | 154 |
| 373 | 3300028379 | Ga0268266_10387444 | Ga0268266_103874442 | 154 |
| 374 | 3300028379 | Ga0268266_10810107 | Ga0268266_108101072 | 154 |
| 375 | 3300028379 | Ga0268266_11513682 | Ga0268266_115136821 | 154 |
| 376 | 3300028380 | Ga0268265_10000703 | Ga0268265_1000070323 | 154 |
| 377 | 3300028380 | Ga0268265_10027017 | Ga0268265_100270172 | 154 |
| 378 | 3300028381 | Ga0268264_10071750 | Ga0268264_100717503 | 154 |
| 379 | 3300028381 | Ga0268264_11015805 | Ga0268264_110158052 | 154 |
| 380 | 3300032005 | Ga0307411_10445242 | Ga0307411_104452422 | 154 |
| 381 | 3300034820 | Ga0373959_0025597 | Ga0373959_0025597_347_811 | 154 |
| 382 | 3300041441 | Ga0451787_314151 | Ga0451787_314151_144_608 | 154 |
| 383 | 3300041451 | Ga0451791_0664256 | Ga0451791_0664256_2137_2601 | 154 |
| 384 | 3300041451 | Ga0451791_0696030 | Ga0451791_0696030_174_638 | 154 |
| 385 | 3300041451 | Ga0451791_0831041 | Ga0451791_0831041_157_621 | 154 |
| 386 | 3300041451 | Ga0451791_1533604 | Ga0451791_1533604_59_523 | 154 |
| 387 | 3300041452 | Ga0451793_1514598 | Ga0451793_1514598_12_476 | 154 |
| 388 | 3300041456 | Ga0451795_1696294 | Ga0451795_1696294_354_818 | 154 |
| 389 | 3300041459 | Ga0451800_1313995 | Ga0451800_1313995_149_613 | 154 |
| 390 | 3300041460 | Ga0451802_2085149 | Ga0451802_2085149_1544_2008 | 154 |
| 391 | 3300041486 | Ga0451807_0271974 | Ga0451807_0271974_241_705 | 154 |
| 392 | 3300041486 | Ga0451807_0982744 | Ga0451807_0982744_262_726 | 154 |
| 393 | 3300041494 | Ga0451837_0222153 | Ga0451837_0222153_612_1076 | 154 |
| 394 | 3300041505 | Ga0451849_1115349 | Ga0451849_1115349_35_499 | 154 |
| 395 | 3300041511 | Ga0451855_0855629 | Ga0451855_0855629_403_867 | 154 |
| 396 | 3300041511 | Ga0451855_1988188 | Ga0451855_1988188_62_526 | 154 |
| 397 | 3300041512 | Ga0451853_0551252 | Ga0451853_0551252_138_602 | 154 |
| 398 | 3300041512 | Ga0451853_1922382 | Ga0451853_1922382_946_1410 | 154 |
| 399 | 3300041512 | Ga0451853_2076092 | Ga0451853_2076092_36_500 | 154 |
| 400 | 3300041512 | Ga0451853_3257288 | Ga0451853_3257288_146_610 | 154 |
| 401 | 3300041512 | Ga0451853_3508447 | Ga0451853_3508447_146_610 | 154 |
| 402 | 3300041512 | Ga0451853_3583829 | Ga0451853_3583829_415_879 | 154 |
| 403 | 3300044656 | Ga0466969_0049636 | Ga0466969_0049636_131_595 | 154 |
| 404 | 3300044658 | Ga0466972_0002707 | Ga0466972_0002707_5166_5630 | 154 |
| 405 | 3300044658 | Ga0466972_0017986 | Ga0466972_0017986_2660_3124 | 154 |
| 406 | 3300044672 | Ga0466982_0000001 | Ga0466982_0000001_124597_125061 | 154 |
| 407 | 3300044683 | Ga0466965_0052174 | Ga0466965_0052174_1357_1821 | 154 |
| 408 | 3300044684 | Ga0466966_0002088 | Ga0466966_0002088_762_1226 | 154 |
| 409 | 3300044706 | Ga0466964_0003492 | Ga0466964_0003492_5164_5628 | 154 |
| 410 | 3300044719 | Ga0466971_0009001 | Ga0466971_0009001_3178_3642 | 154 |
| 411 | 3300044735 | Ga0466968_0033047 | Ga0466968_0033047_1414_1878 | 154 |
| 412 | 3300044765 | Ga0466970_0002027 | Ga0466970_0002027_3410_3874 | 154 |
| 413 | 3300044842 | Ga0466957_0181326 | Ga0466957_0181326_175_639 | 154 |
| 414 | 3300044901 | Ga0466960_0005888 | Ga0466960_0005888_664_1128 | 154 |
| 415 | 3300045049 | Ga0466959_0118473 | Ga0466959_0118473_149_613 | 154 |
| 416 | 3300045976 | Ga0466967_0506219 | Ga0466967_0506219_537_1001 | 154 |
| 417 | 3300046660 | Ga0495625_0236545 | Ga0495625_0236545_149_613 | 154 |
| 418 | 3300047472 | Ga0495686_0001992 | Ga0495686_0001992_5000_5464 | 154 |
| 419 | 3300048904 | Ga0496101_0099998 | Ga0496101_0099998_1361_1825 | 154 |
| 420 | 3300048905 | Ga0496102_0321823 | Ga0496102_0321823_244_708 | 154 |
| 421 | 3300048918 | Ga0496115_0075498 | Ga0496115_0075498_1004_1468 | 154 |
| 422 | 3300048918 | Ga0496115_0747981 | Ga0496115_0747981_242_706 | 154 |
| 423 | 3300048920 | Ga0496117_0123689 | Ga0496117_0123689_976_1440 | 154 |
| 424 | 3300048921 | Ga0496118_0000673 | Ga0496118_0000673_22922_23386 | 154 |
| 425 | 3300048921 | Ga0496118_0001581 | Ga0496118_0001581_29687_30151 | 154 |
| 426 | 3300048925 | Ga0496122_0000142 | Ga0496122_0000142_81505_81984 | 154 |
| 427 | 3300048926 | Ga0496123_0000148 | Ga0496123_0000148_71588_72067 | 154 |
| 428 | 3300048929 | Ga0496126_0093601 | Ga0496126_0093601_1898_2377 | 154 |
| 429 | 3300048929 | Ga0496126_0262078 | Ga0496126_0262078_285_749 | 154 |
| 430 | 3300049568 | Ga0501031_0001060 | Ga0501031_0001060_11866_12330 | 154 |
| 431 | 3300049568 | Ga0501031_0322752 | Ga0501031_0322752_58_522 | 154 |
| 432 | 3300049569 | Ga0501032_0001781 | Ga0501032_0001781_7779_8243 | 154 |
| 433 | 3300049570 | Ga0501033_0001474 | Ga0501033_0001474_841_1305 | 154 |
| 434 | 3300049570 | Ga0501033_0003824 | Ga0501033_0003824_8500_8964 | 154 |
| 435 | 3300049570 | Ga0501033_0058978 | Ga0501033_0058978_537_1001 | 154 |
| 436 | 3300049571 | Ga0501034_0002026 | Ga0501034_0002026_21756_22220 | 154 |
| 437 | 3300049571 | Ga0501034_0002668 | Ga0501034_0002668_11649_12113 | 154 |
| 438 | 3300049571 | Ga0501034_0263291 | Ga0501034_0263291_955_1419 | 154 |
| 439 | 3300049572 | Ga0501036_0029504 | Ga0501036_0029504_1404_1868 | 154 |
| 440 | 3300049573 | Ga0501037_0002612 | Ga0501037_0002612_9237_9701 | 154 |
| 441 | 3300049573 | Ga0501037_0005859 | Ga0501037_0005859_7905_8369 | 154 |
| 442 | 3300049573 | Ga0501037_0105001 | Ga0501037_0105001_42_509 | 154 |
| 443 | 3300049573 | Ga0501037_0308036 | Ga0501037_0308036_213_677 | 154 |
| 444 | 3300049574 | Ga0501038_0003449 | Ga0501038_0003449_3218_3682 | 154 |
| 445 | 3300049574 | Ga0501038_0003529 | Ga0501038_0003529_12589_13053 | 154 |
| 446 | 3300049575 | Ga0501039_0005510 | Ga0501039_0005510_1007_1471 | 154 |
| 447 | 3300049575 | Ga0501039_0015618 | Ga0501039_0015618_2683_3147 | 154 |
| 448 | 3300049575 | Ga0501039_0021639 | Ga0501039_0021639_3823_4287 | 154 |
| 449 | 3300049576 | Ga0501040_0168695 | Ga0501040_0168695_235_699 | 154 |
| 450 | 3300049576 | Ga0501040_0271467 | Ga0501040_0271467_476_940 | 154 |
| 451 | 3300049578 | Ga0501042_0222785 | Ga0501042_0222785_635_1099 | 154 |
| 452 | 3300049579 | Ga0501043_0005793 | Ga0501043_0005793_122_586 | 154 |
| 453 | 3300049579 | Ga0501043_0017023 | Ga0501043_0017023_3169_3633 | 154 |
| 454 | 3300049579 | Ga0501043_0056992 | Ga0501043_0056992_181_645 | 154 |
| 455 | 3300049579 | Ga0501043_0172790 | Ga0501043_0172790_267_731 | 154 |
| 456 | 3300049579 | Ga0501043_0512250 | Ga0501043_0512250_103_567 | 154 |
| 457 | 3300049580 | Ga0501046_0000433 | Ga0501046_0000433_18774_19238 | 154 |
| 458 | 3300049580 | Ga0501046_0009071 | Ga0501046_0009071_7138_7602 | 154 |
| 459 | 3300049580 | Ga0501046_0046193 | Ga0501046_0046193_1818_2282 | 154 |
| 460 | 3300049581 | Ga0501047_0008200 | Ga0501047_0008200_6652_7116 | 154 |
| 461 | 3300049581 | Ga0501047_0009306 | Ga0501047_0009306_5314_5778 | 154 |
| 462 | 3300049581 | Ga0501047_0029664 | Ga0501047_0029664_570_1034 | 154 |
| 463 | 3300049581 | Ga0501047_0045586 | Ga0501047_0045586_3640_4104 | 154 |
| 464 | 3300049581 | Ga0501047_0183158 | Ga0501047_0183158_1111_1578 | 154 |
| 465 | 3300049582 | Ga0501048_0000620 | Ga0501048_0000620_23802_24266 | 154 |
| 466 | 3300049582 | Ga0501048_0082913 | Ga0501048_0082913_1566_2030 | 154 |
| 467 | 3300049582 | Ga0501048_0519801 | Ga0501048_0519801_325_789 | 154 |
| 468 | 3300049583 | Ga0501067_0016177 | Ga0501067_0016177_3498_3962 | 154 |
| 469 | 3300049583 | Ga0501067_0339388 | Ga0501067_0339388_22_486 | 154 |
| 470 | 3300049584 | Ga0501068_0102322 | Ga0501068_0102322_1291_1755 | 154 |
| 471 | 3300049584 | Ga0501068_0263945 | Ga0501068_0263945_551_1015 | 154 |
| 472 | 3300049584 | Ga0501068_0596574 | Ga0501068_0596574_74_538 | 154 |
| 473 | 3300049585 | Ga0501069_0019734 | Ga0501069_0019734_113_577 | 154 |
| 474 | 3300049585 | Ga0501069_0155938 | Ga0501069_0155938_190_657 | 154 |
| 475 | 3300049585 | Ga0501069_0615707 | Ga0501069_0615707_31_495 | 154 |
| 476 | 3300049586 | Ga0501070_0000863 | Ga0501070_0000863_9414_9878 | 154 |
| 477 | 3300049586 | Ga0501070_0004345 | Ga0501070_0004345_10969_11436 | 154 |
| 478 | 3300049586 | Ga0501070_0013645 | Ga0501070_0013645_6201_6665 | 154 |
| 479 | 3300049586 | Ga0501070_0114267 | Ga0501070_0114267_645_1109 | 154 |
| 480 | 3300049586 | Ga0501070_0555767 | Ga0501070_0555767_14_478 | 154 |
| 481 | 3300049587 | Ga0501071_0038372 | Ga0501071_0038372_1433_1900 | 154 |
| 482 | 3300049587 | Ga0501071_0057565 | Ga0501071_0057565_2060_2524 | 154 |
| 483 | 3300049588 | Ga0501072_0008627 | Ga0501072_0008627_7023_7487 | 154 |
| 484 | 3300049588 | Ga0501072_0575694 | Ga0501072_0575694_286_753 | 154 |
| 485 | 3300049589 | Ga0501073_0001668 | Ga0501073_0001668_1249_1713 | 154 |
| 486 | 3300049589 | Ga0501073_0082937 | Ga0501073_0082937_1120_1584 | 154 |
| 487 | 3300049589 | Ga0501073_0090000 | Ga0501073_0090000_762_1229 | 154 |
| 488 | 3300049589 | Ga0501073_0209392 | Ga0501073_0209392_756_1220 | 154 |
| 489 | 3300049590 | Ga0501074_0005670 | Ga0501074_0005670_8103_8567 | 154 |
| 490 | 3300049590 | Ga0501074_0433414 | Ga0501074_0433414_159_623 | 154 |
| 491 | 3300049590 | Ga0501074_0500736 | Ga0501074_0500736_195_662 | 154 |
| 492 | 3300049591 | Ga0501075_0687908 | Ga0501075_0687908_61_525 | 154 |
| 493 | 3300049593 | Ga0501077_0727377 | Ga0501077_0727377_138_605 | 154 |
| 494 | 3300049741 | Ga0501079_0031326 | Ga0501079_0031326_1540_2004 | 154 |
| 495 | 3300049741 | Ga0501079_0060312 | Ga0501079_0060312_448_912 | 154 |
| 496 | 3300049741 | Ga0501079_0283889 | Ga0501079_0283889_722_1189 | 154 |
| 497 | 3300049742 | Ga0501080_0004884 | Ga0501080_0004884_1382_1846 | 154 |
| 498 | 3300049742 | Ga0501080_0032486 | Ga0501080_0032486_4192_4659 | 154 |
| 499 | 3300049742 | Ga0501080_0034312 | Ga0501080_0034312_329_793 | 154 |
| 500 | 3300049742 | Ga0501080_0052219 | Ga0501080_0052219_1027_1491 | 154 |
| 501 | 3300049742 | Ga0501080_0249279 | Ga0501080_0249279_696_1160 | 154 |
| 502 | 3300049742 | Ga0501080_0648742 | Ga0501080_0648742_138_602 | 154 |
| 503 | 3300049742 | Ga0501080_1062275 | Ga0501080_1062275_36_500 | 154 |
| 504 | 3300049743 | Ga0501081_0023882 | Ga0501081_0023882_733_1197 | 154 |
| 505 | 3300049744 | Ga0501083_0007573 | Ga0501083_0007573_6288_6752 | 154 |
| 506 | 3300049744 | Ga0501083_0138335 | Ga0501083_0138335_657_1121 | 154 |
| 507 | 3300049822 | Ga0501035_0004461 | Ga0501035_0004461_3630_4094 | 154 |
| 508 | 3300049822 | Ga0501035_0078712 | Ga0501035_0078712_261_725 | 154 |
| 509 | 3300049822 | Ga0501035_0215692 | Ga0501035_0215692_955_1419 | 154 |
| 510 | 3300049822 | Ga0501035_0505282 | Ga0501035_0505282_174_641 | 154 |
| 511 | 3300049823 | Ga0501044_0016825 | Ga0501044_0016825_7122_7586 | 154 |
| 512 | 3300049823 | Ga0501044_0029647 | Ga0501044_0029647_1025_1489 | 154 |
| 513 | 3300049823 | Ga0501044_0040555 | Ga0501044_0040555_4240_4704 | 154 |
| 514 | 3300049823 | Ga0501044_0063782 | Ga0501044_0063782_3278_3742 | 154 |
| 515 | 3300049823 | Ga0501044_0095864 | Ga0501044_0095864_340_807 | 154 |
| 516 | 3300049823 | Ga0501044_0584437 | Ga0501044_0584437_438_902 | 154 |
| 517 | 3300049824 | Ga0501045_0003570 | Ga0501045_0003570_2751_3215 | 154 |
| 518 | 3300053079 | Ga0500610_0022773 | Ga0500610_0022773_2462_2926 | 154 |
| 519 | 3300053093 | Ga0500651_0003648 | Ga0500651_0003648_6415_6879 | 154 |
| 520 | 3300053093 | Ga0500651_0250831 | Ga0500651_0250831_413_877 | 154 |
| 521 | 3300053136 | Ga0500559_0348853 | Ga0500559_0348853_60_524 | 154 |
| 522 | 3300053155 | Ga0500620_078199 | Ga0500620_078199_298_762 | 154 |
| 523 | 3300054114 | Ga0501084_0019087 | Ga0501084_0019087_430_894 | 154 |
| 524 | 3300054114 | Ga0501084_0765875 | Ga0501084_0765875_275_739 | 154 |
| 525 | 3300060353 | Ga0501082_0004943 | Ga0501082_0004943_10167_10631 | 154 |
| 526 | 3300060353 | Ga0501082_0053049 | Ga0501082_0053049_2792_3256 | 154 |
| 527 | 3300060353 | Ga0501082_0218912 | Ga0501082_0218912_808_1272 | 154 |
| 528 | 3300061719 | Ga0466962_0002437 | Ga0466962_0002437_5414_5878 | 154 |
| 529 | 3300061734 | Ga0530510_0330197 | Ga0530510_0330197_543_1010 | 154 |
| 530 | iso_pu_bacteria | 2739367700 | 2739732700 | 154 |
| 531 | iso_pu_bacteria | 2884411467 | 2884415246 | 154 |
| 532 | iso_pu_bacteria | 2928963466 | 2928965420 | 154 |
| 533 | 3300001989 | JGI24739J22299_10157449 | JGI24739J22299_101574492 | 157 |
| 534 | 3300001990 | JGI24737J22298_10090807 | JGI24737J22298_100908071 | 157 |
| 535 | 3300002067 | JGI24735J21928_10000330 | JGI24735J21928_100003308 | 157 |
| 536 | 3300003762 | Ga0055542_1000531 | Ga0055542_100053128 | 157 |
| 537 | 3300005365 | Ga0070688_100357274 | Ga0070688_1003572742 | 157 |
| 538 | 3300005466 | Ga0070685_10011582 | Ga0070685_100115823 | 157 |
| 539 | 3300013105 | Ga0157369_10115805 | Ga0157369_101158053 | 157 |
| 540 | 3300015687 | Ga0183368_1003 | Ga0183368_100318 | 157 |
| 541 | 3300025226 | Ga0209674_100033 | Ga0209674_10003319 | 157 |
| 542 | 3300025231 | Ga0207427_102604 | Ga0207427_1026043 | 157 |
| 543 | 3300025233 | Ga0209437_100141 | Ga0209437_100141128 | 157 |
| 544 | 3300025242 | Ga0209258_101254 | Ga0209258_1012546 | 157 |
| 545 | 3300025242 | Ga0209258_103818 | Ga0209258_1038184 | 157 |
| 546 | 3300025250 | Ga0209026_1004424 | Ga0209026_10044243 | 157 |
| 547 | 3300025254 | Ga0209148_1000002 | Ga0209148_1000002653 | 157 |
| 548 | 3300025904 | Ga0207647_10012275 | Ga0207647_100122758 | 157 |
| 549 | 3300048906 | Ga0496103_0008538 | Ga0496103_0008538_1397_1918 | 157 |
| 550 | 3300048907 | Ga0496104_0387725 | Ga0496104_0387725_602_1078 | 157 |
| 551 | 3300048918 | Ga0496115_0000008 | Ga0496115_0000008_19811_20287 | 157 |
| 552 | 3300048920 | Ga0496117_0159391 | Ga0496117_0159391_141_662 | 157 |
| 553 | 3300048921 | Ga0496118_0047452 | Ga0496118_0047452_2729_3250 | 157 |
| 554 | 3300048926 | Ga0496123_0129923 | Ga0496123_0129923_375_893 | 157 |
| 555 | 3300041503 | Ga0451847_0132680 | Ga0451847_0132680_348_890 | 159 |
| 556 | 3300002737 | JGI25162J39368_1001075 | JGI25162J39368_100107515 | 161 |
| 557 | 3300002741 | JGI25157J39369_1000501 | JGI25157J39369_100050119 | 161 |
| 558 | 3300002741 | JGI25157J39369_1004503 | JGI25157J39369_10045032 | 161 |
| 559 | 3300002772 | JGI25164J39214_1000024 | JGI25164J39214_100002459 | 161 |
| 560 | 3300003214 | JGI25165J46597_1000446 | JGI25165J46597_10004463 | 161 |
| 561 | 3300003214 | JGI25165J46597_1003141 | JGI25165J46597_10031413 | 161 |
| 562 | 3300003756 | Ga0055533_1000621 | Ga0055533_100062110 | 161 |
| 563 | 3300003760 | Ga0055527_1000126 | Ga0055527_100012636 | 161 |
| 564 | 3300003761 | Ga0055535_1000284 | Ga0055535_100028435 | 161 |
| 565 | 3300003761 | Ga0055535_1000758 | Ga0055535_10007588 | 161 |
| 566 | 3300003761 | Ga0055535_1001377 | Ga0055535_10013777 | 161 |
| 567 | 3300003762 | Ga0055542_1000279 | Ga0055542_10002797 | 161 |
| 568 | 3300003762 | Ga0055542_1000310 | Ga0055542_100031036 | 161 |
| 569 | 3300003762 | Ga0055542_1000733 | Ga0055542_10007339 | 161 |
| 570 | 3300003763 | Ga0055529_1000120 | Ga0055529_10001209 | 161 |
| 571 | 3300003763 | Ga0055529_1000325 | Ga0055529_100032521 | 161 |
| 572 | 3300025226 | Ga0209674_100127 | Ga0209674_10012782 | 161 |
| 573 | 3300025226 | Ga0209674_100449 | Ga0209674_10044911 | 161 |
| 574 | 3300025228 | Ga0209672_100022 | Ga0209672_100022103 | 161 |
| 575 | 3300025228 | Ga0209672_100203 | Ga0209672_10020343 | 161 |
| 576 | 3300025228 | Ga0209672_101389 | Ga0209672_1013895 | 161 |
| 577 | 3300025231 | Ga0207427_100058 | Ga0207427_100058134 | 161 |
| 578 | 3300025233 | Ga0209437_100142 | Ga0209437_10014258 | 161 |
| 579 | 3300025242 | Ga0209258_100004 | Ga0209258_100004277 | 161 |
| 580 | 3300025242 | Ga0209258_100122 | Ga0209258_100122172 | 161 |
| 581 | 3300025242 | Ga0209258_100158 | Ga0209258_100158143 | 161 |
| 582 | 3300025246 | Ga0209646_1001430 | Ga0209646_10014303 | 161 |
| 583 | 3300025250 | Ga0209026_1000087 | Ga0209026_1000087175 | 161 |
| 584 | 3300025250 | Ga0209026_1000346 | Ga0209026_100034640 | 161 |
| 585 | 3300025253 | Ga0209677_103470 | Ga0209677_1034705 | 161 |
| 586 | 3300025254 | Ga0209148_1000053 | Ga0209148_100005322 | 161 |
| 587 | 3300025254 | Ga0209148_1000062 | Ga0209148_1000062316 | 161 |
| 588 | 3300025254 | Ga0209148_1000362 | Ga0209148_10003627 | 161 |
| 589 | 3300025256 | Ga0209759_1000602 | Ga0209759_100060215 | 161 |
| 590 | 3300025256 | Ga0209759_1000894 | Ga0209759_10008945 | 161 |
| 591 | 3300025261 | Ga0209233_1000141 | Ga0209233_1000141134 | 161 |
| 592 | 3300025272 | Ga0209455_1000007 | Ga0209455_100000722 | 161 |
| 593 | 3300025272 | Ga0209455_1000040 | Ga0209455_1000040323 | 161 |
| 594 | 3300025272 | Ga0209455_1010019 | Ga0209455_10100195 | 161 |
| 595 | 3300037312 | Ga0395899_0256992 | Ga0395899_0256992_92_580 | 161 |
| 596 | 3300037466 | Ga0395898_0000023 | Ga0395898_0000023_52315_52803 | 161 |
| 597 | 3300037466 | Ga0395898_0000110 | Ga0395898_0000110_95625_96113 | 161 |
| 598 | 3300044693 | Ga0466961_0010861 | Ga0466961_0010861_4251_4739 | 161 |
| 599 | 3300044693 | Ga0466961_0014132 | Ga0466961_0014132_4012_4500 | 161 |
| 600 | 3300044694 | Ga0466963_0134503 | Ga0466963_0134503_881_1369 | 161 |
| 601 | 3300044706 | Ga0466964_0071947 | Ga0466964_0071947_737_1225 | 161 |
| 602 | 3300044765 | Ga0466970_0059811 | Ga0466970_0059811_837_1325 | 161 |
| 603 | 3300044765 | Ga0466970_0301613 | Ga0466970_0301613_234_722 | 161 |
| 604 | 3300045049 | Ga0466959_0000213 | Ga0466959_0000213_9804_10292 | 161 |
| 605 | 3300045049 | Ga0466959_0037803 | Ga0466959_0037803_2304_2792 | 161 |
| 606 | 3300045836 | Ga0466958_0004650 | Ga0466958_0004650_6302_6790 | 161 |
| 607 | 3300045976 | Ga0466967_0764481 | Ga0466967_0764481_151_639 | 161 |
| 608 | 3300001979 | JGI24740J21852_10009154 | JGI24740J21852_100091542 | 162 |
| 609 | 3300001989 | JGI24739J22299_10000870 | JGI24739J22299_100008703 | 162 |
| 610 | 3300001990 | JGI24737J22298_10005793 | JGI24737J22298_100057935 | 162 |
| 611 | 3300003215 | JGI25153J46596_10013051 | JGI25153J46596_100130512 | 162 |
| 612 | 3300003316 | rootH1_10057966 | rootH1_100579663 | 162 |
| 613 | 3300003320 | rootH2_10010398 | rootH2_100103984 | 162 |
| 614 | 3300003578 | Ga0006562J51391_1016472 | Ga0006562J51391_10164722 | 162 |
| 615 | 3300003578 | Ga0006562J51391_1016473 | Ga0006562J51391_10164735 | 162 |
| 616 | 3300005455 | Ga0070663_100014022 | Ga0070663_1000140224 | 162 |
| 617 | 3300005457 | Ga0070662_100284473 | Ga0070662_1002844731 | 162 |
| 618 | 3300005547 | Ga0070693_100365341 | Ga0070693_1003653412 | 162 |
| 619 | 3300005563 | Ga0068855_100333763 | Ga0068855_1003337633 | 162 |
| 620 | 3300005577 | Ga0068857_100000379 | Ga0068857_10000037928 | 162 |
| 621 | 3300005578 | Ga0068854_100843916 | Ga0068854_1008439162 | 162 |
| 622 | 3300005614 | Ga0068856_100442611 | Ga0068856_1004426111 | 162 |
| 623 | 3300005616 | Ga0068852_100673144 | Ga0068852_1006731442 | 162 |
| 624 | 3300005842 | Ga0068858_100309999 | Ga0068858_1003099993 | 162 |
| 625 | 3300009093 | Ga0105240_10145612 | Ga0105240_101456123 | 162 |
| 626 | 3300009093 | Ga0105240_10698903 | Ga0105240_106989032 | 162 |
| 627 | 3300009545 | Ga0105237_10000011 | Ga0105237_1000001152 | 162 |
| 628 | 3300010375 | Ga0105239_10133783 | Ga0105239_101337833 | 162 |
| 629 | 3300012490 | Ga0157322_1007219 | Ga0157322_10072191 | 162 |
| 630 | 3300012500 | Ga0157314_1000597 | Ga0157314_10005974 | 162 |
| 631 | 3300013102 | Ga0157371_10823309 | Ga0157371_108233091 | 162 |
| 632 | 3300013105 | Ga0157369_10106798 | Ga0157369_101067982 | 162 |
| 633 | 3300025297 | Ga0209758_1000301 | Ga0209758_100030155 | 162 |
| 634 | 3300025904 | Ga0207647_10017557 | Ga0207647_100175574 | 162 |
| 635 | 3300025913 | Ga0207695_10000802 | Ga0207695_1000080233 | 162 |
| 636 | 3300025913 | Ga0207695_10108915 | Ga0207695_101089153 | 162 |
| 637 | 3300025914 | Ga0207671_10000011 | Ga0207671_1000001151 | 162 |
| 638 | 3300025933 | Ga0207706_10036589 | Ga0207706_100365892 | 162 |
| 639 | 3300025949 | Ga0207667_10000331 | Ga0207667_1000033127 | 162 |
| 640 | 3300025981 | Ga0207640_10002859 | Ga0207640_100028595 | 162 |
| 641 | 3300026035 | Ga0207703_10194733 | Ga0207703_101947332 | 162 |
| 642 | 3300026067 | Ga0207678_10037867 | Ga0207678_100378672 | 162 |
| 643 | 3300026116 | Ga0207674_10003674 | Ga0207674_1000367413 | 162 |
| 644 | 3300026142 | Ga0207698_10348760 | Ga0207698_103487602 | 162 |
| 645 | 3300042005 | Ga0439448_0001496 | Ga0439448_0001496_358_849 | 162 |
| 646 | 3300048924 | Ga0496121_0056975 | Ga0496121_0056975_2607_3095 | 162 |
| 647 | 3300048928 | Ga0496125_0000118 | Ga0496125_0000118_28066_28554 | 162 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7o6d-assembly1.cif.gz_A | crystal structure of human mitochondrial ferritin (hmtf) fe(ii)-loaded for 3 minutes under anaerobic environment | 0.3392 | 22 | 157 |
| 2l6g-assembly1.cif.gz_A | fat-ld2 double labeled construct with free ld4 peptide | 0.3192 | 23 | 147 |
| 2l6g-assembly1.cif.gz_A | fat-ld2 double labeled construct with free ld4 peptide | 0.2608 | 23 | 147 |
| 7dfe-assembly1.cif.gz_B | nmr structure of tusp2-rp | 0.2578 | 1 | 155 |
| 7o6d-assembly1.cif.gz_A | crystal structure of human mitochondrial ferritin (hmtf) fe(ii)-loaded for 3 minutes under anaerobic environment | 0.2527 | 22 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9LYS9_197_382_2.60.120.200 | Mainly Beta;Sandwich;Jelly Rolls; | 0.3394 | 24 | 159 | 2.60.120.200 |
| af_Q9ZUV4_277_552_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3373 | 9 | 127 | 1.20.1250.20 |
| af_P31675_12_198_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3356 | 11 | 120 | 1.20.1250.20 |
| af_Q54G39_12_190_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3188 | 11 | 125 | 1.20.1250.20 |
| af_I6YDV4_1_171_1.10.287.1490 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.3149 | 9 | 162 | 1.10.287.1490 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A075JYW3-F1-model_v4 | Membrane protein | 0.9609 | 11 | 156 |
GO:0016020
GO:0046521 |
| AF-A0A3S0RK50-F1-model_v4 | DUF962 domain-containing protein | 0.9549 | 9 | 160 |
GO:0016020
GO:0046521 |
| AF-A0A522FZF1-F1-model_v4 | DUF962 domain-containing protein | 0.9507 | 9 | 156 |
GO:0016020
|
| AF-A0A2W5KS54-F1-model_v4 | DUF962 domain-containing protein | 0.9443 | 6 | 159 |
GO:0016020
GO:0046521 |
| AF-A0A3S0RK50-F1-model_v4 | DUF962 domain-containing protein | 0.9428 | 9 | 160 |
GO:0016020
GO:0046521 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar