F472220
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 646 | 242 | 1292 | 147 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0368965|Ga0466967_0368965_609_1067 |
| Length | 152 |
| Sequence | MPHIERTAHVGWDGNLARGAGTLDAESGAFARLPFSLPSRVGDPGGKTSPEELLAAAHGGCLTMSLAGELTSAGTPPGRLDVACTIVMDEVEGQGHQIVGSRVEIVARVDGVDAAALQAAVESAHAGCPFSQLLGRAGAEVTVTARLADQQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 59 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 63 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 92 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 93 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 94 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 95 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 97 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 98 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 99 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 100 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 101 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 102 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 103 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 104 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 105 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 106 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 107 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 109 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 110 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 111 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 112 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 113 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 114 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 115 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 117 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 118 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 119 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 120 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 121 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 122 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 123 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 124 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 125 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 126 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 127 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 128 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 130 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 131 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 132 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 133 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 134 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 135 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 136 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 137 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 138 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 139 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 140 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 141 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 142 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 143 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 144 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 145 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 146 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 147 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 148 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 149 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 150 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 151 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 211 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 212 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 213 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 214 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 215 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 216 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 219 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 220 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 221 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 222 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 223 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 224 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 242 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.85 |
| Metatranscriptomes | 0.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 14.09 |
| Rhizosphere | 85.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466967_0368965 | 3300045976 | Bacteria | 1392 |
| 2 | Ga0070658_10010792 | 3300005327 | Bacteria | 7323 |
| 3 | Ga0070658_11462830 | 3300005327 | Bacteria | 593 |
| 4 | Ga0070683_100621774 | 3300005329 | Unclassified | 1034 |
| 5 | Ga0070680_100040670 | 3300005336 | Bacteria | 3766 |
| 6 | Ga0070680_100046353 | 3300005336 | Bacteria | 3536 |
| 7 | Ga0070682_100527030 | 3300005337 | Bacteria | 920 |
| 8 | Ga0070682_100740606 | 3300005337 | Bacteria | 792 |
| 9 | Ga0068868_100242095 | 3300005338 | Unclassified | 1516 |
| 10 | Ga0068868_101308987 | 3300005338 | Unclassified | 673 |
| 11 | Ga0070660_100007655 | 3300005339 | Bacteria | 7526 |
| 12 | Ga0070660_100500912 | 3300005339 | Unclassified | 1010 |
| 13 | Ga0070660_101149054 | 3300005339 | Bacteria | 658 |
| 14 | Ga0070661_100043921 | 3300005344 | Bacteria | 3264 |
| 15 | Ga0070671_100570143 | 3300005355 | Unclassified | 977 |
| 16 | Ga0070673_100351547 | 3300005364 | Unclassified | 1308 |
| 17 | Ga0070659_100604427 | 3300005366 | Bacteria | 943 |
| 18 | Ga0070709_10002809 | 3300005434 | Bacteria | 9404 |
| 19 | Ga0070709_10021675 | 3300005434 | Bacteria | 3745 |
| 20 | Ga0070714_100003527 | 3300005435 | Bacteria | 11685 |
| 21 | Ga0070714_100026013 | 3300005435 | Bacteria | 4834 |
| 22 | Ga0070714_100027041 | 3300005435 | Bacteria | 4747 |
| 23 | Ga0070714_100235911 | 3300005435 | Unclassified | 1687 |
| 24 | Ga0070714_100540629 | 3300005435 | Bacteria | 1114 |
| 25 | Ga0070713_100022499 | 3300005436 | Bacteria | 4872 |
| 26 | Ga0070710_10000749 | 3300005437 | Bacteria | 15464 |
| 27 | Ga0070710_10002519 | 3300005437 | Bacteria | 8692 |
| 28 | Ga0070710_10296504 | 3300005437 | Bacteria | 1054 |
| 29 | Ga0070711_100015426 | 3300005439 | Bacteria | 4836 |
| 30 | Ga0070711_100501666 | 3300005439 | Bacteria | 1001 |
| 31 | Ga0070711_100846721 | 3300005439 | Unclassified | 778 |
| 32 | Ga0070711_101005305 | 3300005439 | Bacteria | 715 |
| 33 | Ga0070694_100228364 | 3300005444 | Bacteria | 1399 |
| 34 | Ga0070708_100905546 | 3300005445 | Bacteria | 828 |
| 35 | Ga0070678_100096159 | 3300005456 | Bacteria | 2284 |
| 36 | Ga0070678_101482130 | 3300005456 | Bacteria | 635 |
| 37 | Ga0070681_10005602 | 3300005458 | Bacteria | 12133 |
| 38 | Ga0070681_10013001 | 3300005458 | Bacteria | 8266 |
| 39 | Ga0070681_10027893 | 3300005458 | Bacteria | 5676 |
| 40 | Ga0070681_10292520 | 3300005458 | Bacteria | 1539 |
| 41 | Ga0070707_100001390 | 3300005468 | Bacteria | 23809 |
| 42 | Ga0070707_100139653 | 3300005468 | Bacteria | 2358 |
| 43 | Ga0070707_100953595 | 3300005468 | Bacteria | 823 |
| 44 | Ga0070698_100150898 | 3300005471 | Bacteria | 2272 |
| 45 | Ga0070698_100182157 | 3300005471 | Bacteria | 2039 |
| 46 | Ga0070679_100060794 | 3300005530 | Bacteria | 3765 |
| 47 | Ga0070679_101264111 | 3300005530 | Unclassified | 684 |
| 48 | Ga0070684_100077152 | 3300005535 | Bacteria | 2942 |
| 49 | Ga0070684_100155912 | 3300005535 | Unclassified | 2071 |
| 50 | Ga0070695_100000473 | 3300005545 | Bacteria | 20860 |
| 51 | Ga0070693_100714756 | 3300005547 | Bacteria | 735 |
| 52 | Ga0070693_101145834 | 3300005547 | Unclassified | 595 |
| 53 | Ga0070665_100283047 | 3300005548 | Unclassified | 1660 |
| 54 | Ga0068855_100022931 | 3300005563 | Bacteria | 7482 |
| 55 | Ga0070664_100260950 | 3300005564 | Unclassified | 1559 |
| 56 | Ga0068857_100166888 | 3300005577 | Bacteria | 2000 |
| 57 | Ga0068856_100096345 | 3300005614 | Bacteria | 2947 |
| 58 | Ga0068856_100195704 | 3300005614 | Bacteria | 2035 |
| 59 | Ga0068852_100608306 | 3300005616 | Bacteria | 1098 |
| 60 | Ga0068852_101342701 | 3300005616 | Bacteria | 737 |
| 61 | Ga0068864_100552499 | 3300005618 | Unclassified | 1113 |
| 62 | Ga0068851_10810561 | 3300005834 | Bacteria | 582 |
| 63 | Ga0070717_10016747 | 3300006028 | Bacteria | 5689 |
| 64 | Ga0070717_10020833 | 3300006028 | Bacteria | 5161 |
| 65 | Ga0070717_10031394 | 3300006028 | Bacteria | 4274 |
| 66 | Ga0070717_10226620 | 3300006028 | Bacteria | 1644 |
| 67 | Ga0070717_10241230 | 3300006028 | Bacteria | 1594 |
| 68 | Ga0070715_10000369 | 3300006163 | Bacteria | 11279 |
| 69 | Ga0070716_100124654 | 3300006173 | Bacteria | 1618 |
| 70 | Ga0070716_100340645 | 3300006173 | Bacteria | 1058 |
| 71 | Ga0070716_100743209 | 3300006173 | Bacteria | 754 |
| 72 | Ga0070712_100207737 | 3300006175 | Bacteria | 1542 |
| 73 | Ga0070712_100264256 | 3300006175 | Bacteria | 1380 |
| 74 | Ga0070712_100269470 | 3300006175 | Bacteria | 1367 |
| 75 | Ga0070712_100362639 | 3300006175 | Bacteria | 1189 |
| 76 | Ga0070712_100528878 | 3300006175 | Bacteria | 991 |
| 77 | Ga0070712_100691835 | 3300006175 | Unclassified | 869 |
| 78 | Ga0097621_100583478 | 3300006237 | Bacteria | 1020 |
| 79 | Ga0097621_101339999 | 3300006237 | Bacteria | 677 |
| 80 | Ga0075434_100006835 | 3300006871 | Bacteria | 10500 |
| 81 | Ga0105240_10011632 | 3300009093 | Bacteria | 12237 |
| 82 | Ga0105240_10027704 | 3300009093 | Bacteria | 7415 |
| 83 | Ga0105240_10516112 | 3300009093 | Bacteria | 1327 |
| 84 | Ga0105240_10819401 | 3300009093 | Bacteria | 1007 |
| 85 | Ga0105240_11179439 | 3300009093 | Bacteria | 812 |
| 86 | Ga0105240_11443848 | 3300009093 | Bacteria | 722 |
| 87 | Ga0105245_10119429 | 3300009098 | Bacteria | 2461 |
| 88 | Ga0105245_10228952 | 3300009098 | Unclassified | 1797 |
| 89 | Ga0105243_11063990 | 3300009148 | Bacteria | 815 |
| 90 | Ga0105241_10445454 | 3300009174 | Bacteria | 1145 |
| 91 | Ga0105242_11409202 | 3300009176 | Bacteria | 725 |
| 92 | Ga0105248_10200743 | 3300009177 | Bacteria | 2247 |
| 93 | Ga0105237_10029761 | 3300009545 | Bacteria | 5549 |
| 94 | Ga0105237_10453124 | 3300009545 | Bacteria | 1289 |
| 95 | Ga0105238_10306688 | 3300009551 | Bacteria | 1572 |
| 96 | Ga0105239_10883248 | 3300010375 | Unclassified | 1026 |
| 97 | Ga0105246_11445977 | 3300011119 | Bacteria | 643 |
| 98 | Ga0157373_10365462 | 3300013100 | Bacteria | 1031 |
| 99 | Ga0157370_10550578 | 3300013104 | Bacteria | 1057 |
| 100 | Ga0157369_10004734 | 3300013105 | Bacteria | 15988 |
| 101 | Ga0157369_10130297 | 3300013105 | Bacteria | 2666 |
| 102 | Ga0157369_10229327 | 3300013105 | Bacteria | 1942 |
| 103 | Ga0157374_10301814 | 3300013296 | Unclassified | 1584 |
| 104 | Ga0157374_10596283 | 3300013296 | Bacteria | 1114 |
| 105 | Ga0163162_10226085 | 3300013306 | Unclassified | 2001 |
| 106 | Ga0157372_10004242 | 3300013307 | Bacteria | 15325 |
| 107 | Ga0157372_10225797 | 3300013307 | Bacteria | 2171 |
| 108 | Ga0157372_10361214 | 3300013307 | Bacteria | 1692 |
| 109 | Ga0157372_10405691 | 3300013307 | Unclassified | 1588 |
| 110 | Ga0157372_10988490 | 3300013307 | Bacteria | 975 |
| 111 | Ga0157372_11785698 | 3300013307 | Unclassified | 707 |
| 112 | Ga0157372_12031286 | 3300013307 | Bacteria | 661 |
| 113 | Ga0157375_10177433 | 3300013308 | Unclassified | 2281 |
| 114 | Ga0157375_10685994 | 3300013308 | Unclassified | 1179 |
| 115 | Ga0182008_10024912 | 3300014497 | Bacteria | 3043 |
| 116 | Ga0157379_10235851 | 3300014968 | Bacteria | 1659 |
| 117 | Ga0157376_11196925 | 3300014969 | Unclassified | 788 |
| 118 | Ga0206354_11065840 | 3300020081 | Bacteria | 1522 |
| 119 | Ga0213876_10056142 | 3300021384 | Bacteria | 2079 |
| 120 | Ga0207692_10001782 | 3300025898 | Bacteria | 8174 |
| 121 | Ga0207692_10179558 | 3300025898 | Bacteria | 1232 |
| 122 | Ga0207685_10003611 | 3300025905 | Bacteria | 3791 |
| 123 | Ga0207699_10018389 | 3300025906 | Bacteria | 3702 |
| 124 | Ga0207699_10126165 | 3300025906 | Bacteria | 1662 |
| 125 | Ga0207699_10209427 | 3300025906 | Bacteria | 1325 |
| 126 | Ga0207705_10085996 | 3300025909 | Bacteria | 2297 |
| 127 | Ga0207684_11014337 | 3300025910 | Bacteria | 694 |
| 128 | Ga0207707_10004043 | 3300025912 | Bacteria | 13003 |
| 129 | Ga0207707_10210769 | 3300025912 | Bacteria | 1692 |
| 130 | Ga0207707_10691530 | 3300025912 | Unclassified | 857 |
| 131 | Ga0207695_10024390 | 3300025913 | Bacteria | 6808 |
| 132 | Ga0207695_10047381 | 3300025913 | Bacteria | 4550 |
| 133 | Ga0207695_10984014 | 3300025913 | Bacteria | 723 |
| 134 | Ga0207671_10068882 | 3300025914 | Bacteria | 2637 |
| 135 | Ga0207693_10002770 | 3300025915 | Bacteria | 15175 |
| 136 | Ga0207693_10004412 | 3300025915 | Bacteria | 11894 |
| 137 | Ga0207693_10355148 | 3300025915 | Bacteria | 1147 |
| 138 | Ga0207693_10378299 | 3300025915 | Unclassified | 1107 |
| 139 | Ga0207663_10004334 | 3300025916 | Bacteria | 7044 |
| 140 | Ga0207663_10490961 | 3300025916 | Bacteria | 953 |
| 141 | Ga0207660_10054335 | 3300025917 | Bacteria | 2858 |
| 142 | Ga0207660_10055534 | 3300025917 | Bacteria | 2830 |
| 143 | Ga0207657_10001500 | 3300025919 | Bacteria | 24976 |
| 144 | Ga0207657_10010053 | 3300025919 | Bacteria | 9464 |
| 145 | Ga0207657_10755778 | 3300025919 | Bacteria | 753 |
| 146 | Ga0207649_10017821 | 3300025920 | Bacteria | 4028 |
| 147 | Ga0207652_10567570 | 3300025921 | Unclassified | 1019 |
| 148 | Ga0207652_10609306 | 3300025921 | Bacteria | 979 |
| 149 | Ga0207652_10660008 | 3300025921 | Unclassified | 935 |
| 150 | Ga0207646_10001697 | 3300025922 | Bacteria | 26787 |
| 151 | Ga0207646_10040548 | 3300025922 | Bacteria | 4187 |
| 152 | Ga0207646_10075781 | 3300025922 | Bacteria | 3006 |
| 153 | Ga0207687_10017580 | 3300025927 | Bacteria | 4710 |
| 154 | Ga0207700_10071824 | 3300025928 | Bacteria | 2666 |
| 155 | Ga0207700_10106422 | 3300025928 | Bacteria | 2248 |
| 156 | Ga0207664_10012781 | 3300025929 | Bacteria | 6011 |
| 157 | Ga0207664_10290404 | 3300025929 | Unclassified | 1437 |
| 158 | Ga0207664_10880969 | 3300025929 | Bacteria | 804 |
| 159 | Ga0207690_10022448 | 3300025932 | Bacteria | 3927 |
| 160 | Ga0207690_10059954 | 3300025932 | Bacteria | 2580 |
| 161 | Ga0207665_10000146 | 3300025939 | Bacteria | 47929 |
| 162 | Ga0207665_10043483 | 3300025939 | Bacteria | 3003 |
| 163 | Ga0207711_10899620 | 3300025941 | Unclassified | 823 |
| 164 | Ga0207679_10104563 | 3300025945 | Bacteria | 2222 |
| 165 | Ga0207667_10241312 | 3300025949 | Bacteria | 1849 |
| 166 | Ga0207676_12446131 | 3300026095 | Bacteria | 519 |
| 167 | Ga0207674_10107983 | 3300026116 | Bacteria | 2760 |
| 168 | Ga0207683_10130165 | 3300026121 | Bacteria | 2263 |
| 169 | Ga0207698_11010647 | 3300026142 | Bacteria | 842 |
| 170 | Ga0268266_10285071 | 3300028379 | Unclassified | 1537 |
| 171 | Ga0265319_1006131 | 3300028563 | Bacteria | 5618 |
| 172 | Ga0265334_10019826 | 3300028573 | Bacteria | 2761 |
| 173 | Ga0265334_10097869 | 3300028573 | Bacteria | 1064 |
| 174 | Ga0265318_10004401 | 3300028577 | Bacteria | 6838 |
| 175 | Ga0265322_10039745 | 3300028654 | Bacteria | 1339 |
| 176 | Ga0265338_10009445 | 3300028800 | Bacteria | 11623 |
| 177 | Ga0265338_10013850 | 3300028800 | Bacteria | 9059 |
| 178 | Ga0265338_10018792 | 3300028800 | Bacteria | 7374 |
| 179 | Ga0265324_10091903 | 3300029957 | Bacteria | 1032 |
| 180 | Ga0265330_10111714 | 3300031235 | Bacteria | 1167 |
| 181 | Ga0265328_10188401 | 3300031239 | Bacteria | 781 |
| 182 | Ga0265320_10019895 | 3300031240 | Bacteria | 3655 |
| 183 | Ga0265325_10058827 | 3300031241 | Bacteria | 1956 |
| 184 | Ga0265325_10193483 | 3300031241 | Bacteria | 941 |
| 185 | Ga0265329_10038063 | 3300031242 | Bacteria | 1548 |
| 186 | Ga0265340_10088836 | 3300031247 | Bacteria | 1447 |
| 187 | Ga0265340_10290232 | 3300031247 | Bacteria | 726 |
| 188 | Ga0265339_10022293 | 3300031249 | Bacteria | 3670 |
| 189 | Ga0265327_10023129 | 3300031251 | Bacteria | 3689 |
| 190 | Ga0265327_10029058 | 3300031251 | Bacteria | 3149 |
| 191 | Ga0265316_10010379 | 3300031344 | Bacteria | 8492 |
| 192 | Ga0265316_10330505 | 3300031344 | Bacteria | 1106 |
| 193 | Ga0265316_10713449 | 3300031344 | Bacteria | 706 |
| 194 | Ga0265313_10204858 | 3300031595 | Bacteria | 819 |
| 195 | Ga0265314_10001460 | 3300031711 | Bacteria | 26370 |
| 196 | Ga0265314_10029908 | 3300031711 | Bacteria | 4041 |
| 197 | Ga0265314_10216087 | 3300031711 | Bacteria | 1122 |
| 198 | Ga0265342_10041735 | 3300031712 | Bacteria | 2775 |
| 199 | Ga0307416_101851102 | 3300032002 | Bacteria | 707 |
| 200 | Ga0316583_10034677 | 3300032133 | Bacteria | 1791 |
| 201 | Ga0373948_0131999 | 3300034817 | Bacteria | 611 |
| 202 | Ga0373926_0012718 | 3300035083 | Bacteria | 2848 |
| 203 | Ga0373940_0092819 | 3300035088 | Bacteria | 907 |
| 204 | Ga0373944_0026941 | 3300035089 | Bacteria | 1701 |
| 205 | Ga0373932_0166690 | 3300035112 | Bacteria | 765 |
| 206 | Ga0373941_0045479 | 3300035115 | Bacteria | 1374 |
| 207 | Ga0373945_0079410 | 3300035116 | Bacteria | 1254 |
| 208 | Ga0373956_0134985 | 3300035119 | Unclassified | 1157 |
| 209 | Ga0373957_0085734 | 3300035120 | Bacteria | 1247 |
| 210 | Ga0373960_0258476 | 3300035121 | Bacteria | 635 |
| 211 | Ga0373943_0018287 | 3300035170 | Bacteria | 3217 |
| 212 | Ga0373955_0217121 | 3300035172 | Bacteria | 1141 |
| 213 | Ga0373955_0670837 | 3300035172 | Unclassified | 636 |
| 214 | Ga0373962_0097454 | 3300035242 | Bacteria | 913 |
| 215 | Ga0373924_0055148 | 3300035410 | Bacteria | 1654 |
| 216 | Ga0373931_0029535 | 3300035691 | Bacteria | 2816 |
| 217 | Ga0373931_0378918 | 3300035691 | Bacteria | 891 |
| 218 | Ga0373947_0002722 | 3300035725 | Bacteria | 10609 |
| 219 | Ga0373947_0274771 | 3300035725 | Unclassified | 1119 |
| 220 | Ga0373937_0000749 | 3300036401 | Bacteria | 28028 |
| 221 | Ga0373937_0351253 | 3300036401 | Bacteria | 1397 |
| 222 | Ga0373925_0007119 | 3300037068 | Bacteria | 8176 |
| 223 | Ga0395899_0047075 | 3300037312 | Bacteria | 3211 |
| 224 | Ga0395900_0199123 | 3300037418 | Bacteria | 2027 |
| 225 | Ga0395900_0205582 | 3300037418 | Bacteria | 1990 |
| 226 | Ga0395898_0319921 | 3300037466 | Unclassified | 1480 |
| 227 | Ga0395898_0552384 | 3300037466 | Bacteria | 1094 |
| 228 | Ga0395898_0936586 | 3300037466 | Bacteria | 804 |
| 229 | Ga0395898_1916853 | 3300037466 | Bacteria | 513 |
| 230 | Ga0395905_1324808 | 3300037471 | Bacteria | 624 |
| 231 | Ga0395901_0011415 | 3300038443 | Bacteria | 8999 |
| 232 | Ga0395901_0220929 | 3300038443 | Bacteria | 1980 |
| 233 | Ga0395901_0551556 | 3300038443 | Bacteria | 1168 |
| 234 | Ga0436365_0848685 | 3300039437 | Bacteria | 892 |
| 235 | Ga0436365_1808150 | 3300039437 | Bacteria | 6273 |
| 236 | Ga0436360_0428150 | 3300039438 | Bacteria | 6728 |
| 237 | Ga0451853_3506410 | 3300041512 | Unclassified | 601 |
| 238 | Ga0451577_1012021 | 3300042876 | Unclassified | 746 |
| 239 | Ga0466969_0001166 | 3300044656 | Bacteria | 14153 |
| 240 | Ga0466969_0002173 | 3300044656 | Bacteria | 10476 |
| 241 | Ga0466969_0081655 | 3300044656 | Bacteria | 1542 |
| 242 | Ga0466965_0058960 | 3300044683 | Bacteria | 1915 |
| 243 | Ga0466966_0040292 | 3300044684 | Bacteria | 3006 |
| 244 | Ga0466966_0057697 | 3300044684 | Bacteria | 2454 |
| 245 | Ga0466966_0114390 | 3300044684 | Unclassified | 1661 |
| 246 | Ga0466966_0121000 | 3300044684 | Bacteria | 1608 |
| 247 | Ga0466966_0379131 | 3300044684 | Bacteria | 850 |
| 248 | Ga0466961_0005135 | 3300044693 | Bacteria | 8241 |
| 249 | Ga0466961_0039587 | 3300044693 | Bacteria | 3022 |
| 250 | Ga0466961_0051174 | 3300044693 | Unclassified | 2638 |
| 251 | Ga0466961_0051918 | 3300044693 | Bacteria | 2617 |
| 252 | Ga0466961_0054026 | 3300044693 | Bacteria | 2562 |
| 253 | Ga0466961_0055944 | 3300044693 | Bacteria | 2514 |
| 254 | Ga0466963_0000509 | 3300044694 | Bacteria | 18145 |
| 255 | Ga0466963_0000833 | 3300044694 | Bacteria | 15462 |
| 256 | Ga0466963_0002118 | 3300044694 | Bacteria | 10974 |
| 257 | Ga0466963_0002832 | 3300044694 | Bacteria | 9778 |
| 258 | Ga0466963_0002984 | 3300044694 | Bacteria | 9562 |
| 259 | Ga0466963_0004243 | 3300044694 | Bacteria | 8315 |
| 260 | Ga0466963_0004416 | 3300044694 | Bacteria | 8170 |
| 261 | Ga0466963_0005742 | 3300044694 | Bacteria | 7293 |
| 262 | Ga0466963_0009139 | 3300044694 | Bacteria | 5960 |
| 263 | Ga0466963_0015231 | 3300044694 | Bacteria | 4757 |
| 264 | Ga0466963_0027849 | 3300044694 | Bacteria | 3623 |
| 265 | Ga0466963_0037108 | 3300044694 | Bacteria | 3181 |
| 266 | Ga0466963_0046236 | 3300044694 | Unclassified | 2869 |
| 267 | Ga0466963_0080480 | 3300044694 | Bacteria | 2205 |
| 268 | Ga0466963_0095784 | 3300044694 | Bacteria | 2026 |
| 269 | Ga0466963_0282084 | 3300044694 | Bacteria | 1167 |
| 270 | Ga0466963_0285202 | 3300044694 | Bacteria | 1161 |
| 271 | Ga0466963_0568837 | 3300044694 | Bacteria | 800 |
| 272 | Ga0466963_0612421 | 3300044694 | Unclassified | 769 |
| 273 | Ga0466963_0761547 | 3300044694 | Unclassified | 683 |
| 274 | Ga0466963_0855906 | 3300044694 | Bacteria | 641 |
| 275 | Ga0466964_0005037 | 3300044706 | Bacteria | 4886 |
| 276 | Ga0466964_0013415 | 3300044706 | Bacteria | 3109 |
| 277 | Ga0466964_0090640 | 3300044706 | Unclassified | 1330 |
| 278 | Ga0466964_0125052 | 3300044706 | Bacteria | 1164 |
| 279 | Ga0466964_0180814 | 3300044706 | Bacteria | 1000 |
| 280 | Ga0466964_0257254 | 3300044706 | Bacteria | 863 |
| 281 | Ga0466964_0269751 | 3300044706 | Bacteria | 846 |
| 282 | Ga0466964_0333659 | 3300044706 | Bacteria | 774 |
| 283 | Ga0466964_0476193 | 3300044706 | Bacteria | 666 |
| 284 | Ga0466971_0003402 | 3300044719 | Bacteria | 6799 |
| 285 | Ga0466971_0005931 | 3300044719 | Bacteria | 5313 |
| 286 | Ga0466971_0016840 | 3300044719 | Bacteria | 3229 |
| 287 | Ga0466971_0033390 | 3300044719 | Unclassified | 2306 |
| 288 | Ga0466971_0237154 | 3300044719 | Bacteria | 867 |
| 289 | Ga0466971_0359721 | 3300044719 | Bacteria | 705 |
| 290 | Ga0466968_0002701 | 3300044735 | Bacteria | 6544 |
| 291 | Ga0466968_0005662 | 3300044735 | Bacteria | 4681 |
| 292 | Ga0466968_0005954 | 3300044735 | Bacteria | 4572 |
| 293 | Ga0466968_0006897 | 3300044735 | Bacteria | 4300 |
| 294 | Ga0466968_0020355 | 3300044735 | Bacteria | 2678 |
| 295 | Ga0466968_0024246 | 3300044735 | Bacteria | 2477 |
| 296 | Ga0466968_0054237 | 3300044735 | Bacteria | 1718 |
| 297 | Ga0466968_0079840 | 3300044735 | Unclassified | 1436 |
| 298 | Ga0466968_0254149 | 3300044735 | Bacteria | 835 |
| 299 | Ga0466968_0293534 | 3300044735 | Bacteria | 780 |
| 300 | Ga0466970_0069984 | 3300044765 | Bacteria | 1886 |
| 301 | Ga0466970_0147147 | 3300044765 | Bacteria | 1300 |
| 302 | Ga0466957_0000407 | 3300044842 | Bacteria | 21025 |
| 303 | Ga0466957_0005648 | 3300044842 | Bacteria | 7033 |
| 304 | Ga0466957_0016683 | 3300044842 | Bacteria | 4296 |
| 305 | Ga0466957_0024708 | 3300044842 | Bacteria | 3558 |
| 306 | Ga0466957_0040250 | 3300044842 | Bacteria | 2822 |
| 307 | Ga0466957_0115259 | 3300044842 | Bacteria | 1708 |
| 308 | Ga0466957_0257609 | 3300044842 | Bacteria | 1162 |
| 309 | Ga0466957_0293240 | 3300044842 | Unclassified | 1091 |
| 310 | Ga0466957_0802676 | 3300044842 | Bacteria | 669 |
| 311 | Ga0466957_0803385 | 3300044842 | Bacteria | 668 |
| 312 | Ga0466957_0864004 | 3300044842 | Bacteria | 645 |
| 313 | Ga0466957_0958499 | 3300044842 | Bacteria | 613 |
| 314 | Ga0466960_0026470 | 3300044901 | Bacteria | 2635 |
| 315 | Ga0466959_0000954 | 3300045049 | Bacteria | 17196 |
| 316 | Ga0466959_0004817 | 3300045049 | Bacteria | 9115 |
| 317 | Ga0466959_0006328 | 3300045049 | Bacteria | 8188 |
| 318 | Ga0466959_0015121 | 3300045049 | Bacteria | 5621 |
| 319 | Ga0466959_0051781 | 3300045049 | Bacteria | 3009 |
| 320 | Ga0466959_0086580 | 3300045049 | Bacteria | 2254 |
| 321 | Ga0466958_0003774 | 3300045836 | Bacteria | 7911 |
| 322 | Ga0466958_0008219 | 3300045836 | Bacteria | 5779 |
| 323 | Ga0466958_0008400 | 3300045836 | Bacteria | 5725 |
| 324 | Ga0466958_0012994 | 3300045836 | Bacteria | 4730 |
| 325 | Ga0466958_0035555 | 3300045836 | Bacteria | 2976 |
| 326 | Ga0466958_0071491 | 3300045836 | Bacteria | 2124 |
| 327 | Ga0466958_0119172 | 3300045836 | Bacteria | 1651 |
| 328 | Ga0466958_0136517 | 3300045836 | Bacteria | 1542 |
| 329 | Ga0466958_0156310 | 3300045836 | Bacteria | 1439 |
| 330 | Ga0466958_0370136 | 3300045836 | Bacteria | 923 |
| 331 | Ga0466958_0579048 | 3300045836 | Bacteria | 730 |
| 332 | Ga0466958_0625239 | 3300045836 | Bacteria | 701 |
| 333 | Ga0466958_0963122 | 3300045836 | Bacteria | 557 |
| 334 | Ga0466967_0001619 | 3300045976 | Bacteria | 13298 |
| 335 | Ga0466967_0004820 | 3300045976 | Bacteria | 9195 |
| 336 | Ga0466967_0007894 | 3300045976 | Bacteria | 7736 |
| 337 | Ga0466967_0010328 | 3300045976 | Bacteria | 6996 |
| 338 | Ga0466967_0021064 | 3300045976 | Bacteria | 5282 |
| 339 | Ga0466967_0022778 | 3300045976 | Bacteria | 5121 |
| 340 | Ga0466967_0023068 | 3300045976 | Bacteria | 5094 |
| 341 | Ga0466967_0028152 | 3300045976 | Bacteria | 4687 |
| 342 | Ga0466967_0036162 | 3300045976 | Bacteria | 4213 |
| 343 | Ga0466967_0053333 | 3300045976 | Bacteria | 3553 |
| 344 | Ga0466967_0059527 | 3300045976 | Bacteria | 3381 |
| 345 | Ga0466967_0103009 | 3300045976 | Bacteria | 2612 |
| 346 | Ga0466967_0149795 | 3300045976 | Bacteria | 2179 |
| 347 | Ga0466967_0195285 | 3300045976 | Bacteria | 1914 |
| 348 | Ga0466967_0228828 | 3300045976 | Bacteria | 1769 |
| 349 | Ga0466967_0271755 | 3300045976 | Bacteria | 1624 |
| 350 | Ga0466967_0351261 | 3300045976 | Unclassified | 1427 |
| 351 | Ga0466967_0424398 | 3300045976 | Unclassified | 1296 |
| 352 | Ga0466967_0544121 | 3300045976 | Bacteria | 1142 |
| 353 | Ga0466967_0559376 | 3300045976 | Bacteria | 1126 |
| 354 | Ga0466967_0604757 | 3300045976 | Unclassified | 1082 |
| 355 | Ga0466967_0628987 | 3300045976 | Bacteria | 1060 |
| 356 | Ga0466967_0774314 | 3300045976 | Bacteria | 952 |
| 357 | Ga0466967_0902901 | 3300045976 | Bacteria | 878 |
| 358 | Ga0466967_1355715 | 3300045976 | Bacteria | 708 |
| 359 | Ga0466967_1588381 | 3300045976 | Bacteria | 651 |
| 360 | Ga0466967_1845165 | 3300045976 | Bacteria | 601 |
| 361 | Ga0495592_0000728 | 3300046454 | Bacteria | 23022 |
| 362 | Ga0495592_0011664 | 3300046454 | Bacteria | 6656 |
| 363 | Ga0495629_0013827 | 3300046459 | Bacteria | 5823 |
| 364 | Ga0495629_0016809 | 3300046459 | Bacteria | 5250 |
| 365 | Ga0495629_0039564 | 3300046459 | Bacteria | 3318 |
| 366 | Ga0495629_0110757 | 3300046459 | Bacteria | 1914 |
| 367 | Ga0495629_0251632 | 3300046459 | Bacteria | 1216 |
| 368 | Ga0495629_0522899 | 3300046459 | Bacteria | 798 |
| 369 | Ga0495641_0002937 | 3300046461 | Bacteria | 13135 |
| 370 | Ga0495641_0036618 | 3300046461 | Bacteria | 2305 |
| 371 | Ga0495641_0045030 | 3300046461 | Bacteria | 2033 |
| 372 | Ga0495651_0000699 | 3300046462 | Bacteria | 26062 |
| 373 | Ga0495651_0024964 | 3300046462 | Bacteria | 4649 |
| 374 | Ga0495651_0125131 | 3300046462 | Bacteria | 1883 |
| 375 | Ga0495651_0170386 | 3300046462 | Bacteria | 1551 |
| 376 | Ga0495651_0248183 | 3300046462 | Bacteria | 1217 |
| 377 | Ga0495653_0003907 | 3300046463 | Bacteria | 12046 |
| 378 | Ga0495653_0014734 | 3300046463 | Bacteria | 6377 |
| 379 | Ga0495653_0051570 | 3300046463 | Unclassified | 3158 |
| 380 | Ga0495653_0139285 | 3300046463 | Unclassified | 1708 |
| 381 | Ga0495653_0583347 | 3300046463 | Bacteria | 689 |
| 382 | Ga0495582_0005208 | 3300046473 | Bacteria | 7278 |
| 383 | Ga0495582_0025283 | 3300046473 | Bacteria | 3253 |
| 384 | Ga0495582_0046358 | 3300046473 | Bacteria | 2394 |
| 385 | Ga0495582_0846575 | 3300046473 | Unclassified | 529 |
| 386 | Ga0495639_0000884 | 3300046475 | Bacteria | 13575 |
| 387 | Ga0495639_0380741 | 3300046475 | Bacteria | 711 |
| 388 | Ga0495662_0001154 | 3300046476 | Bacteria | 13002 |
| 389 | Ga0495662_0193351 | 3300046476 | Bacteria | 1003 |
| 390 | Ga0495664_0159689 | 3300046477 | Bacteria | 1367 |
| 391 | Ga0495664_0170848 | 3300046477 | Bacteria | 1319 |
| 392 | Ga0495584_0005558 | 3300046491 | Bacteria | 6672 |
| 393 | Ga0495585_0020222 | 3300046492 | Unclassified | 3831 |
| 394 | Ga0495596_0014063 | 3300046500 | Bacteria | 3376 |
| 395 | Ga0495608_0004527 | 3300046511 | Bacteria | 9928 |
| 396 | Ga0495608_0015640 | 3300046511 | Bacteria | 5256 |
| 397 | Ga0495608_0072399 | 3300046511 | Bacteria | 2248 |
| 398 | Ga0495618_0000821 | 3300046514 | Bacteria | 21621 |
| 399 | Ga0495618_0050610 | 3300046514 | Bacteria | 2624 |
| 400 | Ga0495628_0001050 | 3300046516 | Bacteria | 25288 |
| 401 | Ga0495628_0074234 | 3300046516 | Bacteria | 2649 |
| 402 | Ga0495628_0404425 | 3300046516 | Unclassified | 997 |
| 403 | Ga0495628_0520633 | 3300046516 | Unclassified | 857 |
| 404 | Ga0495630_0040017 | 3300046517 | Bacteria | 3503 |
| 405 | Ga0495630_0336001 | 3300046517 | Bacteria | 1155 |
| 406 | Ga0495630_0539890 | 3300046517 | Bacteria | 894 |
| 407 | Ga0495631_0070944 | 3300046518 | Unclassified | 1506 |
| 408 | Ga0495637_0027071 | 3300046520 | Unclassified | 2569 |
| 409 | Ga0495666_0000805 | 3300046526 | Bacteria | 14512 |
| 410 | Ga0495642_0180216 | 3300046528 | Unclassified | 919 |
| 411 | Ga0495652_0000187 | 3300046529 | Bacteria | 70410 |
| 412 | Ga0495652_0042347 | 3300046529 | Bacteria | 3926 |
| 413 | Ga0495652_0130689 | 3300046529 | Bacteria | 1988 |
| 414 | Ga0495652_0275758 | 3300046529 | Bacteria | 1234 |
| 415 | Ga0495652_0478708 | 3300046529 | Bacteria | 867 |
| 416 | Ga0495665_0000405 | 3300046531 | Bacteria | 21950 |
| 417 | Ga0495640_0006118 | 3300046533 | Bacteria | 9537 |
| 418 | Ga0495640_0018909 | 3300046533 | Bacteria | 5096 |
| 419 | Ga0495640_0202416 | 3300046533 | Unclassified | 1258 |
| 420 | Ga0495586_0003587 | 3300046535 | Bacteria | 8312 |
| 421 | Ga0495587_0000467 | 3300046536 | Bacteria | 28207 |
| 422 | Ga0495587_0015392 | 3300046536 | Bacteria | 4778 |
| 423 | Ga0495609_0036221 | 3300046538 | Unclassified | 2229 |
| 424 | Ga0495645_0000700 | 3300046543 | Bacteria | 22971 |
| 425 | Ga0495645_0013038 | 3300046543 | Bacteria | 5870 |
| 426 | Ga0495645_0115627 | 3300046543 | Bacteria | 1894 |
| 427 | Ga0495667_0010779 | 3300046559 | Bacteria | 6179 |
| 428 | Ga0495667_0160902 | 3300046559 | Bacteria | 1444 |
| 429 | Ga0495667_0274785 | 3300046559 | Bacteria | 1070 |
| 430 | Ga0495667_0381937 | 3300046559 | Bacteria | 888 |
| 431 | Ga0495667_0655136 | 3300046559 | Bacteria | 652 |
| 432 | Ga0495656_0001006 | 3300046615 | Bacteria | 9116 |
| 433 | Ga0495668_0221167 | 3300046616 | Unclassified | 1037 |
| 434 | Ga0495634_0073090 | 3300046642 | Unclassified | 2255 |
| 435 | Ga0495634_0420032 | 3300046642 | Bacteria | 792 |
| 436 | Ga0495611_0041905 | 3300046648 | Bacteria | 2043 |
| 437 | Ga0495635_0005454 | 3300046663 | Bacteria | 8844 |
| 438 | Ga0495635_0033547 | 3300046663 | Bacteria | 3561 |
| 439 | Ga0495635_0112384 | 3300046663 | Unclassified | 1860 |
| 440 | Ga0495635_0271971 | 3300046663 | Bacteria | 1139 |
| 441 | Ga0495588_0337906 | 3300046674 | Bacteria | 792 |
| 442 | Ga0495588_0779256 | 3300046674 | Bacteria | 500 |
| 443 | Ga0495657_0014943 | 3300046675 | Bacteria | 5693 |
| 444 | Ga0495657_0022627 | 3300046675 | Bacteria | 4499 |
| 445 | Ga0495657_0032144 | 3300046675 | Bacteria | 3664 |
| 446 | Ga0495657_0055767 | 3300046675 | Bacteria | 2635 |
| 447 | Ga0495657_0274697 | 3300046675 | Bacteria | 1010 |
| 448 | Ga0495657_0753514 | 3300046675 | Bacteria | 558 |
| 449 | Ga0495599_0000333 | 3300046678 | Bacteria | 28098 |
| 450 | Ga0495599_0033347 | 3300046678 | Bacteria | 3235 |
| 451 | Ga0495599_0155036 | 3300046678 | Bacteria | 1417 |
| 452 | Ga0495623_0000045 | 3300046679 | Bacteria | 76108 |
| 453 | Ga0495623_0010123 | 3300046679 | Bacteria | 6104 |
| 454 | Ga0495623_0279077 | 3300046679 | Bacteria | 930 |
| 455 | Ga0495623_0543639 | 3300046679 | Bacteria | 609 |
| 456 | Ga0495646_0008728 | 3300046680 | Bacteria | 6439 |
| 457 | Ga0495646_0033184 | 3300046680 | Bacteria | 3210 |
| 458 | Ga0495646_0063747 | 3300046680 | Unclassified | 2187 |
| 459 | Ga0495647_0000812 | 3300046681 | Bacteria | 9337 |
| 460 | Ga0495658_0002164 | 3300046683 | Bacteria | 9942 |
| 461 | Ga0495658_0165164 | 3300046683 | Bacteria | 1367 |
| 462 | Ga0495658_0176239 | 3300046683 | Bacteria | 1325 |
| 463 | Ga0495669_0415680 | 3300046684 | Unclassified | 652 |
| 464 | Ga0495613_0025203 | 3300046689 | Bacteria | 4433 |
| 465 | Ga0495613_0029705 | 3300046689 | Bacteria | 4063 |
| 466 | Ga0495613_0030536 | 3300046689 | Bacteria | 4002 |
| 467 | Ga0495624_0002634 | 3300046690 | Bacteria | 13546 |
| 468 | Ga0495624_0167610 | 3300046690 | Bacteria | 1340 |
| 469 | Ga0495624_0177425 | 3300046690 | Bacteria | 1299 |
| 470 | Ga0495624_0377228 | 3300046690 | Bacteria | 852 |
| 471 | Ga0495670_0065972 | 3300046691 | Unclassified | 1825 |
| 472 | Ga0495600_0021442 | 3300046809 | Bacteria | 4137 |
| 473 | Ga0495600_0051441 | 3300046809 | Bacteria | 2689 |
| 474 | Ga0495600_0099232 | 3300046809 | Bacteria | 1898 |
| 475 | Ga0495600_0146196 | 3300046809 | Unclassified | 1532 |
| 476 | Ga0495600_0354541 | 3300046809 | Unclassified | 918 |
| 477 | Ga0495600_0443787 | 3300046809 | Bacteria | 803 |
| 478 | Ga0495581_0012244 | 3300047315 | Bacteria | 4968 |
| 479 | Ga0495581_0507730 | 3300047315 | Bacteria | 701 |
| 480 | Ga0495604_0000221 | 3300047317 | Bacteria | 52090 |
| 481 | Ga0495604_0067777 | 3300047317 | Bacteria | 2711 |
| 482 | Ga0495604_0822937 | 3300047317 | Bacteria | 584 |
| 483 | Ga0495674_0041238 | 3300047319 | Bacteria | 4125 |
| 484 | Ga0495674_0106129 | 3300047319 | Bacteria | 2386 |
| 485 | Ga0495674_0158000 | 3300047319 | Bacteria | 1898 |
| 486 | Ga0495674_0626719 | 3300047319 | Bacteria | 850 |
| 487 | Ga0495674_0707849 | 3300047319 | Bacteria | 790 |
| 488 | Ga0495676_0012064 | 3300047321 | Bacteria | 7793 |
| 489 | Ga0495676_0136905 | 3300047321 | Bacteria | 1760 |
| 490 | Ga0495676_0502913 | 3300047321 | Bacteria | 795 |
| 491 | Ga0495676_0703624 | 3300047321 | Bacteria | 654 |
| 492 | Ga0495680_0007898 | 3300047322 | Bacteria | 9710 |
| 493 | Ga0495680_0019972 | 3300047322 | Bacteria | 5647 |
| 494 | Ga0495680_0066266 | 3300047322 | Bacteria | 2764 |
| 495 | Ga0495680_0069874 | 3300047322 | Bacteria | 2678 |
| 496 | Ga0495680_0071493 | 3300047322 | Bacteria | 2641 |
| 497 | Ga0495675_0000301 | 3300047444 | Bacteria | 35499 |
| 498 | Ga0495675_0020394 | 3300047444 | Bacteria | 4215 |
| 499 | Ga0495675_0591475 | 3300047444 | Bacteria | 630 |
| 500 | Ga0495677_0078275 | 3300047445 | Unclassified | 1237 |
| 501 | Ga0495684_0002557 | 3300047471 | Bacteria | 14477 |
| 502 | Ga0495684_0063440 | 3300047471 | Bacteria | 2808 |
| 503 | Ga0495684_0211085 | 3300047471 | Bacteria | 1427 |
| 504 | Ga0495593_0000885 | 3300047673 | Bacteria | 17391 |
| 505 | Ga0495602_0000515 | 3300048088 | Bacteria | 36065 |
| 506 | Ga0495602_0021011 | 3300048088 | Bacteria | 6435 |
| 507 | Ga0495614_0002129 | 3300048089 | Bacteria | 8761 |
| 508 | Ga0495614_0055722 | 3300048089 | Bacteria | 1696 |
| 509 | Ga0495626_0369081 | 3300048091 | Bacteria | 558 |
| 510 | Ga0496100_0030524 | 3300048903 | Bacteria | 3344 |
| 511 | Ga0496100_0635989 | 3300048903 | Bacteria | 830 |
| 512 | Ga0496100_0637107 | 3300048903 | Bacteria | 829 |
| 513 | Ga0496101_0058148 | 3300048904 | Bacteria | 2799 |
| 514 | Ga0496101_0079457 | 3300048904 | Unclassified | 2421 |
| 515 | Ga0496101_0158572 | 3300048904 | Bacteria | 1734 |
| 516 | Ga0496101_0208937 | 3300048904 | Unclassified | 1512 |
| 517 | Ga0496101_0412278 | 3300048904 | Bacteria | 1064 |
| 518 | Ga0496101_0947273 | 3300048904 | Bacteria | 677 |
| 519 | Ga0496101_1035641 | 3300048904 | Bacteria | 645 |
| 520 | Ga0496102_0004845 | 3300048905 | Bacteria | 11383 |
| 521 | Ga0496102_0128585 | 3300048905 | Unclassified | 2369 |
| 522 | Ga0496102_1546150 | 3300048905 | Bacteria | 582 |
| 523 | Ga0496103_0004250 | 3300048906 | Bacteria | 8703 |
| 524 | Ga0496103_0165167 | 3300048906 | Bacteria | 1420 |
| 525 | Ga0496104_0001804 | 3300048907 | Bacteria | 18557 |
| 526 | Ga0496104_0031685 | 3300048907 | Bacteria | 4918 |
| 527 | Ga0496104_0052566 | 3300048907 | Bacteria | 3848 |
| 528 | Ga0496104_0124130 | 3300048907 | Bacteria | 2479 |
| 529 | Ga0496104_0132089 | 3300048907 | Bacteria | 2398 |
| 530 | Ga0496104_0396872 | 3300048907 | Bacteria | 1292 |
| 531 | Ga0496104_0449556 | 3300048907 | Unclassified | 1200 |
| 532 | Ga0496104_0763252 | 3300048907 | Bacteria | 874 |
| 533 | Ga0496105_0010606 | 3300048908 | Bacteria | 7250 |
| 534 | Ga0496105_0020837 | 3300048908 | Bacteria | 5300 |
| 535 | Ga0496105_0027306 | 3300048908 | Bacteria | 4661 |
| 536 | Ga0496105_0027402 | 3300048908 | Bacteria | 4654 |
| 537 | Ga0496105_0114867 | 3300048908 | Bacteria | 2221 |
| 538 | Ga0496105_0138919 | 3300048908 | Bacteria | 2001 |
| 539 | Ga0496105_0287096 | 3300048908 | Bacteria | 1325 |
| 540 | Ga0496105_0361210 | 3300048908 | Unclassified | 1158 |
| 541 | Ga0496106_0006189 | 3300048909 | Bacteria | 8851 |
| 542 | Ga0496106_0151804 | 3300048909 | Bacteria | 1828 |
| 543 | Ga0496106_0379866 | 3300048909 | Unclassified | 1135 |
| 544 | Ga0496107_0013191 | 3300048910 | Bacteria | 5773 |
| 545 | Ga0496107_0048034 | 3300048910 | Bacteria | 3074 |
| 546 | Ga0496107_0078266 | 3300048910 | Unclassified | 2409 |
| 547 | Ga0496107_0181754 | 3300048910 | Bacteria | 1562 |
| 548 | Ga0496107_0557108 | 3300048910 | Bacteria | 849 |
| 549 | Ga0496107_0916483 | 3300048910 | Bacteria | 638 |
| 550 | Ga0496108_0010171 | 3300048911 | Bacteria | 7637 |
| 551 | Ga0496108_0020497 | 3300048911 | Bacteria | 5436 |
| 552 | Ga0496108_0042298 | 3300048911 | Bacteria | 3803 |
| 553 | Ga0496108_0090743 | 3300048911 | Unclassified | 2597 |
| 554 | Ga0496108_0109438 | 3300048911 | Bacteria | 2361 |
| 555 | Ga0496108_0194226 | 3300048911 | Bacteria | 1760 |
| 556 | Ga0496108_0359213 | 3300048911 | Unclassified | 1271 |
| 557 | Ga0496109_0002387 | 3300048912 | Bacteria | 15697 |
| 558 | Ga0496109_0006259 | 3300048912 | Bacteria | 10010 |
| 559 | Ga0496109_0019618 | 3300048912 | Bacteria | 5965 |
| 560 | Ga0496109_0050778 | 3300048912 | Bacteria | 3776 |
| 561 | Ga0496109_0111836 | 3300048912 | Bacteria | 2539 |
| 562 | Ga0496109_0595940 | 3300048912 | Unclassified | 1041 |
| 563 | Ga0496109_1389277 | 3300048912 | Bacteria | 638 |
| 564 | Ga0496110_0050731 | 3300048913 | Bacteria | 3644 |
| 565 | Ga0496110_0257538 | 3300048913 | Unclassified | 1588 |
| 566 | Ga0496110_0263020 | 3300048913 | Bacteria | 1570 |
| 567 | Ga0496110_0271761 | 3300048913 | Unclassified | 1543 |
| 568 | Ga0496110_0286512 | 3300048913 | Bacteria | 1500 |
| 569 | Ga0496110_0379582 | 3300048913 | Bacteria | 1288 |
| 570 | Ga0496110_0778938 | 3300048913 | Unclassified | 860 |
| 571 | Ga0496111_0009210 | 3300048914 | Bacteria | 6577 |
| 572 | Ga0496111_0082370 | 3300048914 | Bacteria | 2350 |
| 573 | Ga0496111_0142642 | 3300048914 | Bacteria | 1775 |
| 574 | Ga0496111_0149729 | 3300048914 | Bacteria | 1731 |
| 575 | Ga0496111_0313901 | 3300048914 | Unclassified | 1161 |
| 576 | Ga0496111_0483328 | 3300048914 | Unclassified | 912 |
| 577 | Ga0496112_0005722 | 3300048915 | Bacteria | 10802 |
| 578 | Ga0496112_0062875 | 3300048915 | Bacteria | 3662 |
| 579 | Ga0496112_0097441 | 3300048915 | Bacteria | 2911 |
| 580 | Ga0496112_0125741 | 3300048915 | Bacteria | 2535 |
| 581 | Ga0496112_0326662 | 3300048915 | Bacteria | 1478 |
| 582 | Ga0496112_1338538 | 3300048915 | Unclassified | 631 |
| 583 | Ga0496113_0008044 | 3300048916 | Bacteria | 6843 |
| 584 | Ga0496113_0017965 | 3300048916 | Bacteria | 4918 |
| 585 | Ga0496114_0000875 | 3300048917 | Bacteria | 22544 |
| 586 | Ga0496114_0007774 | 3300048917 | Bacteria | 8484 |
| 587 | Ga0496114_0463948 | 3300048917 | Bacteria | 1121 |
| 588 | Ga0496114_0615762 | 3300048917 | Bacteria | 957 |
| 589 | Ga0496114_0681673 | 3300048917 | Bacteria | 902 |
| 590 | Ga0496114_0702328 | 3300048917 | Bacteria | 887 |
| 591 | Ga0496114_0705004 | 3300048917 | Bacteria | 885 |
| 592 | Ga0496114_0772444 | 3300048917 | Unclassified | 839 |
| 593 | Ga0496114_0975895 | 3300048917 | Bacteria | 730 |
| 594 | Ga0496114_1207107 | 3300048917 | Bacteria | 642 |
| 595 | Ga0496115_0019634 | 3300048918 | Bacteria | 5203 |
| 596 | Ga0496115_0023125 | 3300048918 | Bacteria | 4822 |
| 597 | Ga0496115_0066764 | 3300048918 | Bacteria | 2907 |
| 598 | Ga0496115_0102591 | 3300048918 | Bacteria | 2346 |
| 599 | Ga0496115_0309045 | 3300048918 | Bacteria | 1294 |
| 600 | Ga0496115_0551809 | 3300048918 | Bacteria | 921 |
| 601 | Ga0501067_0007599 | 3300049583 | Bacteria | 6027 |
| 602 | Ga0501067_0025086 | 3300049583 | Bacteria | 3306 |
| 603 | Ga0501067_0095795 | 3300049583 | Bacteria | 1648 |
| 604 | Ga0501067_0256384 | 3300049583 | Bacteria | 974 |
| 605 | Ga0501068_0457886 | 3300049584 | Unclassified | 826 |
| 606 | Ga0501068_0692987 | 3300049584 | Bacteria | 666 |
| 607 | Ga0501069_0001599 | 3300049585 | Bacteria | 11206 |
| 608 | Ga0501069_0212813 | 3300049585 | Bacteria | 1122 |
| 609 | Ga0501069_0584370 | 3300049585 | Unclassified | 670 |
| 610 | Ga0501070_0014768 | 3300049586 | Bacteria | 6570 |
| 611 | Ga0501070_0561296 | 3300049586 | Bacteria | 913 |
| 612 | Ga0501072_0014193 | 3300049588 | Bacteria | 6104 |
| 613 | Ga0501073_0044833 | 3300049589 | Bacteria | 3117 |
| 614 | Ga0501074_0258539 | 3300049590 | Bacteria | 1238 |
| 615 | Ga0501081_0879084 | 3300049743 | Bacteria | 675 |
| 616 | Ga0501083_0027565 | 3300049744 | Bacteria | 3919 |
| 617 | Ga0501044_0683556 | 3300049823 | Bacteria | 913 |
| 618 | nmdc:mga0rr50_142411_c1 | 3300050513 | Unclassified | 1930 |
| 619 | nmdc:mga0a205_346328_c1 | 3300050515 | Unclassified | 1354 |
| 620 | Ga0495601_0000835 | 3300053077 | Bacteria | 16726 |
| 621 | Ga0495601_0050995 | 3300053077 | Bacteria | 2611 |
| 622 | Ga0495601_0242593 | 3300053077 | Bacteria | 1176 |
| 623 | Ga0495601_0361963 | 3300053077 | Bacteria | 942 |
| 624 | Ga0495601_1056643 | 3300053077 | Eukaryota | 509 |
| 625 | Ga0495612_0012105 | 3300053078 | Bacteria | 3475 |
| 626 | Ga0495612_0062944 | 3300053078 | Bacteria | 1538 |
| 627 | Ga0495612_0204107 | 3300053078 | Bacteria | 872 |
| 628 | Ga0495595_0004398 | 3300053084 | Bacteria | 5670 |
| 629 | Ga0495595_0021928 | 3300053084 | Bacteria | 2797 |
| 630 | Ga0495595_0027727 | 3300053084 | Bacteria | 2525 |
| 631 | Ga0495595_0041421 | 3300053084 | Bacteria | 2107 |
| 632 | Ga0495595_0068793 | 3300053084 | Unclassified | 1670 |
| 633 | Ga0495595_0195150 | 3300053084 | Bacteria | 1007 |
| 634 | Ga0495619_0002607 | 3300053085 | Bacteria | 11776 |
| 635 | Ga0495619_0009681 | 3300053085 | Bacteria | 6077 |
| 636 | Ga0495619_0039336 | 3300053085 | Bacteria | 3087 |
| 637 | Ga0495619_0045185 | 3300053085 | Bacteria | 2894 |
| 638 | Ga0495619_0080046 | 3300053085 | Unclassified | 2198 |
| 639 | Ga0501082_0936998 | 3300060353 | Bacteria | 757 |
| 640 | Ga0466962_0001475 | 3300061719 | Bacteria | 10974 |
| 641 | Ga0466962_0025014 | 3300061719 | Bacteria | 2866 |
| 642 | Ga0466962_0092516 | 3300061719 | Unclassified | 1449 |
| 643 | Ga0466962_0105104 | 3300061719 | Bacteria | 1357 |
| 644 | Ga0466962_0152615 | 3300061719 | Bacteria | 1121 |
| 645 | Ga0530510_0164247 | 3300061734 | Bacteria | 1643 |
| 646 | Ga0530510_0312677 | 3300061734 | Bacteria | 1177 |
| 647 | Ga0466967_0368965 | |||
| 648 | Ga0070658_10010792 | |||
| 649 | Ga0070658_11462830 | |||
| 650 | Ga0070683_100621774 | |||
| 651 | Ga0070680_100040670 | |||
| 652 | Ga0070680_100046353 | |||
| 653 | Ga0070682_100527030 | |||
| 654 | Ga0070682_100740606 | |||
| 655 | Ga0068868_100242095 | |||
| 656 | Ga0068868_101308987 | |||
| 657 | Ga0070660_100007655 | |||
| 658 | Ga0070660_100500912 | |||
| 659 | Ga0070660_101149054 | |||
| 660 | Ga0070661_100043921 | |||
| 661 | Ga0070671_100570143 | |||
| 662 | Ga0070673_100351547 | |||
| 663 | Ga0070659_100604427 | |||
| 664 | Ga0070709_10002809 | |||
| 665 | Ga0070709_10021675 | |||
| 666 | Ga0070714_100003527 | |||
| 667 | Ga0070714_100026013 | |||
| 668 | Ga0070714_100027041 | |||
| 669 | Ga0070714_100235911 | |||
| 670 | Ga0070714_100540629 | |||
| 671 | Ga0070713_100022499 | |||
| 672 | Ga0070710_10000749 | |||
| 673 | Ga0070710_10002519 | |||
| 674 | Ga0070710_10296504 | |||
| 675 | Ga0070711_100015426 | |||
| 676 | Ga0070711_100501666 | |||
| 677 | Ga0070711_100846721 | |||
| 678 | Ga0070711_101005305 | |||
| 679 | Ga0070694_100228364 | |||
| 680 | Ga0070708_100905546 | |||
| 681 | Ga0070678_100096159 | |||
| 682 | Ga0070678_101482130 | |||
| 683 | Ga0070681_10005602 | |||
| 684 | Ga0070681_10013001 | |||
| 685 | Ga0070681_10027893 | |||
| 686 | Ga0070681_10292520 | |||
| 687 | Ga0070707_100001390 | |||
| 688 | Ga0070707_100139653 | |||
| 689 | Ga0070707_100953595 | |||
| 690 | Ga0070698_100150898 | |||
| 691 | Ga0070698_100182157 | |||
| 692 | Ga0070679_100060794 | |||
| 693 | Ga0070679_101264111 | |||
| 694 | Ga0070684_100077152 | |||
| 695 | Ga0070684_100155912 | |||
| 696 | Ga0070695_100000473 | |||
| 697 | Ga0070693_100714756 | |||
| 698 | Ga0070693_101145834 | |||
| 699 | Ga0070665_100283047 | |||
| 700 | Ga0068855_100022931 | |||
| 701 | Ga0070664_100260950 | |||
| 702 | Ga0068857_100166888 | |||
| 703 | Ga0068856_100096345 | |||
| 704 | Ga0068856_100195704 | |||
| 705 | Ga0068852_100608306 | |||
| 706 | Ga0068852_101342701 | |||
| 707 | Ga0068864_100552499 | |||
| 708 | Ga0068851_10810561 | |||
| 709 | Ga0070717_10016747 | |||
| 710 | Ga0070717_10020833 | |||
| 711 | Ga0070717_10031394 | |||
| 712 | Ga0070717_10226620 | |||
| 713 | Ga0070717_10241230 | |||
| 714 | Ga0070715_10000369 | |||
| 715 | Ga0070716_100124654 | |||
| 716 | Ga0070716_100340645 | |||
| 717 | Ga0070716_100743209 | |||
| 718 | Ga0070712_100207737 | |||
| 719 | Ga0070712_100264256 | |||
| 720 | Ga0070712_100269470 | |||
| 721 | Ga0070712_100362639 | |||
| 722 | Ga0070712_100528878 | |||
| 723 | Ga0070712_100691835 | |||
| 724 | Ga0097621_100583478 | |||
| 725 | Ga0097621_101339999 | |||
| 726 | Ga0075434_100006835 | |||
| 727 | Ga0105240_10011632 | |||
| 728 | Ga0105240_10027704 | |||
| 729 | Ga0105240_10516112 | |||
| 730 | Ga0105240_10819401 | |||
| 731 | Ga0105240_11179439 | |||
| 732 | Ga0105240_11443848 | |||
| 733 | Ga0105245_10119429 | |||
| 734 | Ga0105245_10228952 | |||
| 735 | Ga0105243_11063990 | |||
| 736 | Ga0105241_10445454 | |||
| 737 | Ga0105242_11409202 | |||
| 738 | Ga0105248_10200743 | |||
| 739 | Ga0105237_10029761 | |||
| 740 | Ga0105237_10453124 | |||
| 741 | Ga0105238_10306688 | |||
| 742 | Ga0105239_10883248 | |||
| 743 | Ga0105246_11445977 | |||
| 744 | Ga0157373_10365462 | |||
| 745 | Ga0157370_10550578 | |||
| 746 | Ga0157369_10004734 | |||
| 747 | Ga0157369_10130297 | |||
| 748 | Ga0157369_10229327 | |||
| 749 | Ga0157374_10301814 | |||
| 750 | Ga0157374_10596283 | |||
| 751 | Ga0163162_10226085 | |||
| 752 | Ga0157372_10004242 | |||
| 753 | Ga0157372_10225797 | |||
| 754 | Ga0157372_10361214 | |||
| 755 | Ga0157372_10405691 | |||
| 756 | Ga0157372_10988490 | |||
| 757 | Ga0157372_11785698 | |||
| 758 | Ga0157372_12031286 | |||
| 759 | Ga0157375_10177433 | |||
| 760 | Ga0157375_10685994 | |||
| 761 | Ga0182008_10024912 | |||
| 762 | Ga0157379_10235851 | |||
| 763 | Ga0157376_11196925 | |||
| 764 | Ga0206354_11065840 | |||
| 765 | Ga0213876_10056142 | |||
| 766 | Ga0207692_10001782 | |||
| 767 | Ga0207692_10179558 | |||
| 768 | Ga0207685_10003611 | |||
| 769 | Ga0207699_10018389 | |||
| 770 | Ga0207699_10126165 | |||
| 771 | Ga0207699_10209427 | |||
| 772 | Ga0207705_10085996 | |||
| 773 | Ga0207684_11014337 | |||
| 774 | Ga0207707_10004043 | |||
| 775 | Ga0207707_10210769 | |||
| 776 | Ga0207707_10691530 | |||
| 777 | Ga0207695_10024390 | |||
| 778 | Ga0207695_10047381 | |||
| 779 | Ga0207695_10984014 | |||
| 780 | Ga0207671_10068882 | |||
| 781 | Ga0207693_10002770 | |||
| 782 | Ga0207693_10004412 | |||
| 783 | Ga0207693_10355148 | |||
| 784 | Ga0207693_10378299 | |||
| 785 | Ga0207663_10004334 | |||
| 786 | Ga0207663_10490961 | |||
| 787 | Ga0207660_10054335 | |||
| 788 | Ga0207660_10055534 | |||
| 789 | Ga0207657_10001500 | |||
| 790 | Ga0207657_10010053 | |||
| 791 | Ga0207657_10755778 | |||
| 792 | Ga0207649_10017821 | |||
| 793 | Ga0207652_10567570 | |||
| 794 | Ga0207652_10609306 | |||
| 795 | Ga0207652_10660008 | |||
| 796 | Ga0207646_10001697 | |||
| 797 | Ga0207646_10040548 | |||
| 798 | Ga0207646_10075781 | |||
| 799 | Ga0207687_10017580 | |||
| 800 | Ga0207700_10071824 | |||
| 801 | Ga0207700_10106422 | |||
| 802 | Ga0207664_10012781 | |||
| 803 | Ga0207664_10290404 | |||
| 804 | Ga0207664_10880969 | |||
| 805 | Ga0207690_10022448 | |||
| 806 | Ga0207690_10059954 | |||
| 807 | Ga0207665_10000146 | |||
| 808 | Ga0207665_10043483 | |||
| 809 | Ga0207711_10899620 | |||
| 810 | Ga0207679_10104563 | |||
| 811 | Ga0207667_10241312 | |||
| 812 | Ga0207676_12446131 | |||
| 813 | Ga0207674_10107983 | |||
| 814 | Ga0207683_10130165 | |||
| 815 | Ga0207698_11010647 | |||
| 816 | Ga0268266_10285071 | |||
| 817 | Ga0265319_1006131 | |||
| 818 | Ga0265334_10019826 | |||
| 819 | Ga0265334_10097869 | |||
| 820 | Ga0265318_10004401 | |||
| 821 | Ga0265322_10039745 | |||
| 822 | Ga0265338_10009445 | |||
| 823 | Ga0265338_10013850 | |||
| 824 | Ga0265338_10018792 | |||
| 825 | Ga0265324_10091903 | |||
| 826 | Ga0265330_10111714 | |||
| 827 | Ga0265328_10188401 | |||
| 828 | Ga0265320_10019895 | |||
| 829 | Ga0265325_10058827 | |||
| 830 | Ga0265325_10193483 | |||
| 831 | Ga0265329_10038063 | |||
| 832 | Ga0265340_10088836 | |||
| 833 | Ga0265340_10290232 | |||
| 834 | Ga0265339_10022293 | |||
| 835 | Ga0265327_10023129 | |||
| 836 | Ga0265327_10029058 | |||
| 837 | Ga0265316_10010379 | |||
| 838 | Ga0265316_10330505 | |||
| 839 | Ga0265316_10713449 | |||
| 840 | Ga0265313_10204858 | |||
| 841 | Ga0265314_10001460 | |||
| 842 | Ga0265314_10029908 | |||
| 843 | Ga0265314_10216087 | |||
| 844 | Ga0265342_10041735 | |||
| 845 | Ga0307416_101851102 | |||
| 846 | Ga0316583_10034677 | |||
| 847 | Ga0373948_0131999 | |||
| 848 | Ga0373926_0012718 | |||
| 849 | Ga0373940_0092819 | |||
| 850 | Ga0373944_0026941 | |||
| 851 | Ga0373932_0166690 | |||
| 852 | Ga0373941_0045479 | |||
| 853 | Ga0373945_0079410 | |||
| 854 | Ga0373956_0134985 | |||
| 855 | Ga0373957_0085734 | |||
| 856 | Ga0373960_0258476 | |||
| 857 | Ga0373943_0018287 | |||
| 858 | Ga0373955_0217121 | |||
| 859 | Ga0373955_0670837 | |||
| 860 | Ga0373962_0097454 | |||
| 861 | Ga0373924_0055148 | |||
| 862 | Ga0373931_0029535 | |||
| 863 | Ga0373931_0378918 | |||
| 864 | Ga0373947_0002722 | |||
| 865 | Ga0373947_0274771 | |||
| 866 | Ga0373937_0000749 | |||
| 867 | Ga0373937_0351253 | |||
| 868 | Ga0373925_0007119 | |||
| 869 | Ga0395899_0047075 | |||
| 870 | Ga0395900_0199123 | |||
| 871 | Ga0395900_0205582 | |||
| 872 | Ga0395898_0319921 | |||
| 873 | Ga0395898_0552384 | |||
| 874 | Ga0395898_0936586 | |||
| 875 | Ga0395898_1916853 | |||
| 876 | Ga0395905_1324808 | |||
| 877 | Ga0395901_0011415 | |||
| 878 | Ga0395901_0220929 | |||
| 879 | Ga0395901_0551556 | |||
| 880 | Ga0436365_0848685 | |||
| 881 | Ga0436365_1808150 | |||
| 882 | Ga0436360_0428150 | |||
| 883 | Ga0451853_3506410 | |||
| 884 | Ga0451577_1012021 | |||
| 885 | Ga0466969_0001166 | |||
| 886 | Ga0466969_0002173 | |||
| 887 | Ga0466969_0081655 | |||
| 888 | Ga0466965_0058960 | |||
| 889 | Ga0466966_0040292 | |||
| 890 | Ga0466966_0057697 | |||
| 891 | Ga0466966_0114390 | |||
| 892 | Ga0466966_0121000 | |||
| 893 | Ga0466966_0379131 | |||
| 894 | Ga0466961_0005135 | |||
| 895 | Ga0466961_0039587 | |||
| 896 | Ga0466961_0051174 | |||
| 897 | Ga0466961_0051918 | |||
| 898 | Ga0466961_0054026 | |||
| 899 | Ga0466961_0055944 | |||
| 900 | Ga0466963_0000509 | |||
| 901 | Ga0466963_0000833 | |||
| 902 | Ga0466963_0002118 | |||
| 903 | Ga0466963_0002832 | |||
| 904 | Ga0466963_0002984 | |||
| 905 | Ga0466963_0004243 | |||
| 906 | Ga0466963_0004416 | |||
| 907 | Ga0466963_0005742 | |||
| 908 | Ga0466963_0009139 | |||
| 909 | Ga0466963_0015231 | |||
| 910 | Ga0466963_0027849 | |||
| 911 | Ga0466963_0037108 | |||
| 912 | Ga0466963_0046236 | |||
| 913 | Ga0466963_0080480 | |||
| 914 | Ga0466963_0095784 | |||
| 915 | Ga0466963_0282084 | |||
| 916 | Ga0466963_0285202 | |||
| 917 | Ga0466963_0568837 | |||
| 918 | Ga0466963_0612421 | |||
| 919 | Ga0466963_0761547 | |||
| 920 | Ga0466963_0855906 | |||
| 921 | Ga0466964_0005037 | |||
| 922 | Ga0466964_0013415 | |||
| 923 | Ga0466964_0090640 | |||
| 924 | Ga0466964_0125052 | |||
| 925 | Ga0466964_0180814 | |||
| 926 | Ga0466964_0257254 | |||
| 927 | Ga0466964_0269751 | |||
| 928 | Ga0466964_0333659 | |||
| 929 | Ga0466964_0476193 | |||
| 930 | Ga0466971_0003402 | |||
| 931 | Ga0466971_0005931 | |||
| 932 | Ga0466971_0016840 | |||
| 933 | Ga0466971_0033390 | |||
| 934 | Ga0466971_0237154 | |||
| 935 | Ga0466971_0359721 | |||
| 936 | Ga0466968_0002701 | |||
| 937 | Ga0466968_0005662 | |||
| 938 | Ga0466968_0005954 | |||
| 939 | Ga0466968_0006897 | |||
| 940 | Ga0466968_0020355 | |||
| 941 | Ga0466968_0024246 | |||
| 942 | Ga0466968_0054237 | |||
| 943 | Ga0466968_0079840 | |||
| 944 | Ga0466968_0254149 | |||
| 945 | Ga0466968_0293534 | |||
| 946 | Ga0466970_0069984 | |||
| 947 | Ga0466970_0147147 | |||
| 948 | Ga0466957_0000407 | |||
| 949 | Ga0466957_0005648 | |||
| 950 | Ga0466957_0016683 | |||
| 951 | Ga0466957_0024708 | |||
| 952 | Ga0466957_0040250 | |||
| 953 | Ga0466957_0115259 | |||
| 954 | Ga0466957_0257609 | |||
| 955 | Ga0466957_0293240 | |||
| 956 | Ga0466957_0802676 | |||
| 957 | Ga0466957_0803385 | |||
| 958 | Ga0466957_0864004 | |||
| 959 | Ga0466957_0958499 | |||
| 960 | Ga0466960_0026470 | |||
| 961 | Ga0466959_0000954 | |||
| 962 | Ga0466959_0004817 | |||
| 963 | Ga0466959_0006328 | |||
| 964 | Ga0466959_0015121 | |||
| 965 | Ga0466959_0051781 | |||
| 966 | Ga0466959_0086580 | |||
| 967 | Ga0466958_0003774 | |||
| 968 | Ga0466958_0008219 | |||
| 969 | Ga0466958_0008400 | |||
| 970 | Ga0466958_0012994 | |||
| 971 | Ga0466958_0035555 | |||
| 972 | Ga0466958_0071491 | |||
| 973 | Ga0466958_0119172 | |||
| 974 | Ga0466958_0136517 | |||
| 975 | Ga0466958_0156310 | |||
| 976 | Ga0466958_0370136 | |||
| 977 | Ga0466958_0579048 | |||
| 978 | Ga0466958_0625239 | |||
| 979 | Ga0466958_0963122 | |||
| 980 | Ga0466967_0001619 | |||
| 981 | Ga0466967_0004820 | |||
| 982 | Ga0466967_0007894 | |||
| 983 | Ga0466967_0010328 | |||
| 984 | Ga0466967_0021064 | |||
| 985 | Ga0466967_0022778 | |||
| 986 | Ga0466967_0023068 | |||
| 987 | Ga0466967_0028152 | |||
| 988 | Ga0466967_0036162 | |||
| 989 | Ga0466967_0053333 | |||
| 990 | Ga0466967_0059527 | |||
| 991 | Ga0466967_0103009 | |||
| 992 | Ga0466967_0149795 | |||
| 993 | Ga0466967_0195285 | |||
| 994 | Ga0466967_0228828 | |||
| 995 | Ga0466967_0271755 | |||
| 996 | Ga0466967_0351261 | |||
| 997 | Ga0466967_0424398 | |||
| 998 | Ga0466967_0544121 | |||
| 999 | Ga0466967_0559376 | |||
| 1000 | Ga0466967_0604757 | |||
| 1001 | Ga0466967_0628987 | |||
| 1002 | Ga0466967_0774314 | |||
| 1003 | Ga0466967_0902901 | |||
| 1004 | Ga0466967_1355715 | |||
| 1005 | Ga0466967_1588381 | |||
| 1006 | Ga0466967_1845165 | |||
| 1007 | Ga0495592_0000728 | |||
| 1008 | Ga0495592_0011664 | |||
| 1009 | Ga0495629_0013827 | |||
| 1010 | Ga0495629_0016809 | |||
| 1011 | Ga0495629_0039564 | |||
| 1012 | Ga0495629_0110757 | |||
| 1013 | Ga0495629_0251632 | |||
| 1014 | Ga0495629_0522899 | |||
| 1015 | Ga0495641_0002937 | |||
| 1016 | Ga0495641_0036618 | |||
| 1017 | Ga0495641_0045030 | |||
| 1018 | Ga0495651_0000699 | |||
| 1019 | Ga0495651_0024964 | |||
| 1020 | Ga0495651_0125131 | |||
| 1021 | Ga0495651_0170386 | |||
| 1022 | Ga0495651_0248183 | |||
| 1023 | Ga0495653_0003907 | |||
| 1024 | Ga0495653_0014734 | |||
| 1025 | Ga0495653_0051570 | |||
| 1026 | Ga0495653_0139285 | |||
| 1027 | Ga0495653_0583347 | |||
| 1028 | Ga0495582_0005208 | |||
| 1029 | Ga0495582_0025283 | |||
| 1030 | Ga0495582_0046358 | |||
| 1031 | Ga0495582_0846575 | |||
| 1032 | Ga0495639_0000884 | |||
| 1033 | Ga0495639_0380741 | |||
| 1034 | Ga0495662_0001154 | |||
| 1035 | Ga0495662_0193351 | |||
| 1036 | Ga0495664_0159689 | |||
| 1037 | Ga0495664_0170848 | |||
| 1038 | Ga0495584_0005558 | |||
| 1039 | Ga0495585_0020222 | |||
| 1040 | Ga0495596_0014063 | |||
| 1041 | Ga0495608_0004527 | |||
| 1042 | Ga0495608_0015640 | |||
| 1043 | Ga0495608_0072399 | |||
| 1044 | Ga0495618_0000821 | |||
| 1045 | Ga0495618_0050610 | |||
| 1046 | Ga0495628_0001050 | |||
| 1047 | Ga0495628_0074234 | |||
| 1048 | Ga0495628_0404425 | |||
| 1049 | Ga0495628_0520633 | |||
| 1050 | Ga0495630_0040017 | |||
| 1051 | Ga0495630_0336001 | |||
| 1052 | Ga0495630_0539890 | |||
| 1053 | Ga0495631_0070944 | |||
| 1054 | Ga0495637_0027071 | |||
| 1055 | Ga0495666_0000805 | |||
| 1056 | Ga0495642_0180216 | |||
| 1057 | Ga0495652_0000187 | |||
| 1058 | Ga0495652_0042347 | |||
| 1059 | Ga0495652_0130689 | |||
| 1060 | Ga0495652_0275758 | |||
| 1061 | Ga0495652_0478708 | |||
| 1062 | Ga0495665_0000405 | |||
| 1063 | Ga0495640_0006118 | |||
| 1064 | Ga0495640_0018909 | |||
| 1065 | Ga0495640_0202416 | |||
| 1066 | Ga0495586_0003587 | |||
| 1067 | Ga0495587_0000467 | |||
| 1068 | Ga0495587_0015392 | |||
| 1069 | Ga0495609_0036221 | |||
| 1070 | Ga0495645_0000700 | |||
| 1071 | Ga0495645_0013038 | |||
| 1072 | Ga0495645_0115627 | |||
| 1073 | Ga0495667_0010779 | |||
| 1074 | Ga0495667_0160902 | |||
| 1075 | Ga0495667_0274785 | |||
| 1076 | Ga0495667_0381937 | |||
| 1077 | Ga0495667_0655136 | |||
| 1078 | Ga0495656_0001006 | |||
| 1079 | Ga0495668_0221167 | |||
| 1080 | Ga0495634_0073090 | |||
| 1081 | Ga0495634_0420032 | |||
| 1082 | Ga0495611_0041905 | |||
| 1083 | Ga0495635_0005454 | |||
| 1084 | Ga0495635_0033547 | |||
| 1085 | Ga0495635_0112384 | |||
| 1086 | Ga0495635_0271971 | |||
| 1087 | Ga0495588_0337906 | |||
| 1088 | Ga0495588_0779256 | |||
| 1089 | Ga0495657_0014943 | |||
| 1090 | Ga0495657_0022627 | |||
| 1091 | Ga0495657_0032144 | |||
| 1092 | Ga0495657_0055767 | |||
| 1093 | Ga0495657_0274697 | |||
| 1094 | Ga0495657_0753514 | |||
| 1095 | Ga0495599_0000333 | |||
| 1096 | Ga0495599_0033347 | |||
| 1097 | Ga0495599_0155036 | |||
| 1098 | Ga0495623_0000045 | |||
| 1099 | Ga0495623_0010123 | |||
| 1100 | Ga0495623_0279077 | |||
| 1101 | Ga0495623_0543639 | |||
| 1102 | Ga0495646_0008728 | |||
| 1103 | Ga0495646_0033184 | |||
| 1104 | Ga0495646_0063747 | |||
| 1105 | Ga0495647_0000812 | |||
| 1106 | Ga0495658_0002164 | |||
| 1107 | Ga0495658_0165164 | |||
| 1108 | Ga0495658_0176239 | |||
| 1109 | Ga0495669_0415680 | |||
| 1110 | Ga0495613_0025203 | |||
| 1111 | Ga0495613_0029705 | |||
| 1112 | Ga0495613_0030536 | |||
| 1113 | Ga0495624_0002634 | |||
| 1114 | Ga0495624_0167610 | |||
| 1115 | Ga0495624_0177425 | |||
| 1116 | Ga0495624_0377228 | |||
| 1117 | Ga0495670_0065972 | |||
| 1118 | Ga0495600_0021442 | |||
| 1119 | Ga0495600_0051441 | |||
| 1120 | Ga0495600_0099232 | |||
| 1121 | Ga0495600_0146196 | |||
| 1122 | Ga0495600_0354541 | |||
| 1123 | Ga0495600_0443787 | |||
| 1124 | Ga0495581_0012244 | |||
| 1125 | Ga0495581_0507730 | |||
| 1126 | Ga0495604_0000221 | |||
| 1127 | Ga0495604_0067777 | |||
| 1128 | Ga0495604_0822937 | |||
| 1129 | Ga0495674_0041238 | |||
| 1130 | Ga0495674_0106129 | |||
| 1131 | Ga0495674_0158000 | |||
| 1132 | Ga0495674_0626719 | |||
| 1133 | Ga0495674_0707849 | |||
| 1134 | Ga0495676_0012064 | |||
| 1135 | Ga0495676_0136905 | |||
| 1136 | Ga0495676_0502913 | |||
| 1137 | Ga0495676_0703624 | |||
| 1138 | Ga0495680_0007898 | |||
| 1139 | Ga0495680_0019972 | |||
| 1140 | Ga0495680_0066266 | |||
| 1141 | Ga0495680_0069874 | |||
| 1142 | Ga0495680_0071493 | |||
| 1143 | Ga0495675_0000301 | |||
| 1144 | Ga0495675_0020394 | |||
| 1145 | Ga0495675_0591475 | |||
| 1146 | Ga0495677_0078275 | |||
| 1147 | Ga0495684_0002557 | |||
| 1148 | Ga0495684_0063440 | |||
| 1149 | Ga0495684_0211085 | |||
| 1150 | Ga0495593_0000885 | |||
| 1151 | Ga0495602_0000515 | |||
| 1152 | Ga0495602_0021011 | |||
| 1153 | Ga0495614_0002129 | |||
| 1154 | Ga0495614_0055722 | |||
| 1155 | Ga0495626_0369081 | |||
| 1156 | Ga0496100_0030524 | |||
| 1157 | Ga0496100_0635989 | |||
| 1158 | Ga0496100_0637107 | |||
| 1159 | Ga0496101_0058148 | |||
| 1160 | Ga0496101_0079457 | |||
| 1161 | Ga0496101_0158572 | |||
| 1162 | Ga0496101_0208937 | |||
| 1163 | Ga0496101_0412278 | |||
| 1164 | Ga0496101_0947273 | |||
| 1165 | Ga0496101_1035641 | |||
| 1166 | Ga0496102_0004845 | |||
| 1167 | Ga0496102_0128585 | |||
| 1168 | Ga0496102_1546150 | |||
| 1169 | Ga0496103_0004250 | |||
| 1170 | Ga0496103_0165167 | |||
| 1171 | Ga0496104_0001804 | |||
| 1172 | Ga0496104_0031685 | |||
| 1173 | Ga0496104_0052566 | |||
| 1174 | Ga0496104_0124130 | |||
| 1175 | Ga0496104_0132089 | |||
| 1176 | Ga0496104_0396872 | |||
| 1177 | Ga0496104_0449556 | |||
| 1178 | Ga0496104_0763252 | |||
| 1179 | Ga0496105_0010606 | |||
| 1180 | Ga0496105_0020837 | |||
| 1181 | Ga0496105_0027306 | |||
| 1182 | Ga0496105_0027402 | |||
| 1183 | Ga0496105_0114867 | |||
| 1184 | Ga0496105_0138919 | |||
| 1185 | Ga0496105_0287096 | |||
| 1186 | Ga0496105_0361210 | |||
| 1187 | Ga0496106_0006189 | |||
| 1188 | Ga0496106_0151804 | |||
| 1189 | Ga0496106_0379866 | |||
| 1190 | Ga0496107_0013191 | |||
| 1191 | Ga0496107_0048034 | |||
| 1192 | Ga0496107_0078266 | |||
| 1193 | Ga0496107_0181754 | |||
| 1194 | Ga0496107_0557108 | |||
| 1195 | Ga0496107_0916483 | |||
| 1196 | Ga0496108_0010171 | |||
| 1197 | Ga0496108_0020497 | |||
| 1198 | Ga0496108_0042298 | |||
| 1199 | Ga0496108_0090743 | |||
| 1200 | Ga0496108_0109438 | |||
| 1201 | Ga0496108_0194226 | |||
| 1202 | Ga0496108_0359213 | |||
| 1203 | Ga0496109_0002387 | |||
| 1204 | Ga0496109_0006259 | |||
| 1205 | Ga0496109_0019618 | |||
| 1206 | Ga0496109_0050778 | |||
| 1207 | Ga0496109_0111836 | |||
| 1208 | Ga0496109_0595940 | |||
| 1209 | Ga0496109_1389277 | |||
| 1210 | Ga0496110_0050731 | |||
| 1211 | Ga0496110_0257538 | |||
| 1212 | Ga0496110_0263020 | |||
| 1213 | Ga0496110_0271761 | |||
| 1214 | Ga0496110_0286512 | |||
| 1215 | Ga0496110_0379582 | |||
| 1216 | Ga0496110_0778938 | |||
| 1217 | Ga0496111_0009210 | |||
| 1218 | Ga0496111_0082370 | |||
| 1219 | Ga0496111_0142642 | |||
| 1220 | Ga0496111_0149729 | |||
| 1221 | Ga0496111_0313901 | |||
| 1222 | Ga0496111_0483328 | |||
| 1223 | Ga0496112_0005722 | |||
| 1224 | Ga0496112_0062875 | |||
| 1225 | Ga0496112_0097441 | |||
| 1226 | Ga0496112_0125741 | |||
| 1227 | Ga0496112_0326662 | |||
| 1228 | Ga0496112_1338538 | |||
| 1229 | Ga0496113_0008044 | |||
| 1230 | Ga0496113_0017965 | |||
| 1231 | Ga0496114_0000875 | |||
| 1232 | Ga0496114_0007774 | |||
| 1233 | Ga0496114_0463948 | |||
| 1234 | Ga0496114_0615762 | |||
| 1235 | Ga0496114_0681673 | |||
| 1236 | Ga0496114_0702328 | |||
| 1237 | Ga0496114_0705004 | |||
| 1238 | Ga0496114_0772444 | |||
| 1239 | Ga0496114_0975895 | |||
| 1240 | Ga0496114_1207107 | |||
| 1241 | Ga0496115_0019634 | |||
| 1242 | Ga0496115_0023125 | |||
| 1243 | Ga0496115_0066764 | |||
| 1244 | Ga0496115_0102591 | |||
| 1245 | Ga0496115_0309045 | |||
| 1246 | Ga0496115_0551809 | |||
| 1247 | Ga0501067_0007599 | |||
| 1248 | Ga0501067_0025086 | |||
| 1249 | Ga0501067_0095795 | |||
| 1250 | Ga0501067_0256384 | |||
| 1251 | Ga0501068_0457886 | |||
| 1252 | Ga0501068_0692987 | |||
| 1253 | Ga0501069_0001599 | |||
| 1254 | Ga0501069_0212813 | |||
| 1255 | Ga0501069_0584370 | |||
| 1256 | Ga0501070_0014768 | |||
| 1257 | Ga0501070_0561296 | |||
| 1258 | Ga0501072_0014193 | |||
| 1259 | Ga0501073_0044833 | |||
| 1260 | Ga0501074_0258539 | |||
| 1261 | Ga0501081_0879084 | |||
| 1262 | Ga0501083_0027565 | |||
| 1263 | Ga0501044_0683556 | |||
| 1264 | nmdc:mga0rr50_142411_c1 | |||
| 1265 | nmdc:mga0a205_346328_c1 | |||
| 1266 | Ga0495601_0000835 | |||
| 1267 | Ga0495601_0050995 | |||
| 1268 | Ga0495601_0242593 | |||
| 1269 | Ga0495601_0361963 | |||
| 1270 | Ga0495601_1056643 | |||
| 1271 | Ga0495612_0012105 | |||
| 1272 | Ga0495612_0062944 | |||
| 1273 | Ga0495612_0204107 | |||
| 1274 | Ga0495595_0004398 | |||
| 1275 | Ga0495595_0021928 | |||
| 1276 | Ga0495595_0027727 | |||
| 1277 | Ga0495595_0041421 | |||
| 1278 | Ga0495595_0068793 | |||
| 1279 | Ga0495595_0195150 | |||
| 1280 | Ga0495619_0002607 | |||
| 1281 | Ga0495619_0009681 | |||
| 1282 | Ga0495619_0039336 | |||
| 1283 | Ga0495619_0045185 | |||
| 1284 | Ga0495619_0080046 | |||
| 1285 | Ga0501082_0936998 | |||
| 1286 | Ga0466962_0001475 | |||
| 1287 | Ga0466962_0025014 | |||
| 1288 | Ga0466962_0092516 | |||
| 1289 | Ga0466962_0105104 | |||
| 1290 | Ga0466962_0152615 | |||
| 1291 | Ga0530510_0164247 | |||
| 1292 | Ga0530510_0312677 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nye-assembly3.cif.gz_F | crystal structure of osmc from e. coli | 0.9226 | 3 | 147 |
| 1nye-assembly1.cif.gz_A | crystal structure of osmc from e. coli | 0.9188 | 3 | 148 |
| 1nye-assembly2.cif.gz_D | crystal structure of osmc from e. coli | 0.911 | 3 | 147 |
| 1nye-assembly2.cif.gz_C | crystal structure of osmc from e. coli | 0.9061 | 1 | 148 |
| 1qwi-assembly1.cif.gz_B | crystal structure of e. coli osmc | 0.9049 | 3 | 147 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1nyeE00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9147 | 3 | 147 | 3.30.300.20 |
| af_Q55EI4_11_156_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9029 | 7 | 148 | 3.30.300.20 |
| af_Q55E30_8_160_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8923 | 5 | 147 | 3.30.300.20 |
| 1ukkB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8872 | 4 | 148 | 3.30.300.20 |
| 1ukkB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8813 | 4 | 148 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A177R797-F1-model_v4 | deleted | 0.9669 | 46 | 148 |
|
| AF-W7TE60-F1-model_v4 | Osmotically inducible protein OsmC | 0.9631 | 46 | 148 |
GO:0004601
GO:0006979 |
| AF-A0A7W1N6Z2-F1-model_v4 | OsmC family peroxiredoxin | 0.9627 | 38 | 146 |
GO:0004601
GO:0006979 |
| AF-A0A7M2YZU4-F1-model_v4 | Peroxiredoxin, OsmC subfamily | 0.9575 | 1 | 148 |
GO:0004601
GO:0006979 |
| AF-A0A7W1N6Z2-F1-model_v4 | OsmC family peroxiredoxin | 0.9542 | 38 | 146 |
GO:0004601
GO:0006979 |