F472305

General Info

Members Datasets Scaffolds Average Seq Length
647 260 640 153

Family's Representative Sequence

Representative Sequence 3300041503|Ga0451847_0132680|Ga0451847_0132680_348_890
Length 180
Sequence MAAASCALLPRRSRRAMIELAQAELSMRSVNDWFGSYSADHQNPTNRLIHWICVPAILWAVVALLWLLPVPPSIGRAGLWCAFVMIGALSFYWRLSRPLGAAMFVVFVLLALLTEWLYRTLGGQPLLWLAIGVFVIAWIGQFVGHVIEGRRPSFFTDLAYLLIGPAWLTGKIMRKVGVAY

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
3 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
4 2739367700 Dyella sp. YR388 Isolate Unclassified
5 2884411467 Dyella sp. AD56 Isolate Rhizosphere
6 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
7 2928963466 Dyella japonica 1073 Isolate Unclassified
8 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
14 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
15 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
16 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
17 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
22 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
23 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
84 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
104 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
111 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
113 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
114 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
117 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
171 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
172 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
173 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
174 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
175 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
176 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
177 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
178 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
179 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
180 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
183 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
186 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
187 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
193 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
220 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
254 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
255 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
256 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.84
Metatranscriptomes 0.93
Isolates 1.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.36
Nodule 0
Rhizoplane 3.25
Rhizosphere 78.36
Stem 0
Stem Tuber 0
Unclassified 8.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009154 3300001979 Bacteria 3893
2 JGI24739J22299_10000870 3300001989 Bacteria 11155
3 JGI24739J22299_10157449 3300001989 Bacteria 671
4 JGI24737J22298_10005793 3300001990 Bacteria 4257
5 JGI24737J22298_10090807 3300001990 Bacteria 906
6 JGI24735J21928_10000330 3300002067 Bacteria 16497
7 JGI25162J39368_1000837 3300002737 Bacteria 20279
8 JGI25162J39368_1001075 3300002737 Bacteria 16659
9 JGI25157J39369_1000177 3300002741 Bacteria 53890
10 JGI25157J39369_1000501 3300002741 Bacteria 24125
11 JGI25157J39369_1004503 3300002741 Bacteria 2504
12 JGI25163J39215_1002314 3300002771 Bacteria 2049
13 JGI25164J39214_1000024 3300002772 Bacteria 165608
14 JGI25164J39214_1000159 3300002772 Bacteria 63983
15 JGI25165J46597_1000287 3300003214 Bacteria 64000
16 JGI25165J46597_1000446 3300003214 Bacteria 41610
17 JGI25165J46597_1003141 3300003214 Bacteria 4403
18 JGI25153J46596_10013051 3300003215 Bacteria 3539
19 rootH1_10057966 3300003316 Bacteria 1516
20 rootH1_10057966 3300003323 Bacteria 6154
21 rootH2_10010398 3300003320 Bacteria 3132
22 Ga0006562J51391_1016472 3300003578 Bacteria 7310
23 Ga0006562J51391_1016473 3300003578 Bacteria 3930
24 Ga0055538_1001479 3300003751 Bacteria 4461
25 Ga0055533_1000621 3300003756 Bacteria 11966
26 Ga0055527_1000126 3300003760 Bacteria 53492
27 Ga0055535_1000284 3300003761 Bacteria 53480
28 Ga0055535_1000329 3300003761 Bacteria 47890
29 Ga0055535_1000758 3300003761 Bacteria 24017
30 Ga0055535_1001377 3300003761 Bacteria 12655
31 Ga0055542_1000279 3300003762 Bacteria 57233
32 Ga0055542_1000310 3300003762 Bacteria 53492
33 Ga0055542_1000531 3300003762 Bacteria 33988
34 Ga0055542_1000547 3300003762 Bacteria 33443
35 Ga0055542_1000733 3300003762 Bacteria 25465
36 Ga0055529_1000108 3300003763 Bacteria 122223
37 Ga0055529_1000120 3300003763 Bacteria 115533
38 Ga0055529_1000325 3300003763 Bacteria 53492
39 Ga0070658_10056111 3300005327 Bacteria 3201
40 Ga0070658_10692495 3300005327 Bacteria 884
41 Ga0070676_10332751 3300005328 Bacteria 1039
42 Ga0070670_100361288 3300005331 Bacteria 1277
43 Ga0068869_101075893 3300005334 Bacteria 703
44 Ga0070666_10057963 3300005335 Bacteria 2618
45 Ga0070666_10099798 3300005335 Bacteria 1999
46 Ga0070682_100024425 3300005337 Bacteria 3597
47 Ga0070682_100314597 3300005337 Bacteria 1154
48 Ga0070682_101235436 3300005337 Bacteria 632
49 Ga0068868_100076880 3300005338 Bacteria 2669
50 Ga0070660_100457366 3300005339 Bacteria 1059
51 Ga0070660_101042721 3300005339 Bacteria 691
52 Ga0070660_101173520 3300005339 Bacteria 651
53 Ga0070691_10215119 3300005341 Bacteria 1016
54 Ga0070661_100028400 3300005344 Bacteria 4035
55 Ga0070661_100028468 3300005344 Bacteria 4030
56 Ga0070661_100168671 3300005344 Bacteria 1661
57 Ga0070661_100277416 3300005344 Bacteria 1299
58 Ga0070661_100384553 3300005344 Bacteria 1107
59 Ga0070661_100441298 3300005344 Bacteria 1034
60 Ga0070692_10013248 3300005345 Bacteria 3840
61 Ga0070692_10017159 3300005345 Bacteria 3457
62 Ga0070692_10153253 3300005345 Bacteria 1314
63 Ga0070668_100048132 3300005347 Bacteria 3279
64 Ga0070668_100621448 3300005347 Bacteria 947
65 Ga0070668_102194901 3300005347 Bacteria 510
66 Ga0070671_100084270 3300005355 Bacteria 2658
67 Ga0070671_100862100 3300005355 Bacteria 790
68 Ga0070674_100205078 3300005356 Bacteria 1525
69 Ga0070673_100103345 3300005364 Bacteria 2351
70 Ga0070688_100357274 3300005365 Bacteria 1071
71 Ga0070659_100001431 3300005366 Bacteria 17216
72 Ga0070659_100074854 3300005366 Bacteria 2698
73 Ga0070659_100356007 3300005366 Bacteria 1229
74 Ga0070667_100000243 3300005367 Bacteria 61793
75 Ga0070667_100007499 3300005367 Bacteria 9049
76 Ga0070667_100021449 3300005367 Bacteria 5363
77 Ga0070667_100067079 3300005367 Bacteria 3050
78 Ga0070667_100331525 3300005367 Bacteria 1375
79 Ga0070667_100674261 3300005367 Bacteria 955
80 Ga0070709_10669666 3300005434 Bacteria 805
81 Ga0070714_100000070 3300005435 Bacteria 92555
82 Ga0070694_100203539 3300005444 Bacteria 1477
83 Ga0070663_100014022 3300005455 Bacteria 5133
84 Ga0070663_100055413 3300005455 Bacteria 2838
85 Ga0070663_100640920 3300005455 Bacteria 898
86 Ga0070663_101767430 3300005455 Bacteria 554
87 Ga0070662_100284473 3300005457 Bacteria 1339
88 Ga0070681_10000799 3300005458 Bacteria 26246
89 Ga0070681_10042888 3300005458 Bacteria 4533
90 Ga0070681_10650872 3300005458 Bacteria 969
91 Ga0070685_10011582 3300005466 Bacteria 4619
92 Ga0070685_10849339 3300005466 Bacteria 676
93 Ga0070684_100148945 3300005535 Bacteria 2119
94 Ga0070684_100331999 3300005535 Bacteria 1397
95 Ga0070684_100446831 3300005535 Bacteria 1195
96 Ga0068853_100001964 3300005539 Bacteria 15151
97 Ga0068853_100018102 3300005539 Bacteria 5826
98 Ga0068853_100018189 3300005539 Bacteria 5813
99 Ga0068853_100034791 3300005539 Bacteria 4277
100 Ga0068853_100047092 3300005539 Bacteria 3700
101 Ga0068853_100182912 3300005539 Bacteria 1901
102 Ga0068853_100194108 3300005539 Bacteria 1846
103 Ga0068853_101540344 3300005539 Bacteria 644
104 Ga0070696_100145366 3300005546 Bacteria 1736
105 Ga0070693_100050344 3300005547 Bacteria 2380
106 Ga0070693_100365341 3300005547 Bacteria 991
107 Ga0070665_100000126 3300005548 Bacteria 146495
108 Ga0070665_100016275 3300005548 Bacteria 7462
109 Ga0070665_100052121 3300005548 Bacteria 4105
110 Ga0070665_100096902 3300005548 Bacteria 2954
111 Ga0070665_100772577 3300005548 Bacteria 974
112 Ga0070665_101182220 3300005548 Bacteria 776
113 Ga0068855_100026134 3300005563 Bacteria 6984
114 Ga0068855_100128818 3300005563 Bacteria 2891
115 Ga0068855_100229325 3300005563 Bacteria 2080
116 Ga0068855_100333763 3300005563 Bacteria 1673
117 Ga0068855_100336141 3300005563 Bacteria 1666
118 Ga0068855_100377635 3300005563 Bacteria 1557
119 Ga0068855_100575517 3300005563 Bacteria 1217
120 Ga0068855_101515468 3300005563 Bacteria 688
121 Ga0068855_101860799 3300005563 Bacteria 610
122 Ga0070664_100037916 3300005564 Bacteria 4054
123 Ga0068857_100000379 3300005577 Bacteria 31170
124 Ga0068857_100098116 3300005577 Bacteria 2627
125 Ga0068857_100148003 3300005577 Bacteria 2126
126 Ga0068857_100414861 3300005577 Bacteria 1254
127 Ga0068854_100353302 3300005578 Bacteria 1204
128 Ga0068854_100814373 3300005578 Bacteria 815
129 Ga0068854_100843916 3300005578 Bacteria 801
130 Ga0068856_100059168 3300005614 Bacteria 3784
131 Ga0068856_100194594 3300005614 Bacteria 2042
132 Ga0068856_100442611 3300005614 Bacteria 1320
133 Ga0068856_100770724 3300005614 Bacteria 982
134 Ga0068852_100176686 3300005616 Bacteria 2005
135 Ga0068852_100310026 3300005616 Bacteria 1530
136 Ga0068852_100597119 3300005616 Bacteria 1108
137 Ga0068852_100673144 3300005616 Bacteria 1044
138 Ga0068859_100000374 3300005617 Bacteria 44673
139 Ga0068864_100292612 3300005618 Bacteria 1522
140 Ga0068864_100380406 3300005618 Bacteria 1338
141 Ga0068861_100021160 3300005719 Bacteria 4674
142 Ga0068851_10007468 3300005834 Bacteria 5020
143 Ga0068851_10096668 3300005834 Bacteria 1562
144 Ga0068863_100013853 3300005841 Bacteria 7772
145 Ga0068863_100041607 3300005841 Bacteria 4370
146 Ga0068863_100123462 3300005841 Bacteria 2470
147 Ga0068858_100067218 3300005842 Bacteria 3320
148 Ga0068858_100309999 3300005842 Bacteria 1507
149 Ga0068860_100108360 3300005843 Bacteria 2655
150 Ga0068862_100000144 3300005844 Bacteria 80630
151 Ga0068862_100069457 3300005844 Bacteria 3041
152 Ga0068862_100399261 3300005844 Bacteria 1286
153 Ga0081455_10111456 3300005937 Bacteria 2174
154 Ga0081540_1004609 3300005983 Bacteria 10434
155 Ga0097621_100023103 3300006237 Bacteria 4836
156 Ga0097621_100034619 3300006237 Bacteria 4030
157 Ga0097621_100082453 3300006237 Bacteria 2678
158 Ga0068871_100078781 3300006358 Bacteria 2725
159 Ga0068871_100682698 3300006358 Bacteria 940
160 Ga0097620_100000374 3300006931 Bacteria 44673
161 Ga0105240_10145612 3300009093 Bacteria 2827
162 Ga0105240_10223859 3300009093 Bacteria 2190
163 Ga0105240_10698903 3300009093 Bacteria 1107
164 Ga0105247_10313483 3300009101 Bacteria 1092
165 Ga0105237_10000011 3300009545 Bacteria 307361
166 Ga0105237_10000318 3300009545 Bacteria 67535
167 Ga0105237_10093432 3300009545 Bacteria 2997
168 Ga0105237_10159201 3300009545 Bacteria 2256
169 Ga0105237_10339705 3300009545 Bacteria 1506
170 Ga0105237_10455940 3300009545 Bacteria 1284
171 Ga0105237_11843911 3300009545 Bacteria 612
172 Ga0105238_10012695 3300009551 Bacteria 8501
173 Ga0105238_10035681 3300009551 Bacteria 5054
174 Ga0105238_10125267 3300009551 Bacteria 2548
175 Ga0105238_10305686 3300009551 Bacteria 1574
176 Ga0105238_10572334 3300009551 Bacteria 1135
177 Ga0105238_11075410 3300009551 Bacteria 827
178 Ga0105238_11624025 3300009551 Bacteria 677
179 Ga0105249_10024522 3300009553 Bacteria 5422
180 Ga0105239_10083550 3300010375 Bacteria 3517
181 Ga0105239_10133783 3300010375 Bacteria 2760
182 Ga0105239_10172476 3300010375 Bacteria 2419
183 Ga0105239_10212246 3300010375 Bacteria 2170
184 Ga0105239_10244488 3300010375 Bacteria 2014
185 Ga0105239_11223471 3300010375 Bacteria 866
186 Ga0157322_1007219 3300012490 Bacteria 818
187 Ga0157314_1000597 3300012500 Bacteria 3295
188 Ga0157373_10101344 3300013100 Bacteria 2026
189 Ga0157371_10085131 3300013102 Bacteria 2240
190 Ga0157371_10749137 3300013102 Bacteria 733
191 Ga0157371_10823309 3300013102 Bacteria 701
192 Ga0157371_10935835 3300013102 Bacteria 658
193 Ga0157370_10171695 3300013104 Bacteria 2015
194 Ga0157370_10174310 3300013104 Bacteria 1999
195 Ga0157370_10295008 3300013104 Bacteria 1497
196 Ga0157370_10406359 3300013104 Bacteria 1253
197 Ga0157369_10106798 3300013105 Bacteria 2979
198 Ga0157369_10115805 3300013105 Bacteria 2847
199 Ga0157374_10429564 3300013296 Bacteria 1321
200 Ga0157374_10701725 3300013296 Bacteria 1025
201 Ga0157372_10011446 3300013307 Bacteria 9431
202 Ga0157372_10032397 3300013307 Bacteria 5731
203 Ga0157372_10057339 3300013307 Bacteria 4353
204 Ga0157372_10218999 3300013307 Bacteria 2206
205 Ga0157372_11747357 3300013307 Bacteria 715
206 Ga0157372_11801917 3300013307 Bacteria 704
207 Ga0157375_10289862 3300013308 Bacteria 1800
208 Ga0163163_10035757 3300014325 Bacteria 4821
209 Ga0182008_10558257 3300014497 Bacteria 637
210 Ga0157379_10085790 3300014968 Bacteria 2822
211 Ga0157379_10843614 3300014968 Bacteria 867
212 Ga0157376_10290210 3300014969 Bacteria 1544
213 Ga0157376_10455104 3300014969 Bacteria 1249
214 Ga0157376_11071284 3300014969 Bacteria 831
215 Ga0157376_11552913 3300014969 Unclassified 696
216 Ga0182006_1191793 3300015261 Bacteria 679
217 Ga0182007_10053649 3300015262 Bacteria 1327
218 Ga0182007_10194687 3300015262 Bacteria 706
219 Ga0182007_10208623 3300015262 Bacteria 686
220 Ga0182007_10211161 3300015262 Bacteria 682
221 Ga0182007_10247961 3300015262 Bacteria 638
222 Ga0183368_1003 3300015687 Bacteria 1276390
223 Ga0206356_10126730 3300020070 Bacteria 6649
224 Ga0206350_10185836 3300020080 Bacteria 1424
225 Ga0206353_10150174 3300020082 Bacteria 6346
226 Ga0154015_1137588 3300020610 Bacteria 1387
227 Ga0209435_107095 3300025206 Bacteria 1243
228 Ga0209760_100925 3300025207 Bacteria 3634
229 Ga0209784_100076 3300025224 Bacteria 139766
230 Ga0209566_102527 3300025225 Bacteria 3325
231 Ga0209674_100033 3300025226 Bacteria 423450
232 Ga0209674_100127 3300025226 Bacteria 123030
233 Ga0209674_100449 3300025226 Bacteria 18818
234 Ga0209672_100022 3300025228 Bacteria 374313
235 Ga0209672_100203 3300025228 Bacteria 47041
236 Ga0209672_101389 3300025228 Bacteria 8954
237 Ga0209672_110225 3300025228 Bacteria 1279
238 Ga0207427_100058 3300025231 Bacteria 192979
239 Ga0207427_100097 3300025231 Bacteria 122973
240 Ga0207427_102604 3300025231 Bacteria 4631
241 Ga0209437_100116 3300025233 Bacteria 209449
242 Ga0209437_100141 3300025233 Bacteria 166553
243 Ga0209437_100142 3300025233 Bacteria 165628
244 Ga0209258_100004 3300025242 Bacteria 1376422
245 Ga0209258_100122 3300025242 Bacteria 180314
246 Ga0209258_100158 3300025242 Bacteria 156881
247 Ga0209258_100214 3300025242 Bacteria 115049
248 Ga0209258_101254 3300025242 Bacteria 9712
249 Ga0209258_103818 3300025242 Bacteria 3081
250 Ga0209646_1000512 3300025246 Bacteria 17395
251 Ga0209646_1001430 3300025246 Bacteria 6423
252 Ga0209026_1000087 3300025250 Bacteria 184044
253 Ga0209026_1000152 3300025250 Bacteria 110285
254 Ga0209026_1000346 3300025250 Bacteria 44154
255 Ga0209026_1004424 3300025250 Bacteria 4161
256 Ga0209677_103470 3300025253 Bacteria 5096
257 Ga0209148_1000002 3300025254 Bacteria 2399500
258 Ga0209148_1000047 3300025254 Bacteria 434369
259 Ga0209148_1000053 3300025254 Bacteria 373506
260 Ga0209148_1000062 3300025254 Bacteria 347704
261 Ga0209148_1000362 3300025254 Bacteria 57285
262 Ga0209759_1000477 3300025256 Bacteria 44647
263 Ga0209759_1000602 3300025256 Bacteria 34775
264 Ga0209759_1000894 3300025256 Bacteria 22283
265 Ga0209759_1002664 3300025256 Bacteria 7645
266 Ga0209233_1000100 3300025261 Bacteria 293905
267 Ga0209233_1000141 3300025261 Bacteria 192978
268 Ga0209233_1024946 3300025261 Bacteria 1487
269 Ga0209455_1000007 3300025272 Bacteria 1157983
270 Ga0209455_1000040 3300025272 Bacteria 430197
271 Ga0209455_1000056 3300025272 Bacteria 349821
272 Ga0209455_1008009 3300025272 Bacteria 2920
273 Ga0209455_1010019 3300025272 Bacteria 2440
274 Ga0209758_1000301 3300025297 Bacteria 96998
275 Ga0209051_1031958 3300025303 Bacteria 2016
276 Ga0207656_10189696 3300025321 Bacteria 989
277 Ga0207710_10217492 3300025900 Bacteria 948
278 Ga0207680_10024378 3300025903 Bacteria 3320
279 Ga0207680_10038708 3300025903 Bacteria 2762
280 Ga0207680_10393423 3300025903 Bacteria 979
281 Ga0207647_10001467 3300025904 Bacteria 18124
282 Ga0207647_10012275 3300025904 Bacteria 5970
283 Ga0207647_10014847 3300025904 Bacteria 5356
284 Ga0207647_10017557 3300025904 Bacteria 4863
285 Ga0207647_10367630 3300025904 Bacteria 813
286 Ga0207645_10044128 3300025907 Bacteria 2853
287 Ga0207705_10112912 3300025909 Bacteria 2009
288 Ga0207705_11422709 3300025909 Bacteria 527
289 Ga0207707_10000626 3300025912 Bacteria 35036
290 Ga0207707_10000976 3300025912 Bacteria 27495
291 Ga0207707_10047538 3300025912 Bacteria 3737
292 Ga0207707_10084557 3300025912 Bacteria 2771
293 Ga0207707_10762238 3300025912 Bacteria 808
294 Ga0207695_10000802 3300025913 Bacteria 58681
295 Ga0207695_10108915 3300025913 Bacteria 2753
296 Ga0207695_10137764 3300025913 Bacteria 2393
297 Ga0207695_10668430 3300025913 Bacteria 919
298 Ga0207671_10000011 3300025914 Bacteria 530349
299 Ga0207671_10000618 3300025914 Bacteria 46890
300 Ga0207671_10397320 3300025914 Bacteria 1096
301 Ga0207660_10005591 3300025917 Bacteria 8162
302 Ga0207660_10364093 3300025917 Bacteria 1160
303 Ga0207649_10008623 3300025920 Bacteria 5566
304 Ga0207649_10011831 3300025920 Bacteria 4827
305 Ga0207649_10041309 3300025920 Bacteria 2807
306 Ga0207649_10056315 3300025920 Bacteria 2455
307 Ga0207649_10181318 3300025920 Bacteria 1474
308 Ga0207652_10022193 3300025921 Bacteria 5247
309 Ga0207652_10144803 3300025921 Bacteria 2126
310 Ga0207652_10332329 3300025921 Bacteria 1372
311 Ga0207694_10802159 3300025924 Bacteria 795
312 Ga0207650_10061491 3300025925 Bacteria 2804
313 Ga0207664_10000068 3300025929 Bacteria 107432
314 Ga0207644_10592008 3300025931 Bacteria 920
315 Ga0207690_10002033 3300025932 Bacteria 12404
316 Ga0207690_10009636 3300025932 Bacteria 5734
317 Ga0207690_10201926 3300025932 Bacteria 1510
318 Ga0207690_10328491 3300025932 Bacteria 1204
319 Ga0207690_10617374 3300025932 Bacteria 886
320 Ga0207706_10010243 3300025933 Bacteria 8572
321 Ga0207706_10036589 3300025933 Bacteria 4360
322 Ga0207706_10269614 3300025933 Bacteria 1485
323 Ga0207709_10400340 3300025935 Bacteria 1049
324 Ga0207704_10140526 3300025938 Bacteria 1688
325 Ga0207704_10920183 3300025938 Bacteria 736
326 Ga0207691_10038146 3300025940 Bacteria 4445
327 Ga0207711_10229881 3300025941 Bacteria 1698
328 Ga0207689_10050054 3300025942 Bacteria 3446
329 Ga0207689_10164296 3300025942 Bacteria 1829
330 Ga0207689_10822388 3300025942 Bacteria 784
331 Ga0207661_10054030 3300025944 Bacteria 3216
332 Ga0207679_10162058 3300025945 Bacteria 1832
333 Ga0207667_10000331 3300025949 Bacteria 65208
334 Ga0207667_10006296 3300025949 Bacteria 14394
335 Ga0207667_10085064 3300025949 Bacteria 3274
336 Ga0207667_10088020 3300025949 Bacteria 3212
337 Ga0207667_10110806 3300025949 Bacteria 2831
338 Ga0207667_10198618 3300025949 Bacteria 2058
339 Ga0207667_10219471 3300025949 Bacteria 1948
340 Ga0207667_10314674 3300025949 Bacteria 1599
341 Ga0207651_10836456 3300025960 Bacteria 817
342 Ga0207712_10103347 3300025961 Bacteria 2123
343 Ga0207668_10290679 3300025972 Bacteria 1344
344 Ga0207668_10593870 3300025972 Bacteria 964
345 Ga0207668_10864123 3300025972 Bacteria 804
346 Ga0207640_10002859 3300025981 Bacteria 9263
347 Ga0207640_10163170 3300025981 Bacteria 1651
348 Ga0207640_10351592 3300025981 Bacteria 1184
349 Ga0207640_11240346 3300025981 Bacteria 664
350 Ga0207658_10000203 3300025986 Bacteria 61802
351 Ga0207658_10003606 3300025986 Bacteria 10942
352 Ga0207658_10078415 3300025986 Bacteria 2524
353 Ga0207658_10174133 3300025986 Bacteria 1776
354 Ga0207658_10274036 3300025986 Bacteria 1444
355 Ga0207658_10324280 3300025986 Bacteria 1334
356 Ga0207658_10383942 3300025986 Bacteria 1231
357 Ga0207658_10522496 3300025986 Bacteria 1059
358 Ga0207703_10194733 3300026035 Bacteria 1797
359 Ga0207703_10776926 3300026035 Bacteria 913
360 Ga0207639_10001623 3300026041 Bacteria 15128
361 Ga0207639_10012389 3300026041 Bacteria 5938
362 Ga0207639_10065784 3300026041 Bacteria 2815
363 Ga0207639_10395498 3300026041 Bacteria 1244
364 Ga0207639_10473616 3300026041 Bacteria 1140
365 Ga0207639_10703982 3300026041 Bacteria 937
366 Ga0207639_11225729 3300026041 Bacteria 704
367 Ga0207639_11381209 3300026041 Bacteria 661
368 Ga0207678_10037867 3300026067 Bacteria 4194
369 Ga0207678_10318187 3300026067 Bacteria 1338
370 Ga0207678_10682002 3300026067 Bacteria 904
371 Ga0207678_10862460 3300026067 Bacteria 800
372 Ga0207702_10093136 3300026078 Bacteria 2642
373 Ga0207702_10653983 3300026078 Bacteria 1034
374 Ga0207702_10664739 3300026078 Bacteria 1025
375 Ga0207641_10285513 3300026088 Bacteria 1554
376 Ga0207641_10554748 3300026088 Bacteria 1121
377 Ga0207641_10944359 3300026088 Bacteria 857
378 Ga0207676_10818263 3300026095 Bacteria 909
379 Ga0207676_11513143 3300026095 Bacteria 668
380 Ga0207674_10003674 3300026116 Bacteria 18726
381 Ga0207674_10065273 3300026116 Bacteria 3669
382 Ga0207674_10081340 3300026116 Bacteria 3241
383 Ga0207674_10259572 3300026116 Bacteria 1685
384 Ga0207675_100024396 3300026118 Bacteria 5623
385 Ga0207698_10009630 3300026142 Bacteria 6170
386 Ga0207698_10116776 3300026142 Bacteria 2249
387 Ga0207698_10348760 3300026142 Bacteria 1397
388 Ga0207698_10483344 3300026142 Bacteria 1202
389 Ga0207698_11396527 3300026142 Bacteria 715
390 Ga0268266_10000001 3300028379 Bacteria 4040580
391 Ga0268266_10022419 3300028379 Bacteria 5383
392 Ga0268266_10284693 3300028379 Bacteria 1538
393 Ga0268266_10373674 3300028379 Bacteria 1343
394 Ga0268266_10387444 3300028379 Bacteria 1319
395 Ga0268266_10810107 3300028379 Bacteria 905
396 Ga0268266_11513682 3300028379 Bacteria 646
397 Ga0268265_10000703 3300028380 Bacteria 32896
398 Ga0268265_10027017 3300028380 Bacteria 4091
399 Ga0268264_10071750 3300028381 Bacteria 2935
400 Ga0268264_11015805 3300028381 Bacteria 836
401 Ga0268264_11129888 3300028381 Bacteria 792
402 Ga0307411_10445242 3300032005 Bacteria 1082
403 Ga0373959_0025597 3300034820 Bacteria 1161
404 Ga0395899_0256992 3300037312 Bacteria 1196
405 Ga0395899_0317517 3300037312 Bacteria 1050
406 Ga0395900_0099515 3300037418 Bacteria 2987
407 Ga0395898_0000023 3300037466 Bacteria 379477
408 Ga0395898_0000110 3300037466 Bacteria 217100
409 Ga0395898_0593756 3300037466 Bacteria 1050
410 Ga0395901_0002089 3300038443 Bacteria 20494
411 Ga0395901_0109855 3300038443 Bacteria 2895
412 Ga0395901_0167904 3300038443 Bacteria 2303
413 Ga0451787_314151 3300041441 Bacteria 908
414 Ga0451791_0664256 3300041451 Bacteria 2707
415 Ga0451791_0696030 3300041451 Bacteria 3454
416 Ga0451791_0831041 3300041451 Bacteria 942
417 Ga0451791_1533604 3300041451 Bacteria 703
418 Ga0451793_1514598 3300041452 Bacteria 609
419 Ga0451795_1696294 3300041456 Bacteria 945
420 Ga0451800_1313995 3300041459 Bacteria 1077
421 Ga0451802_2085149 3300041460 Bacteria 3630
422 Ga0451807_0271974 3300041486 Bacteria 980
423 Ga0451807_0982744 3300041486 Bacteria 1317
424 Ga0451837_0222153 3300041494 Bacteria 3374
425 Ga0451847_0132680 3300041503 Bacteria 1030
426 Ga0451849_1115349 3300041505 Bacteria 683
427 Ga0451855_0855629 3300041511 Bacteria 978
428 Ga0451855_1988188 3300041511 Bacteria 581
429 Ga0451853_0551252 3300041512 Bacteria 622
430 Ga0451853_1922382 3300041512 Bacteria 3699
431 Ga0451853_2076092 3300041512 Bacteria 531
432 Ga0451853_3257288 3300041512 Bacteria 706
433 Ga0451853_3508447 3300041512 Bacteria 885
434 Ga0451853_3583829 3300041512 Unclassified 988
435 Ga0439437_009814 3300042000 Bacteria 1086
436 Ga0439448_0001496 3300042005 Bacteria 6082
437 Ga0466969_0049636 3300044656 Bacteria 2070
438 Ga0466972_0002707 3300044658 Bacteria 8765
439 Ga0466972_0017986 3300044658 Bacteria 3534
440 Ga0466982_0000001 3300044672 Bacteria 514662
441 Ga0466965_0008397 3300044683 Bacteria 4778
442 Ga0466965_0052174 3300044683 Bacteria 2030
443 Ga0466966_0002088 3300044684 Bacteria 12972
444 Ga0466961_0010861 3300044693 Bacteria 5815
445 Ga0466961_0014132 3300044693 Bacteria 5121
446 Ga0466963_0134503 3300044694 Bacteria 1710
447 Ga0466964_0003492 3300044706 Bacteria 5738
448 Ga0466964_0071947 3300044706 Bacteria 1464
449 Ga0466971_0009001 3300044719 Bacteria 4363
450 Ga0466968_0033047 3300044735 Bacteria 2154
451 Ga0466970_0002027 3300044765 Bacteria 9804
452 Ga0466970_0059811 3300044765 Bacteria 2040
453 Ga0466970_0301613 3300044765 Bacteria 903
454 Ga0466957_0026653 3300044842 Bacteria 3430
455 Ga0466957_0105204 3300044842 Bacteria 1783
456 Ga0466957_0181326 3300044842 Bacteria 1375
457 Ga0466960_0005888 3300044901 Bacteria 4886
458 Ga0466959_0000213 3300045049 Bacteria 37533
459 Ga0466959_0037803 3300045049 Bacteria 3567
460 Ga0466959_0118473 3300045049 Bacteria 1884
461 Ga0466959_0469096 3300045049 Unclassified 852
462 Ga0466958_0004650 3300045836 Bacteria 7282
463 Ga0466958_0009099 3300045836 Bacteria 5520
464 Ga0466967_0506219 3300045976 Bacteria 1186
465 Ga0466967_0764481 3300045976 Bacteria 958
466 Ga0495638_0000201 3300046460 Bacteria 85006
467 Ga0495638_0000208 3300046460 Bacteria 83214
468 Ga0495650_0000112 3300046471 Bacteria 197339
469 Ga0495606_0002080 3300046507 Bacteria 24428
470 Ga0495622_0042981 3300046557 Bacteria 2101
471 Ga0495625_0236545 3300046660 Bacteria 1191
472 Ga0495649_0003176 3300046694 Bacteria 11231
473 Ga0495686_0001992 3300047472 Bacteria 20283
474 Ga0496101_0099998 3300048904 Bacteria 2169
475 Ga0496102_0321823 3300048905 Bacteria 1457
476 Ga0496103_0008538 3300048906 Bacteria 6088
477 Ga0496104_0387725 3300048907 Bacteria 1309
478 Ga0496115_0000008 3300048918 Bacteria 237485
479 Ga0496115_0000135 3300048918 Bacteria 67733
480 Ga0496115_0007937 3300048918 Bacteria 7831
481 Ga0496115_0075498 3300048918 Bacteria 2738
482 Ga0496115_0715633 3300048918 Bacteria 786
483 Ga0496115_0747981 3300048918 Bacteria 765
484 Ga0496117_0123689 3300048920 Bacteria 1583
485 Ga0496117_0159391 3300048920 Bacteria 1324
486 Ga0496118_0000673 3300048921 Bacteria 55557
487 Ga0496118_0001581 3300048921 Bacteria 33785
488 Ga0496118_0047452 3300048921 Bacteria 3328
489 Ga0496121_0056975 3300048924 Bacteria 3242
490 Ga0496122_0000142 3300048925 Bacteria 168391
491 Ga0496123_0000148 3300048926 Bacteria 143265
492 Ga0496123_0129923 3300048926 Bacteria 1398
493 Ga0496125_0000118 3300048928 Bacteria 176551
494 Ga0496125_0542479 3300048928 Bacteria 646
495 Ga0496126_0038468 3300048929 Bacteria 4451
496 Ga0496126_0046614 3300048929 Bacteria 3973
497 Ga0496126_0065365 3300048929 Bacteria 3255
498 Ga0496126_0093601 3300048929 Bacteria 2638
499 Ga0496126_0262078 3300048929 Bacteria 1437
500 Ga0495678_050868 3300049459 Bacteria 1604
501 Ga0495682_0004030 3300049460 Bacteria 6392
502 Ga0501031_0001060 3300049568 Bacteria 16696
503 Ga0501031_0278876 3300049568 Bacteria 1084
504 Ga0501031_0322752 3300049568 Bacteria 1000
505 Ga0501031_0638302 3300049568 Bacteria 684
506 Ga0501032_0001781 3300049569 Bacteria 17001
507 Ga0501032_0356729 3300049569 Bacteria 941
508 Ga0501033_0000434 3300049570 Bacteria 40122
509 Ga0501033_0001474 3300049570 Bacteria 20818
510 Ga0501033_0003824 3300049570 Bacteria 12251
511 Ga0501033_0058978 3300049570 Bacteria 2834
512 Ga0501033_1150443 3300049570 Bacteria 515
513 Ga0501034_0002026 3300049571 Bacteria 25507
514 Ga0501034_0002668 3300049571 Bacteria 21100
515 Ga0501034_0017272 3300049571 Bacteria 7401
516 Ga0501034_0263291 3300049571 Bacteria 1666
517 Ga0501036_0029504 3300049572 Bacteria 4633
518 Ga0501036_0055506 3300049572 Bacteria 3356
519 Ga0501037_0002612 3300049573 Bacteria 13005
520 Ga0501037_0005859 3300049573 Bacteria 8976
521 Ga0501037_0010840 3300049573 Bacteria 6697
522 Ga0501037_0054755 3300049573 Bacteria 2917
523 Ga0501037_0092872 3300049573 Bacteria 2182
524 Ga0501037_0105001 3300049573 Bacteria 2036
525 Ga0501037_0268311 3300049573 Bacteria 1191
526 Ga0501037_0308036 3300049573 Bacteria 1098
527 Ga0501038_0003449 3300049574 Bacteria 14741
528 Ga0501038_0003529 3300049574 Bacteria 14564
529 Ga0501038_0103647 3300049574 Bacteria 2365
530 Ga0501038_0661486 3300049574 Bacteria 785
531 Ga0501039_0005510 3300049575 Bacteria 9573
532 Ga0501039_0015618 3300049575 Bacteria 5810
533 Ga0501039_0021639 3300049575 Bacteria 4933
534 Ga0501039_0477963 3300049575 Bacteria 978
535 Ga0501040_0168695 3300049576 Bacteria 1549
536 Ga0501040_0271467 3300049576 Bacteria 1211
537 Ga0501040_0379058 3300049576 Bacteria 1015
538 Ga0501041_0948722 3300049577 Bacteria 553
539 Ga0501042_0222785 3300049578 Bacteria 1360
540 Ga0501042_0417959 3300049578 Bacteria 972
541 Ga0501043_0005793 3300049579 Bacteria 9940
542 Ga0501043_0017023 3300049579 Bacteria 5699
543 Ga0501043_0022297 3300049579 Bacteria 4968
544 Ga0501043_0033076 3300049579 Bacteria 4067
545 Ga0501043_0056992 3300049579 Bacteria 3068
546 Ga0501043_0172790 3300049579 Bacteria 1685
547 Ga0501043_0230232 3300049579 Bacteria 1431
548 Ga0501043_0512250 3300049579 Bacteria 895
549 Ga0501046_0000433 3300049580 Bacteria 41959
550 Ga0501046_0009071 3300049580 Bacteria 8624
551 Ga0501046_0026664 3300049580 Bacteria 4719
552 Ga0501046_0046193 3300049580 Bacteria 3457
553 Ga0501047_0004697 3300049581 Bacteria 12841
554 Ga0501047_0008200 3300049581 Bacteria 9868
555 Ga0501047_0009306 3300049581 Bacteria 9277
556 Ga0501047_0029664 3300049581 Bacteria 5273
557 Ga0501047_0045586 3300049581 Bacteria 4240
558 Ga0501047_0183158 3300049581 Bacteria 1960
559 Ga0501047_0419035 3300049581 Bacteria 1170
560 Ga0501048_0000620 3300049582 Bacteria 25293
561 Ga0501048_0082913 3300049582 Bacteria 2261
562 Ga0501048_0275379 3300049582 Bacteria 1196
563 Ga0501048_0519801 3300049582 Bacteria 854
564 Ga0501067_0016177 3300049583 Bacteria 4123
565 Ga0501067_0339388 3300049583 Bacteria 837
566 Ga0501068_0102322 3300049584 Bacteria 1776
567 Ga0501068_0263945 3300049584 Bacteria 1098
568 Ga0501068_0596574 3300049584 Bacteria 719
569 Ga0501069_0019734 3300049585 Bacteria 3647
570 Ga0501069_0155938 3300049585 Bacteria 1313
571 Ga0501069_0615707 3300049585 Bacteria 652
572 Ga0501070_0000863 3300049586 Bacteria 27570
573 Ga0501070_0004345 3300049586 Bacteria 12184
574 Ga0501070_0008384 3300049586 Bacteria 8731
575 Ga0501070_0013645 3300049586 Bacteria 6845
576 Ga0501070_0114267 3300049586 Bacteria 2230
577 Ga0501070_0509434 3300049586 Bacteria 966
578 Ga0501070_0555767 3300049586 Unclassified 918
579 Ga0501071_0038372 3300049587 Bacteria 3423
580 Ga0501071_0057565 3300049587 Bacteria 2809
581 Ga0501072_0008627 3300049588 Bacteria 7735
582 Ga0501072_0575694 3300049588 Bacteria 888
583 Ga0501073_0001668 3300049589 Bacteria 16442
584 Ga0501073_0082937 3300049589 Bacteria 2230
585 Ga0501073_0090000 3300049589 Bacteria 2133
586 Ga0501073_0181467 3300049589 Bacteria 1457
587 Ga0501073_0209392 3300049589 Bacteria 1347
588 Ga0501074_0005670 3300049590 Bacteria 8996
589 Ga0501074_0431608 3300049590 Bacteria 934
590 Ga0501074_0433414 3300049590 Bacteria 932
591 Ga0501074_0500736 3300049590 Bacteria 860
592 Ga0501075_0687908 3300049591 Bacteria 779
593 Ga0501077_0131792 3300049593 Bacteria 1585
594 Ga0501077_0727377 3300049593 Bacteria 638
595 Ga0501079_0031326 3300049741 Bacteria 4086
596 Ga0501079_0060312 3300049741 Bacteria 2926
597 Ga0501079_0283889 3300049741 Bacteria 1294
598 Ga0501080_0004884 3300049742 Bacteria 11947
599 Ga0501080_0032486 3300049742 Bacteria 4868
600 Ga0501080_0034312 3300049742 Bacteria 4735
601 Ga0501080_0052219 3300049742 Bacteria 3804
602 Ga0501080_0125324 3300049742 Bacteria 2379
603 Ga0501080_0249279 3300049742 Bacteria 1619
604 Ga0501080_0504057 3300049742 Bacteria 1081
605 Ga0501080_0648742 3300049742 Bacteria 934
606 Ga0501080_1062275 3300049742 Bacteria 700
607 Ga0501081_0023882 3300049743 Bacteria 4101
608 Ga0501083_0007573 3300049744 Bacteria 7693
609 Ga0501083_0138335 3300049744 Bacteria 1595
610 Ga0501035_0004461 3300049822 Bacteria 13279
611 Ga0501035_0017079 3300049822 Bacteria 6686
612 Ga0501035_0055982 3300049822 Bacteria 3520
613 Ga0501035_0078712 3300049822 Bacteria 2911
614 Ga0501035_0215692 3300049822 Bacteria 1640
615 Ga0501035_0323369 3300049822 Bacteria 1295
616 Ga0501035_0505282 3300049822 Bacteria 994
617 Ga0501035_1028799 3300049822 Bacteria 646
618 Ga0501044_0007108 3300049823 Bacteria 12314
619 Ga0501044_0016825 3300049823 Bacteria 7846
620 Ga0501044_0023397 3300049823 Bacteria 6571
621 Ga0501044_0029647 3300049823 Bacteria 5768
622 Ga0501044_0040555 3300049823 Bacteria 4851
623 Ga0501044_0063782 3300049823 Unclassified 3762
624 Ga0501044_0076307 3300049823 Bacteria 3402
625 Ga0501044_0095864 3300049823 Bacteria 2989
626 Ga0501044_0272952 3300049823 Bacteria 1626
627 Ga0501044_0584437 3300049823 Bacteria 1011
628 Ga0501045_0003570 3300049824 Bacteria 10679
629 Ga0500610_0022773 3300053079 Bacteria 3093
630 Ga0500651_0003648 3300053093 Bacteria 8464
631 Ga0500651_0250831 3300053093 Bacteria 1029
632 Ga0500559_0348853 3300053136 Bacteria 692
633 Ga0500620_078199 3300053155 Bacteria 1144
634 Ga0501084_0019087 3300054114 Bacteria 5710
635 Ga0501084_0765875 3300054114 Bacteria 813
636 Ga0501082_0004943 3300060353 Bacteria 11630
637 Ga0501082_0053049 3300060353 Bacteria 3496
638 Ga0501082_0218912 3300060353 Bacteria 1656
639 Ga0466962_0002437 3300061719 Bacteria 8823
640 Ga0530510_0330197 3300061734 Bacteria 1144

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005539 Ga0068853_100034791 Ga0068853_1000347914 135
2 3300026041 Ga0207639_11225729 Ga0207639_112257292 135
3 3300049570 Ga0501033_1150443 Ga0501033_1150443_26_496 135
4 3300049571 Ga0501034_0017272 Ga0501034_0017272_6255_6725 135
5 3300049572 Ga0501036_0055506 Ga0501036_0055506_556_1026 135
6 3300049573 Ga0501037_0010840 Ga0501037_0010840_1748_2218 135
7 3300049579 Ga0501043_0033076 Ga0501043_0033076_2092_2562 135
8 3300049586 Ga0501070_0008384 Ga0501070_0008384_2867_3337 135
9 3300049593 Ga0501077_0131792 Ga0501077_0131792_159_629 135
10 3300049822 Ga0501035_0017079 Ga0501035_0017079_3668_4138 135
11 3300049823 Ga0501044_0076307 Ga0501044_0076307_2300_2770 135
12 3300005341 Ga0070691_10215119 Ga0070691_102151192 137
13 3300005366 Ga0070659_100074854 Ga0070659_1000748544 137
14 3300005563 Ga0068855_100229325 Ga0068855_1002293254 137
15 3300009551 Ga0105238_10125267 Ga0105238_101252672 137
16 3300013100 Ga0157373_10101344 Ga0157373_101013443 137
17 3300013102 Ga0157371_10085131 Ga0157371_100851314 137
18 3300013104 Ga0157370_10171695 Ga0157370_101716952 137
19 3300013307 Ga0157372_10011446 Ga0157372_100114462 137
20 3300025932 Ga0207690_10201926 Ga0207690_102019262 137
21 3300026041 Ga0207639_10065784 Ga0207639_100657844 137
22 3300005335 Ga0070666_10099798 Ga0070666_100997982 140
23 3300005548 Ga0070665_100016275 Ga0070665_1000162758 140
24 3300025903 Ga0207680_10393423 Ga0207680_103934232 140
25 3300025986 Ga0207658_10324280 Ga0207658_103242801 140
26 3300028379 Ga0268266_10022419 Ga0268266_100224193 140
27 3300005327 Ga0070658_10692495 Ga0070658_106924951 143
28 3300005339 Ga0070660_100457366 Ga0070660_1004573662 143
29 3300005339 Ga0070660_101042721 Ga0070660_1010427212 143
30 3300005344 Ga0070661_100028468 Ga0070661_1000284683 143
31 3300005345 Ga0070692_10017159 Ga0070692_100171595 143
32 3300005435 Ga0070714_100000070 Ga0070714_10000007041 143
33 3300005444 Ga0070694_100203539 Ga0070694_1002035392 143
34 3300005563 Ga0068855_101860799 Ga0068855_1018607991 143
35 3300005614 Ga0068856_100059168 Ga0068856_1000591684 143
36 3300005616 Ga0068852_100597119 Ga0068852_1005971191 143
37 3300009551 Ga0105238_10305686 Ga0105238_103056862 143
38 3300009551 Ga0105238_11075410 Ga0105238_110754102 143
39 3300010375 Ga0105239_10172476 Ga0105239_101724761 143
40 3300010375 Ga0105239_10244488 Ga0105239_102444884 143
41 3300013102 Ga0157371_10749137 Ga0157371_107491372 143
42 3300013102 Ga0157371_10935835 Ga0157371_109358352 143
43 3300013307 Ga0157372_11801917 Ga0157372_118019171 143
44 3300014497 Ga0182008_10558257 Ga0182008_105582571 143
45 3300015261 Ga0182006_1191793 Ga0182006_11917931 143
46 3300015262 Ga0182007_10194687 Ga0182007_101946872 143
47 3300015262 Ga0182007_10247961 Ga0182007_102479612 143
48 3300025904 Ga0207647_10014847 Ga0207647_100148478 143
49 3300025929 Ga0207664_10000068 Ga0207664_1000006840 143
50 3300025932 Ga0207690_10009636 Ga0207690_100096362 143
51 3300025932 Ga0207690_10328491 Ga0207690_103284912 143
52 3300025933 Ga0207706_10010243 Ga0207706_100102436 143
53 3300025949 Ga0207667_10110806 Ga0207667_101108062 143
54 3300026041 Ga0207639_11381209 Ga0207639_113812091 143
55 3300026078 Ga0207702_10093136 Ga0207702_100931363 143
56 3300049586 Ga0501070_0509434 Ga0501070_0509434_480_941 143
57 3300013104 Ga0157370_10295008 Ga0157370_102950082 144
58 3300015262 Ga0182007_10053649 Ga0182007_100536492 144
59 3300015262 Ga0182007_10208623 Ga0182007_102086232 144
60 3300015262 Ga0182007_10211161 Ga0182007_102111612 144
61 3300038443 Ga0395901_0109855 Ga0395901_0109855_83_553 144
62 3300046471 Ga0495650_0000112 Ga0495650_0000112_127208_127678 144
63 3300005337 Ga0070682_101235436 Ga0070682_1012354361 145
64 3300005344 Ga0070661_100028400 Ga0070661_1000284005 145
65 3300005458 Ga0070681_10000799 Ga0070681_1000079925 145
66 3300005843 Ga0068860_100108360 Ga0068860_1001083604 145
67 3300005844 Ga0068862_100069457 Ga0068862_1000694573 145
68 3300009551 Ga0105238_10035681 Ga0105238_100356813 145
69 3300025909 Ga0207705_11422709 Ga0207705_114227091 145
70 3300025912 Ga0207707_10000626 Ga0207707_1000062620 145
71 3300025920 Ga0207649_10041309 Ga0207649_100413094 145
72 3300025986 Ga0207658_10383942 Ga0207658_103839421 145
73 3300026067 Ga0207678_10862460 Ga0207678_108624601 145
74 3300028381 Ga0268264_11129888 Ga0268264_111298882 145
75 3300046460 Ga0495638_0000201 Ga0495638_0000201_39496_39966 145
76 3300048918 Ga0496115_0007937 Ga0496115_0007937_2031_2501 145
77 3300048928 Ga0496125_0542479 Ga0496125_0542479_106_576 145
78 3300048929 Ga0496126_0038468 Ga0496126_0038468_328_798 145
79 3300049573 Ga0501037_0268311 Ga0501037_0268311_64_528 145
80 3300049590 Ga0501074_0431608 Ga0501074_0431608_39_503 145
81 3300049742 Ga0501080_0125324 Ga0501080_0125324_1885_2349 145
82 3300049822 Ga0501035_1028799 Ga0501035_1028799_30_494 145
83 3300049823 Ga0501044_0023397 Ga0501044_0023397_3634_4098 145
84 3300005337 Ga0070682_100024425 Ga0070682_1000244255 146
85 3300005366 Ga0070659_100001431 Ga0070659_10000143114 146
86 3300005458 Ga0070681_10042888 Ga0070681_100428884 146
87 3300009551 Ga0105238_11624025 Ga0105238_116240251 146
88 3300013307 Ga0157372_10057339 Ga0157372_100573392 146
89 3300025912 Ga0207707_10047538 Ga0207707_100475382 146
90 3300025921 Ga0207652_10144803 Ga0207652_101448033 146
91 3300025932 Ga0207690_10002033 Ga0207690_100020337 146
92 3300038443 Ga0395901_0167904 Ga0395901_0167904_312_782 146
93 3300042000 Ga0439437_009814 Ga0439437_009814_174_644 146
94 3300048918 Ga0496115_0715633 Ga0496115_0715633_116_592 146
95 3300049568 Ga0501031_0278876 Ga0501031_0278876_280_750 146
96 3300049568 Ga0501031_0638302 Ga0501031_0638302_53_523 146
97 3300049569 Ga0501032_0356729 Ga0501032_0356729_163_633 146
98 3300049570 Ga0501033_0000434 Ga0501033_0000434_30248_30718 146
99 3300049573 Ga0501037_0054755 Ga0501037_0054755_315_785 146
100 3300049573 Ga0501037_0092872 Ga0501037_0092872_575_1045 146
101 3300049574 Ga0501038_0103647 Ga0501038_0103647_1098_1568 146
102 3300049574 Ga0501038_0661486 Ga0501038_0661486_278_748 146
103 3300049575 Ga0501039_0477963 Ga0501039_0477963_309_779 146
104 3300049576 Ga0501040_0379058 Ga0501040_0379058_163_633 146
105 3300049577 Ga0501041_0948722 Ga0501041_0948722_32_502 146
106 3300049578 Ga0501042_0417959 Ga0501042_0417959_157_627 146
107 3300049579 Ga0501043_0022297 Ga0501043_0022297_2749_3219 146
108 3300049579 Ga0501043_0230232 Ga0501043_0230232_561_1031 146
109 3300049580 Ga0501046_0026664 Ga0501046_0026664_446_916 146
110 3300049581 Ga0501047_0004697 Ga0501047_0004697_7871_8341 146
111 3300049581 Ga0501047_0419035 Ga0501047_0419035_17_487 146
112 3300049582 Ga0501048_0275379 Ga0501048_0275379_518_988 146
113 3300049589 Ga0501073_0181467 Ga0501073_0181467_590_1060 146
114 3300049742 Ga0501080_0504057 Ga0501080_0504057_414_884 146
115 3300049822 Ga0501035_0055982 Ga0501035_0055982_357_827 146
116 3300049822 Ga0501035_0323369 Ga0501035_0323369_14_484 146
117 3300049823 Ga0501044_0007108 Ga0501044_0007108_4404_4874 146
118 3300049823 Ga0501044_0272952 Ga0501044_0272952_410_880 146
119 3300005455 Ga0070663_100055413 Ga0070663_1000554133 147
120 3300009545 Ga0105237_10093432 Ga0105237_100934322 147
121 3300025272 Ga0209455_1008009 Ga0209455_10080092 147
122 3300037312 Ga0395899_0317517 Ga0395899_0317517_239_709 147
123 3300037418 Ga0395900_0099515 Ga0395900_0099515_1294_1764 147
124 3300037466 Ga0395898_0593756 Ga0395898_0593756_340_810 147
125 3300038443 Ga0395901_0002089 Ga0395901_0002089_19063_19533 147
126 3300048929 Ga0496126_0065365 Ga0496126_0065365_1846_2322 147
127 3300046460 Ga0495638_0000208 Ga0495638_0000208_51957_52433 148
128 3300046507 Ga0495606_0002080 Ga0495606_0002080_3294_3770 148
129 3300046557 Ga0495622_0042981 Ga0495622_0042981_1530_2006 148
130 3300046694 Ga0495649_0003176 Ga0495649_0003176_7303_7779 148
131 3300048918 Ga0496115_0000135 Ga0496115_0000135_31240_31716 148
132 3300048929 Ga0496126_0046614 Ga0496126_0046614_1846_2322 148
133 3300049459 Ga0495678_050868 Ga0495678_050868_530_1006 148
134 3300049460 Ga0495682_0004030 Ga0495682_0004030_2856_3332 148
135 3300002737 JGI25162J39368_1000837 JGI25162J39368_10008375 149
136 3300002741 JGI25157J39369_1000177 JGI25157J39369_100017738 149
137 3300002771 JGI25163J39215_1002314 JGI25163J39215_10023142 149
138 3300002772 JGI25164J39214_1000159 JGI25164J39214_100015927 149
139 3300003214 JGI25165J46597_1000287 JGI25165J46597_100028727 149
140 3300003751 Ga0055538_1001479 Ga0055538_10014792 149
141 3300003761 Ga0055535_1000329 Ga0055535_100032921 149
142 3300003762 Ga0055542_1000547 Ga0055542_10005475 149
143 3300003763 Ga0055529_1000108 Ga0055529_100010827 149
144 3300025206 Ga0209435_107095 Ga0209435_1070951 149
145 3300025207 Ga0209760_100925 Ga0209760_1009255 149
146 3300025224 Ga0209784_100076 Ga0209784_10007641 149
147 3300025225 Ga0209566_102527 Ga0209566_1025272 149
148 3300025228 Ga0209672_110225 Ga0209672_1102253 149
149 3300025231 Ga0207427_100097 Ga0207427_10009727 149
150 3300025233 Ga0209437_100116 Ga0209437_10011694 149
151 3300025242 Ga0209258_100214 Ga0209258_10021427 149
152 3300025246 Ga0209646_1000512 Ga0209646_100051212 149
153 3300025250 Ga0209026_1000152 Ga0209026_100015293 149
154 3300025254 Ga0209148_1000047 Ga0209148_1000047170 149
155 3300025256 Ga0209759_1000477 Ga0209759_100047738 149
156 3300025256 Ga0209759_1002664 Ga0209759_10026648 149
157 3300025261 Ga0209233_1000100 Ga0209233_1000100100 149
158 3300025261 Ga0209233_1024946 Ga0209233_10249462 149
159 3300025272 Ga0209455_1000056 Ga0209455_100005694 149
160 iso_pu_bacteria 2537561836 2538833666 152
161 iso_pu_bacteria 2643221577 2643896516 152
162 iso_pu_bacteria 2643221685 2644478727 152
163 iso_pu_bacteria 2895395659 2895398237 152
164 iso_pu_bacteria 2939611941 2939613168 152
165 3300044683 Ga0466965_0008397 Ga0466965_0008397_3726_4187 153
166 3300044842 Ga0466957_0026653 Ga0466957_0026653_12_473 153
167 3300044842 Ga0466957_0105204 Ga0466957_0105204_315_776 153
168 3300045049 Ga0466959_0469096 Ga0466959_0469096_201_662 153
169 3300045836 Ga0466958_0009099 Ga0466958_0009099_3844_4305 153
170 3300005327 Ga0070658_10056111 Ga0070658_100561113 154
171 3300005328 Ga0070676_10332751 Ga0070676_103327512 154
172 3300005331 Ga0070670_100361288 Ga0070670_1003612881 154
173 3300005334 Ga0068869_101075893 Ga0068869_1010758931 154
174 3300005335 Ga0070666_10057963 Ga0070666_100579632 154
175 3300005337 Ga0070682_100314597 Ga0070682_1003145972 154
176 3300005338 Ga0068868_100076880 Ga0068868_1000768803 154
177 3300005339 Ga0070660_101173520 Ga0070660_1011735201 154
178 3300005344 Ga0070661_100168671 Ga0070661_1001686712 154
179 3300005344 Ga0070661_100277416 Ga0070661_1002774162 154
180 3300005344 Ga0070661_100384553 Ga0070661_1003845532 154
181 3300005344 Ga0070661_100441298 Ga0070661_1004412982 154
182 3300005345 Ga0070692_10013248 Ga0070692_100132483 154
183 3300005345 Ga0070692_10153253 Ga0070692_101532532 154
184 3300005347 Ga0070668_100048132 Ga0070668_1000481322 154
185 3300005347 Ga0070668_100621448 Ga0070668_1006214482 154
186 3300005347 Ga0070668_102194901 Ga0070668_1021949011 154
187 3300005355 Ga0070671_100084270 Ga0070671_1000842703 154
188 3300005355 Ga0070671_100862100 Ga0070671_1008621001 154
189 3300005356 Ga0070674_100205078 Ga0070674_1002050782 154
190 3300005364 Ga0070673_100103345 Ga0070673_1001033452 154
191 3300005366 Ga0070659_100356007 Ga0070659_1003560072 154
192 3300005367 Ga0070667_100000243 Ga0070667_1000002433 154
193 3300005367 Ga0070667_100007499 Ga0070667_10000749910 154
194 3300005367 Ga0070667_100021449 Ga0070667_1000214494 154
195 3300005367 Ga0070667_100067079 Ga0070667_1000670792 154
196 3300005367 Ga0070667_100331525 Ga0070667_1003315252 154
197 3300005367 Ga0070667_100674261 Ga0070667_1006742613 154
198 3300005434 Ga0070709_10669666 Ga0070709_106696662 154
199 3300005455 Ga0070663_100640920 Ga0070663_1006409201 154
200 3300005455 Ga0070663_101767430 Ga0070663_1017674301 154
201 3300005458 Ga0070681_10650872 Ga0070681_106508722 154
202 3300005466 Ga0070685_10849339 Ga0070685_108493391 154
203 3300005535 Ga0070684_100148945 Ga0070684_1001489453 154
204 3300005535 Ga0070684_100331999 Ga0070684_1003319992 154
205 3300005535 Ga0070684_100446831 Ga0070684_1004468313 154
206 3300005539 Ga0068853_100001964 Ga0068853_10000196410 154
207 3300005539 Ga0068853_100018102 Ga0068853_1000181029 154
208 3300005539 Ga0068853_100018189 Ga0068853_1000181896 154
209 3300005539 Ga0068853_100047092 Ga0068853_1000470924 154
210 3300005539 Ga0068853_100182912 Ga0068853_1001829123 154
211 3300005539 Ga0068853_100194108 Ga0068853_1001941082 154
212 3300005539 Ga0068853_101540344 Ga0068853_1015403441 154
213 3300005546 Ga0070696_100145366 Ga0070696_1001453662 154
214 3300005547 Ga0070693_100050344 Ga0070693_1000503443 154
215 3300005548 Ga0070665_100000126 Ga0070665_100000126120 154
216 3300005548 Ga0070665_100052121 Ga0070665_1000521213 154
217 3300005548 Ga0070665_100096902 Ga0070665_1000969024 154
218 3300005548 Ga0070665_100772577 Ga0070665_1007725772 154
219 3300005548 Ga0070665_101182220 Ga0070665_1011822202 154
220 3300005563 Ga0068855_100026134 Ga0068855_1000261348 154
221 3300005563 Ga0068855_100128818 Ga0068855_1001288182 154
222 3300005563 Ga0068855_100336141 Ga0068855_1003361411 154
223 3300005563 Ga0068855_100377635 Ga0068855_1003776353 154
224 3300005563 Ga0068855_100575517 Ga0068855_1005755173 154
225 3300005563 Ga0068855_101515468 Ga0068855_1015154682 154
226 3300005564 Ga0070664_100037916 Ga0070664_1000379163 154
227 3300005577 Ga0068857_100098116 Ga0068857_1000981162 154
228 3300005577 Ga0068857_100148003 Ga0068857_1001480032 154
229 3300005577 Ga0068857_100414861 Ga0068857_1004148611 154
230 3300005578 Ga0068854_100353302 Ga0068854_1003533023 154
231 3300005578 Ga0068854_100814373 Ga0068854_1008143732 154
232 3300005614 Ga0068856_100194594 Ga0068856_1001945943 154
233 3300005614 Ga0068856_100770724 Ga0068856_1007707242 154
234 3300005616 Ga0068852_100176686 Ga0068852_1001766863 154
235 3300005616 Ga0068852_100310026 Ga0068852_1003100262 154
236 3300005617 Ga0068859_100000374 Ga0068859_10000037434 154
237 3300005618 Ga0068864_100292612 Ga0068864_1002926122 154
238 3300005618 Ga0068864_100380406 Ga0068864_1003804062 154
239 3300005719 Ga0068861_100021160 Ga0068861_1000211602 154
240 3300005834 Ga0068851_10007468 Ga0068851_100074684 154
241 3300005834 Ga0068851_10096668 Ga0068851_100966682 154
242 3300005841 Ga0068863_100013853 Ga0068863_1000138538 154
243 3300005841 Ga0068863_100041607 Ga0068863_1000416072 154
244 3300005841 Ga0068863_100123462 Ga0068863_1001234624 154
245 3300005842 Ga0068858_100067218 Ga0068858_1000672182 154
246 3300005844 Ga0068862_100000144 Ga0068862_10000014480 154
247 3300005844 Ga0068862_100399261 Ga0068862_1003992612 154
248 3300005937 Ga0081455_10111456 Ga0081455_101114563 154
249 3300005983 Ga0081540_1004609 Ga0081540_10046099 154
250 3300006237 Ga0097621_100023103 Ga0097621_1000231034 154
251 3300006237 Ga0097621_100034619 Ga0097621_1000346193 154
252 3300006237 Ga0097621_100082453 Ga0097621_1000824532 154
253 3300006358 Ga0068871_100078781 Ga0068871_1000787814 154
254 3300006358 Ga0068871_100682698 Ga0068871_1006826982 154
255 3300006931 Ga0097620_100000374 Ga0097620_10000037434 154
256 3300009093 Ga0105240_10223859 Ga0105240_102238593 154
257 3300009101 Ga0105247_10313483 Ga0105247_103134832 154
258 3300009545 Ga0105237_10000318 Ga0105237_1000031841 154
259 3300009545 Ga0105237_10159201 Ga0105237_101592012 154
260 3300009545 Ga0105237_10339705 Ga0105237_103397053 154
261 3300009545 Ga0105237_10455940 Ga0105237_104559402 154
262 3300009545 Ga0105237_11843911 Ga0105237_118439111 154
263 3300009551 Ga0105238_10012695 Ga0105238_100126952 154
264 3300009551 Ga0105238_10572334 Ga0105238_105723343 154
265 3300009553 Ga0105249_10024522 Ga0105249_100245222 154
266 3300010375 Ga0105239_10083550 Ga0105239_100835504 154
267 3300010375 Ga0105239_10212246 Ga0105239_102122462 154
268 3300010375 Ga0105239_11223471 Ga0105239_112234711 154
269 3300013104 Ga0157370_10174310 Ga0157370_101743102 154
270 3300013104 Ga0157370_10406359 Ga0157370_104063592 154
271 3300013296 Ga0157374_10429564 Ga0157374_104295643 154
272 3300013296 Ga0157374_10701725 Ga0157374_107017252 154
273 3300013307 Ga0157372_10032397 Ga0157372_100323974 154
274 3300013307 Ga0157372_10218999 Ga0157372_102189992 154
275 3300013307 Ga0157372_11747357 Ga0157372_117473571 154
276 3300013308 Ga0157375_10289862 Ga0157375_102898621 154
277 3300014325 Ga0163163_10035757 Ga0163163_100357575 154
278 3300014968 Ga0157379_10085790 Ga0157379_100857904 154
279 3300014968 Ga0157379_10843614 Ga0157379_108436142 154
280 3300014969 Ga0157376_10290210 Ga0157376_102902102 154
281 3300014969 Ga0157376_10455104 Ga0157376_104551042 154
282 3300014969 Ga0157376_11071284 Ga0157376_110712841 154
283 3300014969 Ga0157376_11552913 Ga0157376_115529131 154
284 3300020070 Ga0206356_10126730 Ga0206356_101267307 154
285 3300020080 Ga0206350_10185836 Ga0206350_101858363 154
286 3300020082 Ga0206353_10150174 Ga0206353_101501741 154
287 3300020610 Ga0154015_1137588 Ga0154015_11375882 154
288 3300025303 Ga0209051_1031958 Ga0209051_10319582 154
289 3300025321 Ga0207656_10189696 Ga0207656_101896962 154
290 3300025900 Ga0207710_10217492 Ga0207710_102174922 154
291 3300025903 Ga0207680_10024378 Ga0207680_100243784 154
292 3300025903 Ga0207680_10038708 Ga0207680_100387083 154
293 3300025904 Ga0207647_10001467 Ga0207647_100014674 154
294 3300025904 Ga0207647_10367630 Ga0207647_103676302 154
295 3300025907 Ga0207645_10044128 Ga0207645_100441284 154
296 3300025909 Ga0207705_10112912 Ga0207705_101129122 154
297 3300025912 Ga0207707_10000976 Ga0207707_1000097627 154
298 3300025912 Ga0207707_10084557 Ga0207707_100845573 154
299 3300025912 Ga0207707_10762238 Ga0207707_107622382 154
300 3300025913 Ga0207695_10137764 Ga0207695_101377643 154
301 3300025913 Ga0207695_10668430 Ga0207695_106684301 154
302 3300025914 Ga0207671_10000618 Ga0207671_1000061816 154
303 3300025914 Ga0207671_10397320 Ga0207671_103973201 154
304 3300025917 Ga0207660_10005591 Ga0207660_100055912 154
305 3300025917 Ga0207660_10364093 Ga0207660_103640932 154
306 3300025920 Ga0207649_10008623 Ga0207649_100086232 154
307 3300025920 Ga0207649_10011831 Ga0207649_100118312 154
308 3300025920 Ga0207649_10056315 Ga0207649_100563152 154
309 3300025920 Ga0207649_10181318 Ga0207649_101813182 154
310 3300025921 Ga0207652_10022193 Ga0207652_100221937 154
311 3300025921 Ga0207652_10332329 Ga0207652_103323291 154
312 3300025924 Ga0207694_10802159 Ga0207694_108021592 154
313 3300025925 Ga0207650_10061491 Ga0207650_100614911 154
314 3300025931 Ga0207644_10592008 Ga0207644_105920081 154
315 3300025932 Ga0207690_10617374 Ga0207690_106173742 154
316 3300025933 Ga0207706_10269614 Ga0207706_102696141 154
317 3300025935 Ga0207709_10400340 Ga0207709_104003401 154
318 3300025938 Ga0207704_10140526 Ga0207704_101405262 154
319 3300025938 Ga0207704_10920183 Ga0207704_109201832 154
320 3300025940 Ga0207691_10038146 Ga0207691_100381464 154
321 3300025941 Ga0207711_10229881 Ga0207711_102298811 154
322 3300025942 Ga0207689_10050054 Ga0207689_100500545 154
323 3300025942 Ga0207689_10164296 Ga0207689_101642963 154
324 3300025942 Ga0207689_10822388 Ga0207689_108223881 154
325 3300025944 Ga0207661_10054030 Ga0207661_100540303 154
326 3300025945 Ga0207679_10162058 Ga0207679_101620581 154
327 3300025949 Ga0207667_10006296 Ga0207667_1000629610 154
328 3300025949 Ga0207667_10085064 Ga0207667_100850641 154
329 3300025949 Ga0207667_10088020 Ga0207667_100880202 154
330 3300025949 Ga0207667_10198618 Ga0207667_101986182 154
331 3300025949 Ga0207667_10219471 Ga0207667_102194712 154
332 3300025949 Ga0207667_10314674 Ga0207667_103146742 154
333 3300025960 Ga0207651_10836456 Ga0207651_108364562 154
334 3300025961 Ga0207712_10103347 Ga0207712_101033472 154
335 3300025972 Ga0207668_10290679 Ga0207668_102906792 154
336 3300025972 Ga0207668_10593870 Ga0207668_105938702 154
337 3300025972 Ga0207668_10864123 Ga0207668_108641231 154
338 3300025981 Ga0207640_10163170 Ga0207640_101631702 154
339 3300025981 Ga0207640_10351592 Ga0207640_103515922 154
340 3300025981 Ga0207640_11240346 Ga0207640_112403462 154
341 3300025986 Ga0207658_10000203 Ga0207658_100002033 154
342 3300025986 Ga0207658_10003606 Ga0207658_1000360611 154
343 3300025986 Ga0207658_10078415 Ga0207658_100784152 154
344 3300025986 Ga0207658_10174133 Ga0207658_101741332 154
345 3300025986 Ga0207658_10274036 Ga0207658_102740362 154
346 3300025986 Ga0207658_10522496 Ga0207658_105224961 154
347 3300026035 Ga0207703_10776926 Ga0207703_107769261 154
348 3300026041 Ga0207639_10001623 Ga0207639_1000162310 154
349 3300026041 Ga0207639_10012389 Ga0207639_100123898 154
350 3300026041 Ga0207639_10395498 Ga0207639_103954981 154
351 3300026041 Ga0207639_10473616 Ga0207639_104736161 154
352 3300026041 Ga0207639_10703982 Ga0207639_107039821 154
353 3300026067 Ga0207678_10318187 Ga0207678_103181871 154
354 3300026067 Ga0207678_10682002 Ga0207678_106820021 154
355 3300026078 Ga0207702_10653983 Ga0207702_106539832 154
356 3300026078 Ga0207702_10664739 Ga0207702_106647391 154
357 3300026088 Ga0207641_10285513 Ga0207641_102855132 154
358 3300026088 Ga0207641_10554748 Ga0207641_105547482 154
359 3300026088 Ga0207641_10944359 Ga0207641_109443591 154
360 3300026095 Ga0207676_10818263 Ga0207676_108182631 154
361 3300026095 Ga0207676_11513143 Ga0207676_115131431 154
362 3300026116 Ga0207674_10065273 Ga0207674_100652733 154
363 3300026116 Ga0207674_10081340 Ga0207674_100813403 154
364 3300026116 Ga0207674_10259572 Ga0207674_102595721 154
365 3300026118 Ga0207675_100024396 Ga0207675_1000243967 154
366 3300026142 Ga0207698_10009630 Ga0207698_100096307 154
367 3300026142 Ga0207698_10116776 Ga0207698_101167762 154
368 3300026142 Ga0207698_10483344 Ga0207698_104833442 154
369 3300026142 Ga0207698_11396527 Ga0207698_113965271 154
370 3300028379 Ga0268266_10000001 Ga0268266_10000001562 154
371 3300028379 Ga0268266_10284693 Ga0268266_102846932 154
372 3300028379 Ga0268266_10373674 Ga0268266_103736742 154
373 3300028379 Ga0268266_10387444 Ga0268266_103874442 154
374 3300028379 Ga0268266_10810107 Ga0268266_108101072 154
375 3300028379 Ga0268266_11513682 Ga0268266_115136821 154
376 3300028380 Ga0268265_10000703 Ga0268265_1000070323 154
377 3300028380 Ga0268265_10027017 Ga0268265_100270172 154
378 3300028381 Ga0268264_10071750 Ga0268264_100717503 154
379 3300028381 Ga0268264_11015805 Ga0268264_110158052 154
380 3300032005 Ga0307411_10445242 Ga0307411_104452422 154
381 3300034820 Ga0373959_0025597 Ga0373959_0025597_347_811 154
382 3300041441 Ga0451787_314151 Ga0451787_314151_144_608 154
383 3300041451 Ga0451791_0664256 Ga0451791_0664256_2137_2601 154
384 3300041451 Ga0451791_0696030 Ga0451791_0696030_174_638 154
385 3300041451 Ga0451791_0831041 Ga0451791_0831041_157_621 154
386 3300041451 Ga0451791_1533604 Ga0451791_1533604_59_523 154
387 3300041452 Ga0451793_1514598 Ga0451793_1514598_12_476 154
388 3300041456 Ga0451795_1696294 Ga0451795_1696294_354_818 154
389 3300041459 Ga0451800_1313995 Ga0451800_1313995_149_613 154
390 3300041460 Ga0451802_2085149 Ga0451802_2085149_1544_2008 154
391 3300041486 Ga0451807_0271974 Ga0451807_0271974_241_705 154
392 3300041486 Ga0451807_0982744 Ga0451807_0982744_262_726 154
393 3300041494 Ga0451837_0222153 Ga0451837_0222153_612_1076 154
394 3300041505 Ga0451849_1115349 Ga0451849_1115349_35_499 154
395 3300041511 Ga0451855_0855629 Ga0451855_0855629_403_867 154
396 3300041511 Ga0451855_1988188 Ga0451855_1988188_62_526 154
397 3300041512 Ga0451853_0551252 Ga0451853_0551252_138_602 154
398 3300041512 Ga0451853_1922382 Ga0451853_1922382_946_1410 154
399 3300041512 Ga0451853_2076092 Ga0451853_2076092_36_500 154
400 3300041512 Ga0451853_3257288 Ga0451853_3257288_146_610 154
401 3300041512 Ga0451853_3508447 Ga0451853_3508447_146_610 154
402 3300041512 Ga0451853_3583829 Ga0451853_3583829_415_879 154
403 3300044656 Ga0466969_0049636 Ga0466969_0049636_131_595 154
404 3300044658 Ga0466972_0002707 Ga0466972_0002707_5166_5630 154
405 3300044658 Ga0466972_0017986 Ga0466972_0017986_2660_3124 154
406 3300044672 Ga0466982_0000001 Ga0466982_0000001_124597_125061 154
407 3300044683 Ga0466965_0052174 Ga0466965_0052174_1357_1821 154
408 3300044684 Ga0466966_0002088 Ga0466966_0002088_762_1226 154
409 3300044706 Ga0466964_0003492 Ga0466964_0003492_5164_5628 154
410 3300044719 Ga0466971_0009001 Ga0466971_0009001_3178_3642 154
411 3300044735 Ga0466968_0033047 Ga0466968_0033047_1414_1878 154
412 3300044765 Ga0466970_0002027 Ga0466970_0002027_3410_3874 154
413 3300044842 Ga0466957_0181326 Ga0466957_0181326_175_639 154
414 3300044901 Ga0466960_0005888 Ga0466960_0005888_664_1128 154
415 3300045049 Ga0466959_0118473 Ga0466959_0118473_149_613 154
416 3300045976 Ga0466967_0506219 Ga0466967_0506219_537_1001 154
417 3300046660 Ga0495625_0236545 Ga0495625_0236545_149_613 154
418 3300047472 Ga0495686_0001992 Ga0495686_0001992_5000_5464 154
419 3300048904 Ga0496101_0099998 Ga0496101_0099998_1361_1825 154
420 3300048905 Ga0496102_0321823 Ga0496102_0321823_244_708 154
421 3300048918 Ga0496115_0075498 Ga0496115_0075498_1004_1468 154
422 3300048918 Ga0496115_0747981 Ga0496115_0747981_242_706 154
423 3300048920 Ga0496117_0123689 Ga0496117_0123689_976_1440 154
424 3300048921 Ga0496118_0000673 Ga0496118_0000673_22922_23386 154
425 3300048921 Ga0496118_0001581 Ga0496118_0001581_29687_30151 154
426 3300048925 Ga0496122_0000142 Ga0496122_0000142_81505_81984 154
427 3300048926 Ga0496123_0000148 Ga0496123_0000148_71588_72067 154
428 3300048929 Ga0496126_0093601 Ga0496126_0093601_1898_2377 154
429 3300048929 Ga0496126_0262078 Ga0496126_0262078_285_749 154
430 3300049568 Ga0501031_0001060 Ga0501031_0001060_11866_12330 154
431 3300049568 Ga0501031_0322752 Ga0501031_0322752_58_522 154
432 3300049569 Ga0501032_0001781 Ga0501032_0001781_7779_8243 154
433 3300049570 Ga0501033_0001474 Ga0501033_0001474_841_1305 154
434 3300049570 Ga0501033_0003824 Ga0501033_0003824_8500_8964 154
435 3300049570 Ga0501033_0058978 Ga0501033_0058978_537_1001 154
436 3300049571 Ga0501034_0002026 Ga0501034_0002026_21756_22220 154
437 3300049571 Ga0501034_0002668 Ga0501034_0002668_11649_12113 154
438 3300049571 Ga0501034_0263291 Ga0501034_0263291_955_1419 154
439 3300049572 Ga0501036_0029504 Ga0501036_0029504_1404_1868 154
440 3300049573 Ga0501037_0002612 Ga0501037_0002612_9237_9701 154
441 3300049573 Ga0501037_0005859 Ga0501037_0005859_7905_8369 154
442 3300049573 Ga0501037_0105001 Ga0501037_0105001_42_509 154
443 3300049573 Ga0501037_0308036 Ga0501037_0308036_213_677 154
444 3300049574 Ga0501038_0003449 Ga0501038_0003449_3218_3682 154
445 3300049574 Ga0501038_0003529 Ga0501038_0003529_12589_13053 154
446 3300049575 Ga0501039_0005510 Ga0501039_0005510_1007_1471 154
447 3300049575 Ga0501039_0015618 Ga0501039_0015618_2683_3147 154
448 3300049575 Ga0501039_0021639 Ga0501039_0021639_3823_4287 154
449 3300049576 Ga0501040_0168695 Ga0501040_0168695_235_699 154
450 3300049576 Ga0501040_0271467 Ga0501040_0271467_476_940 154
451 3300049578 Ga0501042_0222785 Ga0501042_0222785_635_1099 154
452 3300049579 Ga0501043_0005793 Ga0501043_0005793_122_586 154
453 3300049579 Ga0501043_0017023 Ga0501043_0017023_3169_3633 154
454 3300049579 Ga0501043_0056992 Ga0501043_0056992_181_645 154
455 3300049579 Ga0501043_0172790 Ga0501043_0172790_267_731 154
456 3300049579 Ga0501043_0512250 Ga0501043_0512250_103_567 154
457 3300049580 Ga0501046_0000433 Ga0501046_0000433_18774_19238 154
458 3300049580 Ga0501046_0009071 Ga0501046_0009071_7138_7602 154
459 3300049580 Ga0501046_0046193 Ga0501046_0046193_1818_2282 154
460 3300049581 Ga0501047_0008200 Ga0501047_0008200_6652_7116 154
461 3300049581 Ga0501047_0009306 Ga0501047_0009306_5314_5778 154
462 3300049581 Ga0501047_0029664 Ga0501047_0029664_570_1034 154
463 3300049581 Ga0501047_0045586 Ga0501047_0045586_3640_4104 154
464 3300049581 Ga0501047_0183158 Ga0501047_0183158_1111_1578 154
465 3300049582 Ga0501048_0000620 Ga0501048_0000620_23802_24266 154
466 3300049582 Ga0501048_0082913 Ga0501048_0082913_1566_2030 154
467 3300049582 Ga0501048_0519801 Ga0501048_0519801_325_789 154
468 3300049583 Ga0501067_0016177 Ga0501067_0016177_3498_3962 154
469 3300049583 Ga0501067_0339388 Ga0501067_0339388_22_486 154
470 3300049584 Ga0501068_0102322 Ga0501068_0102322_1291_1755 154
471 3300049584 Ga0501068_0263945 Ga0501068_0263945_551_1015 154
472 3300049584 Ga0501068_0596574 Ga0501068_0596574_74_538 154
473 3300049585 Ga0501069_0019734 Ga0501069_0019734_113_577 154
474 3300049585 Ga0501069_0155938 Ga0501069_0155938_190_657 154
475 3300049585 Ga0501069_0615707 Ga0501069_0615707_31_495 154
476 3300049586 Ga0501070_0000863 Ga0501070_0000863_9414_9878 154
477 3300049586 Ga0501070_0004345 Ga0501070_0004345_10969_11436 154
478 3300049586 Ga0501070_0013645 Ga0501070_0013645_6201_6665 154
479 3300049586 Ga0501070_0114267 Ga0501070_0114267_645_1109 154
480 3300049586 Ga0501070_0555767 Ga0501070_0555767_14_478 154
481 3300049587 Ga0501071_0038372 Ga0501071_0038372_1433_1900 154
482 3300049587 Ga0501071_0057565 Ga0501071_0057565_2060_2524 154
483 3300049588 Ga0501072_0008627 Ga0501072_0008627_7023_7487 154
484 3300049588 Ga0501072_0575694 Ga0501072_0575694_286_753 154
485 3300049589 Ga0501073_0001668 Ga0501073_0001668_1249_1713 154
486 3300049589 Ga0501073_0082937 Ga0501073_0082937_1120_1584 154
487 3300049589 Ga0501073_0090000 Ga0501073_0090000_762_1229 154
488 3300049589 Ga0501073_0209392 Ga0501073_0209392_756_1220 154
489 3300049590 Ga0501074_0005670 Ga0501074_0005670_8103_8567 154
490 3300049590 Ga0501074_0433414 Ga0501074_0433414_159_623 154
491 3300049590 Ga0501074_0500736 Ga0501074_0500736_195_662 154
492 3300049591 Ga0501075_0687908 Ga0501075_0687908_61_525 154
493 3300049593 Ga0501077_0727377 Ga0501077_0727377_138_605 154
494 3300049741 Ga0501079_0031326 Ga0501079_0031326_1540_2004 154
495 3300049741 Ga0501079_0060312 Ga0501079_0060312_448_912 154
496 3300049741 Ga0501079_0283889 Ga0501079_0283889_722_1189 154
497 3300049742 Ga0501080_0004884 Ga0501080_0004884_1382_1846 154
498 3300049742 Ga0501080_0032486 Ga0501080_0032486_4192_4659 154
499 3300049742 Ga0501080_0034312 Ga0501080_0034312_329_793 154
500 3300049742 Ga0501080_0052219 Ga0501080_0052219_1027_1491 154
501 3300049742 Ga0501080_0249279 Ga0501080_0249279_696_1160 154
502 3300049742 Ga0501080_0648742 Ga0501080_0648742_138_602 154
503 3300049742 Ga0501080_1062275 Ga0501080_1062275_36_500 154
504 3300049743 Ga0501081_0023882 Ga0501081_0023882_733_1197 154
505 3300049744 Ga0501083_0007573 Ga0501083_0007573_6288_6752 154
506 3300049744 Ga0501083_0138335 Ga0501083_0138335_657_1121 154
507 3300049822 Ga0501035_0004461 Ga0501035_0004461_3630_4094 154
508 3300049822 Ga0501035_0078712 Ga0501035_0078712_261_725 154
509 3300049822 Ga0501035_0215692 Ga0501035_0215692_955_1419 154
510 3300049822 Ga0501035_0505282 Ga0501035_0505282_174_641 154
511 3300049823 Ga0501044_0016825 Ga0501044_0016825_7122_7586 154
512 3300049823 Ga0501044_0029647 Ga0501044_0029647_1025_1489 154
513 3300049823 Ga0501044_0040555 Ga0501044_0040555_4240_4704 154
514 3300049823 Ga0501044_0063782 Ga0501044_0063782_3278_3742 154
515 3300049823 Ga0501044_0095864 Ga0501044_0095864_340_807 154
516 3300049823 Ga0501044_0584437 Ga0501044_0584437_438_902 154
517 3300049824 Ga0501045_0003570 Ga0501045_0003570_2751_3215 154
518 3300053079 Ga0500610_0022773 Ga0500610_0022773_2462_2926 154
519 3300053093 Ga0500651_0003648 Ga0500651_0003648_6415_6879 154
520 3300053093 Ga0500651_0250831 Ga0500651_0250831_413_877 154
521 3300053136 Ga0500559_0348853 Ga0500559_0348853_60_524 154
522 3300053155 Ga0500620_078199 Ga0500620_078199_298_762 154
523 3300054114 Ga0501084_0019087 Ga0501084_0019087_430_894 154
524 3300054114 Ga0501084_0765875 Ga0501084_0765875_275_739 154
525 3300060353 Ga0501082_0004943 Ga0501082_0004943_10167_10631 154
526 3300060353 Ga0501082_0053049 Ga0501082_0053049_2792_3256 154
527 3300060353 Ga0501082_0218912 Ga0501082_0218912_808_1272 154
528 3300061719 Ga0466962_0002437 Ga0466962_0002437_5414_5878 154
529 3300061734 Ga0530510_0330197 Ga0530510_0330197_543_1010 154
530 iso_pu_bacteria 2739367700 2739732700 154
531 iso_pu_bacteria 2884411467 2884415246 154
532 iso_pu_bacteria 2928963466 2928965420 154
533 3300001989 JGI24739J22299_10157449 JGI24739J22299_101574492 157
534 3300001990 JGI24737J22298_10090807 JGI24737J22298_100908071 157
535 3300002067 JGI24735J21928_10000330 JGI24735J21928_100003308 157
536 3300003762 Ga0055542_1000531 Ga0055542_100053128 157
537 3300005365 Ga0070688_100357274 Ga0070688_1003572742 157
538 3300005466 Ga0070685_10011582 Ga0070685_100115823 157
539 3300013105 Ga0157369_10115805 Ga0157369_101158053 157
540 3300015687 Ga0183368_1003 Ga0183368_100318 157
541 3300025226 Ga0209674_100033 Ga0209674_10003319 157
542 3300025231 Ga0207427_102604 Ga0207427_1026043 157
543 3300025233 Ga0209437_100141 Ga0209437_100141128 157
544 3300025242 Ga0209258_101254 Ga0209258_1012546 157
545 3300025242 Ga0209258_103818 Ga0209258_1038184 157
546 3300025250 Ga0209026_1004424 Ga0209026_10044243 157
547 3300025254 Ga0209148_1000002 Ga0209148_1000002653 157
548 3300025904 Ga0207647_10012275 Ga0207647_100122758 157
549 3300048906 Ga0496103_0008538 Ga0496103_0008538_1397_1918 157
550 3300048907 Ga0496104_0387725 Ga0496104_0387725_602_1078 157
551 3300048918 Ga0496115_0000008 Ga0496115_0000008_19811_20287 157
552 3300048920 Ga0496117_0159391 Ga0496117_0159391_141_662 157
553 3300048921 Ga0496118_0047452 Ga0496118_0047452_2729_3250 157
554 3300048926 Ga0496123_0129923 Ga0496123_0129923_375_893 157
555 3300041503 Ga0451847_0132680 Ga0451847_0132680_348_890 159
556 3300002737 JGI25162J39368_1001075 JGI25162J39368_100107515 161
557 3300002741 JGI25157J39369_1000501 JGI25157J39369_100050119 161
558 3300002741 JGI25157J39369_1004503 JGI25157J39369_10045032 161
559 3300002772 JGI25164J39214_1000024 JGI25164J39214_100002459 161
560 3300003214 JGI25165J46597_1000446 JGI25165J46597_10004463 161
561 3300003214 JGI25165J46597_1003141 JGI25165J46597_10031413 161
562 3300003756 Ga0055533_1000621 Ga0055533_100062110 161
563 3300003760 Ga0055527_1000126 Ga0055527_100012636 161
564 3300003761 Ga0055535_1000284 Ga0055535_100028435 161
565 3300003761 Ga0055535_1000758 Ga0055535_10007588 161
566 3300003761 Ga0055535_1001377 Ga0055535_10013777 161
567 3300003762 Ga0055542_1000279 Ga0055542_10002797 161
568 3300003762 Ga0055542_1000310 Ga0055542_100031036 161
569 3300003762 Ga0055542_1000733 Ga0055542_10007339 161
570 3300003763 Ga0055529_1000120 Ga0055529_10001209 161
571 3300003763 Ga0055529_1000325 Ga0055529_100032521 161
572 3300025226 Ga0209674_100127 Ga0209674_10012782 161
573 3300025226 Ga0209674_100449 Ga0209674_10044911 161
574 3300025228 Ga0209672_100022 Ga0209672_100022103 161
575 3300025228 Ga0209672_100203 Ga0209672_10020343 161
576 3300025228 Ga0209672_101389 Ga0209672_1013895 161
577 3300025231 Ga0207427_100058 Ga0207427_100058134 161
578 3300025233 Ga0209437_100142 Ga0209437_10014258 161
579 3300025242 Ga0209258_100004 Ga0209258_100004277 161
580 3300025242 Ga0209258_100122 Ga0209258_100122172 161
581 3300025242 Ga0209258_100158 Ga0209258_100158143 161
582 3300025246 Ga0209646_1001430 Ga0209646_10014303 161
583 3300025250 Ga0209026_1000087 Ga0209026_1000087175 161
584 3300025250 Ga0209026_1000346 Ga0209026_100034640 161
585 3300025253 Ga0209677_103470 Ga0209677_1034705 161
586 3300025254 Ga0209148_1000053 Ga0209148_100005322 161
587 3300025254 Ga0209148_1000062 Ga0209148_1000062316 161
588 3300025254 Ga0209148_1000362 Ga0209148_10003627 161
589 3300025256 Ga0209759_1000602 Ga0209759_100060215 161
590 3300025256 Ga0209759_1000894 Ga0209759_10008945 161
591 3300025261 Ga0209233_1000141 Ga0209233_1000141134 161
592 3300025272 Ga0209455_1000007 Ga0209455_100000722 161
593 3300025272 Ga0209455_1000040 Ga0209455_1000040323 161
594 3300025272 Ga0209455_1010019 Ga0209455_10100195 161
595 3300037312 Ga0395899_0256992 Ga0395899_0256992_92_580 161
596 3300037466 Ga0395898_0000023 Ga0395898_0000023_52315_52803 161
597 3300037466 Ga0395898_0000110 Ga0395898_0000110_95625_96113 161
598 3300044693 Ga0466961_0010861 Ga0466961_0010861_4251_4739 161
599 3300044693 Ga0466961_0014132 Ga0466961_0014132_4012_4500 161
600 3300044694 Ga0466963_0134503 Ga0466963_0134503_881_1369 161
601 3300044706 Ga0466964_0071947 Ga0466964_0071947_737_1225 161
602 3300044765 Ga0466970_0059811 Ga0466970_0059811_837_1325 161
603 3300044765 Ga0466970_0301613 Ga0466970_0301613_234_722 161
604 3300045049 Ga0466959_0000213 Ga0466959_0000213_9804_10292 161
605 3300045049 Ga0466959_0037803 Ga0466959_0037803_2304_2792 161
606 3300045836 Ga0466958_0004650 Ga0466958_0004650_6302_6790 161
607 3300045976 Ga0466967_0764481 Ga0466967_0764481_151_639 161
608 3300001979 JGI24740J21852_10009154 JGI24740J21852_100091542 162
609 3300001989 JGI24739J22299_10000870 JGI24739J22299_100008703 162
610 3300001990 JGI24737J22298_10005793 JGI24737J22298_100057935 162
611 3300003215 JGI25153J46596_10013051 JGI25153J46596_100130512 162
612 3300003316 rootH1_10057966 rootH1_100579663 162
613 3300003320 rootH2_10010398 rootH2_100103984 162
614 3300003578 Ga0006562J51391_1016472 Ga0006562J51391_10164722 162
615 3300003578 Ga0006562J51391_1016473 Ga0006562J51391_10164735 162
616 3300005455 Ga0070663_100014022 Ga0070663_1000140224 162
617 3300005457 Ga0070662_100284473 Ga0070662_1002844731 162
618 3300005547 Ga0070693_100365341 Ga0070693_1003653412 162
619 3300005563 Ga0068855_100333763 Ga0068855_1003337633 162
620 3300005577 Ga0068857_100000379 Ga0068857_10000037928 162
621 3300005578 Ga0068854_100843916 Ga0068854_1008439162 162
622 3300005614 Ga0068856_100442611 Ga0068856_1004426111 162
623 3300005616 Ga0068852_100673144 Ga0068852_1006731442 162
624 3300005842 Ga0068858_100309999 Ga0068858_1003099993 162
625 3300009093 Ga0105240_10145612 Ga0105240_101456123 162
626 3300009093 Ga0105240_10698903 Ga0105240_106989032 162
627 3300009545 Ga0105237_10000011 Ga0105237_1000001152 162
628 3300010375 Ga0105239_10133783 Ga0105239_101337833 162
629 3300012490 Ga0157322_1007219 Ga0157322_10072191 162
630 3300012500 Ga0157314_1000597 Ga0157314_10005974 162
631 3300013102 Ga0157371_10823309 Ga0157371_108233091 162
632 3300013105 Ga0157369_10106798 Ga0157369_101067982 162
633 3300025297 Ga0209758_1000301 Ga0209758_100030155 162
634 3300025904 Ga0207647_10017557 Ga0207647_100175574 162
635 3300025913 Ga0207695_10000802 Ga0207695_1000080233 162
636 3300025913 Ga0207695_10108915 Ga0207695_101089153 162
637 3300025914 Ga0207671_10000011 Ga0207671_1000001151 162
638 3300025933 Ga0207706_10036589 Ga0207706_100365892 162
639 3300025949 Ga0207667_10000331 Ga0207667_1000033127 162
640 3300025981 Ga0207640_10002859 Ga0207640_100028595 162
641 3300026035 Ga0207703_10194733 Ga0207703_101947332 162
642 3300026067 Ga0207678_10037867 Ga0207678_100378672 162
643 3300026116 Ga0207674_10003674 Ga0207674_1000367413 162
644 3300026142 Ga0207698_10348760 Ga0207698_103487602 162
645 3300042005 Ga0439448_0001496 Ga0439448_0001496_358_849 162
646 3300048924 Ga0496121_0056975 Ga0496121_0056975_2607_3095 162
647 3300048928 Ga0496125_0000118 Ga0496125_0000118_28066_28554 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06127

Mpo1-like

2-hydroxy-palmitic acid dioxygenase Mpo1-like

27

176

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o6d-assembly1.cif.gz_A crystal structure of human mitochondrial ferritin (hmtf) fe(ii)-loaded for 3 minutes under anaerobic environment 0.3392 22 157
2l6g-assembly1.cif.gz_A fat-ld2 double labeled construct with free ld4 peptide 0.3192 23 147
2l6g-assembly1.cif.gz_A fat-ld2 double labeled construct with free ld4 peptide 0.2608 23 147
7dfe-assembly1.cif.gz_B nmr structure of tusp2-rp 0.2578 1 155
7o6d-assembly1.cif.gz_A crystal structure of human mitochondrial ferritin (hmtf) fe(ii)-loaded for 3 minutes under anaerobic environment 0.2527 22 157
ID Description Score Start End Superfamily
af_Q9LYS9_197_382_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.3394 24 159 2.60.120.200
af_Q9ZUV4_277_552_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3373 9 127 1.20.1250.20
af_P31675_12_198_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3356 11 120 1.20.1250.20
af_Q54G39_12_190_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3188 11 125 1.20.1250.20
af_I6YDV4_1_171_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3149 9 162 1.10.287.1490
ID Description Score Start End GO Terms
AF-A0A075JYW3-F1-model_v4 Membrane protein 0.9609 11 156 GO:0016020
GO:0046521
AF-A0A3S0RK50-F1-model_v4 DUF962 domain-containing protein 0.9549 9 160 GO:0016020
GO:0046521
AF-A0A522FZF1-F1-model_v4 DUF962 domain-containing protein 0.9507 9 156 GO:0016020
AF-A0A2W5KS54-F1-model_v4 DUF962 domain-containing protein 0.9443 6 159 GO:0016020
GO:0046521
AF-A0A3S0RK50-F1-model_v4 DUF962 domain-containing protein 0.9428 9 160 GO:0016020
GO:0046521

Feature Viewer

pLDDT pTM Quality
89.56 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map