F472202

General Info

Members Datasets Scaffolds Average Seq Length
646 282 1292 331

Family's Representative Sequence

Representative Sequence 3300025916|Ga0207663_10041753|Ga0207663_100417533
Length 362
Sequence MDMDRDISRRHMLALSAAAGGLAFDGGISRAFAQASTRIEQLAPELDKIIATSEPIKELATGFGGPLGPAEGPLWWKEGGFLLFTDIHNSRRMKHVPGQAPTVDLEPSNRANGLTRDQQGRLLSCEHDTRRVTRRELDGSLTVLANSFQGRRLNRPNDVVVKSDGAIYFTDPWSSPAAPEQWDLTFAGVYRLTPDLGTLSLLVDNFVFPNGLAFSPDESVLYVNDTRRGHIRAFDVQPNGTIARQSDRVFADLRGSEPGVPDGMKVDVAGNVYCGGAGGIWILDPQGKKLGRIVHGYPATTNIAFGGDDWKTLYFTSRTHLGSVNVKISGLPVPASTPKIKRLSRARGAGRPWFCVMEDVEC

Samples

Sample ID Description Type Environment
1 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
176 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
177 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
180 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
181 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
182 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
190 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
198 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
208 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
218 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
219 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
220 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
267 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
268 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 4.8
Rhizosphere 94.12
Stem 0
Stem Tuber 0
Unclassified 7.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207663_10041753 3300025916 Bacteria 2798
2 JGI24744J21845_10010887 3300002077 Bacteria 1861
3 Ga0065704_10084618 3300005289 Bacteria 3315
4 Ga0065715_10090937 3300005293 Bacteria 6298
5 Ga0065707_10114686 3300005295 Bacteria 2286
6 Ga0070676_10025438 3300005328 Bacteria 3346
7 Ga0070690_100074321 3300005330 Bacteria 2213
8 Ga0070690_100076518 3300005330 Bacteria 2183
9 Ga0070690_100228938 3300005330 Bacteria 1306
10 Ga0070670_100007261 3300005331 Bacteria 9392
11 Ga0068869_100127460 3300005334 Bacteria 1953
12 Ga0070666_10028070 3300005335 Bacteria 3691
13 Ga0070666_10223571 3300005335 Bacteria 1328
14 Ga0070682_100032889 3300005337 Bacteria 3147
15 Ga0068868_100010987 3300005338 Bacteria 6577
16 Ga0068868_100018035 3300005338 Bacteria 5268
17 Ga0070689_100001704 3300005340 Bacteria 14047
18 Ga0070689_100009786 3300005340 Bacteria 6814
19 Ga0070689_100018002 3300005340 Bacteria 5196
20 Ga0070691_10015393 3300005341 Bacteria 3515
21 Ga0070691_10052678 3300005341 Bacteria 1946
22 Ga0070691_10183766 3300005341 Bacteria 1090
23 Ga0070687_100000718 3300005343 Bacteria 11020
24 Ga0070687_100059819 3300005343 Bacteria 2007
25 Ga0070687_100121356 3300005343 Unclassified 1495
26 Ga0070668_100058017 3300005347 Bacteria 2994
27 Ga0070668_100220865 3300005347 Bacteria 1563
28 Ga0070668_100317911 3300005347 Unclassified 1310
29 Ga0070669_100000469 3300005353 Bacteria 30626
30 Ga0070669_100002359 3300005353 Bacteria 13651
31 Ga0070669_100026388 3300005353 Bacteria 4180
32 Ga0070669_100166021 3300005353 Unclassified 1718
33 Ga0070669_100295088 3300005353 Unclassified 1302
34 Ga0070675_100000434 3300005354 Bacteria 28406
35 Ga0070675_100060366 3300005354 Bacteria 3131
36 Ga0070671_100053169 3300005355 Bacteria 3367
37 Ga0070671_100224887 3300005355 Bacteria 1592
38 Ga0070674_100031920 3300005356 Bacteria 3494
39 Ga0070674_100094967 3300005356 Bacteria 2161
40 Ga0070673_100065451 3300005364 Bacteria 2899
41 Ga0070673_100208207 3300005364 Bacteria 1687
42 Ga0070688_100006960 3300005365 Bacteria 6077
43 Ga0070659_100030626 3300005366 Bacteria 4164
44 Ga0070659_100172741 3300005366 Bacteria 1771
45 Ga0070667_100026982 3300005367 Bacteria 4778
46 Ga0070667_100055138 3300005367 Bacteria 3357
47 Ga0070667_100343247 3300005367 Bacteria 1351
48 Ga0070709_10249941 3300005434 Bacteria 1277
49 Ga0070714_100463900 3300005435 Bacteria 1204
50 Ga0070710_10147800 3300005437 Bacteria 1447
51 Ga0070710_10225292 3300005437 Bacteria 1195
52 Ga0070701_10008060 3300005438 Bacteria 4535
53 Ga0070701_10008191 3300005438 Bacteria 4507
54 Ga0070701_10024029 3300005438 Bacteria 2944
55 Ga0070705_100000087 3300005440 Bacteria 51657
56 Ga0070705_100005897 3300005440 Bacteria 5988
57 Ga0070705_100032990 3300005440 Bacteria 2882
58 Ga0070705_100116184 3300005440 Bacteria 1719
59 Ga0070700_100027233 3300005441 Bacteria 3387
60 Ga0070700_100039904 3300005441 Unclassified 2871
61 Ga0070700_100044034 3300005441 Bacteria 2747
62 Ga0070700_100073340 3300005441 Bacteria 2191
63 Ga0070694_100000103 3300005444 Bacteria 41036
64 Ga0070708_100029369 3300005445 Bacteria 4741
65 Ga0070708_100056261 3300005445 Bacteria 3499
66 Ga0070678_100022073 3300005456 Unclassified 4208
67 Ga0070678_100026346 3300005456 Bacteria 3929
68 Ga0070678_100056611 3300005456 Bacteria 2869
69 Ga0070678_100129966 3300005456 Bacteria 1999
70 Ga0070662_100017443 3300005457 Bacteria 4841
71 Ga0070662_100055998 3300005457 Bacteria 2862
72 Ga0070681_10180219 3300005458 Bacteria 2034
73 Ga0068867_100026065 3300005459 Bacteria 4195
74 Ga0068867_100036438 3300005459 Bacteria 3571
75 Ga0068867_100049666 3300005459 Bacteria 3089
76 Ga0068867_100096726 3300005459 Bacteria 2248
77 Ga0070685_10012676 3300005466 Bacteria 4434
78 Ga0070706_100008793 3300005467 Bacteria 9411
79 Ga0070706_100210070 3300005467 Bacteria 1817
80 Ga0070706_100289092 3300005467 Bacteria 1530
81 Ga0070707_100095323 3300005468 Bacteria 2882
82 Ga0070707_100135893 3300005468 Bacteria 2392
83 Ga0070698_100007256 3300005471 Bacteria 12006
84 Ga0070698_100010997 3300005471 Bacteria 9628
85 Ga0070698_100016189 3300005471 Bacteria 7873
86 Ga0070698_100064007 3300005471 Bacteria 3706
87 Ga0070698_100187345 3300005471 Bacteria 2007
88 Ga0070698_100338879 3300005471 Bacteria 1435
89 Ga0070699_100017207 3300005518 Bacteria 6208
90 Ga0070699_100066060 3300005518 Bacteria 3139
91 Ga0070699_100070734 3300005518 Bacteria 3034
92 Ga0070699_100078241 3300005518 Bacteria 2880
93 Ga0070699_100220891 3300005518 Bacteria 1688
94 Ga0070679_100005004 3300005530 Bacteria 12228
95 Ga0070697_100034887 3300005536 Bacteria 4057
96 Ga0070697_100038196 3300005536 Bacteria 3879
97 Ga0068853_100153637 3300005539 Bacteria 2073
98 Ga0070672_100027999 3300005543 Unclassified 4210
99 Ga0070672_100049009 3300005543 Bacteria 3285
100 Ga0070672_100158415 3300005543 Unclassified 1876
101 Ga0070686_100038434 3300005544 Bacteria 2975
102 Ga0070686_100056065 3300005544 Bacteria 2526
103 Ga0070686_100094247 3300005544 Unclassified 2009
104 Ga0070686_100104822 3300005544 Bacteria 1916
105 Ga0070695_100000116 3300005545 Bacteria 35624
106 Ga0070695_100037549 3300005545 Bacteria 3053
107 Ga0070696_100000345 3300005546 Bacteria 28124
108 Ga0070696_100001426 3300005546 Bacteria 15634
109 Ga0070696_100077579 3300005546 Bacteria 2348
110 Ga0070696_100152962 3300005546 Bacteria 1695
111 Ga0070696_100165745 3300005546 Bacteria 1630
112 Ga0070704_100000258 3300005549 Bacteria 23005
113 Ga0070704_100001068 3300005549 Bacteria 14172
114 Ga0070704_100228098 3300005549 Bacteria 1518
115 Ga0070664_100012100 3300005564 Bacteria 7010
116 Ga0070664_100038150 3300005564 Bacteria 4043
117 Ga0070664_100156300 3300005564 Bacteria 2015
118 Ga0070664_100398216 3300005564 Bacteria 1259
119 Ga0068857_100134986 3300005577 Bacteria 2228
120 Ga0068857_100199001 3300005577 Bacteria 1826
121 Ga0068854_100019198 3300005578 Bacteria 4602
122 Ga0068856_100066336 3300005614 Bacteria 3567
123 Ga0068856_100135015 3300005614 Bacteria 2472
124 Ga0070702_100035194 3300005615 Bacteria 2765
125 Ga0070702_100064569 3300005615 Bacteria 2142
126 Ga0068852_100022763 3300005616 Bacteria 5030
127 Ga0068852_100031308 3300005616 Bacteria 4388
128 Ga0068859_100011783 3300005617 Bacteria 8785
129 Ga0068859_100015539 3300005617 Bacteria 7649
130 Ga0068859_100026138 3300005617 Bacteria 5855
131 Ga0068859_100374142 3300005617 Bacteria 1520
132 Ga0068859_100399206 3300005617 Bacteria 1471
133 Ga0068864_100012076 3300005618 Bacteria 7134
134 Ga0068864_100019652 3300005618 Bacteria 5650
135 Ga0068866_10001364 3300005718 Bacteria 10561
136 Ga0068866_10006714 3300005718 Bacteria 4798
137 Ga0068861_100013268 3300005719 Bacteria 5765
138 Ga0068861_100045060 3300005719 Unclassified 3319
139 Ga0068861_100105419 3300005719 Bacteria 2251
140 Ga0068870_10001492 3300005840 Bacteria 9469
141 Ga0068870_10002270 3300005840 Bacteria 7985
142 Ga0068863_100022288 3300005841 Bacteria 6047
143 Ga0068863_100129613 3300005841 Bacteria 2408
144 Ga0068858_100031820 3300005842 Bacteria 4903
145 Ga0068858_100033662 3300005842 Bacteria 4753
146 Ga0068858_100270418 3300005842 Unclassified 1617
147 Ga0068858_100362929 3300005842 Bacteria 1388
148 Ga0068860_100009000 3300005843 Bacteria 9943
149 Ga0068860_100309814 3300005843 Bacteria 1548
150 Ga0068862_100003067 3300005844 Bacteria 14558
151 Ga0068862_100010563 3300005844 Bacteria 7631
152 Ga0068862_100086031 3300005844 Bacteria 2732
153 Ga0068862_100107394 3300005844 Bacteria 2447
154 Ga0081455_10002744 3300005937 Bacteria 20778
155 Ga0081455_10037892 3300005937 Bacteria 4273
156 Ga0081455_10053278 3300005937 Bacteria 3457
157 Ga0081538_10007260 3300005981 Bacteria 9609
158 Ga0081540_1020328 3300005983 Bacteria 3997
159 Ga0081540_1039895 3300005983 Bacteria 2455
160 Ga0081539_10002992 3300005985 Bacteria 22121
161 Ga0070717_10234405 3300006028 Unclassified 1617
162 Ga0070717_10261406 3300006028 Bacteria 1531
163 Ga0075365_10015095 3300006038 Bacteria 4663
164 Ga0075365_10125402 3300006038 Bacteria 1774
165 Ga0070715_10016945 3300006163 Bacteria 2748
166 Ga0070712_100093398 3300006175 Bacteria 2208
167 Ga0097621_100038830 3300006237 Bacteria 3821
168 Ga0097621_100126965 3300006237 Bacteria 2167
169 Ga0068871_100045834 3300006358 Bacteria 3520
170 Ga0068871_100164460 3300006358 Unclassified 1899
171 Ga0075428_100003941 3300006844 Bacteria 16281
172 Ga0075428_100012537 3300006844 Bacteria 9425
173 Ga0075428_100019135 3300006844 Bacteria 7573
174 Ga0075428_100022546 3300006844 Bacteria 6971
175 Ga0075428_100055848 3300006844 Unclassified 4325
176 Ga0075428_100116314 3300006844 Bacteria 2912
177 Ga0075428_100587768 3300006844 Bacteria 1189
178 Ga0075430_100005600 3300006846 Bacteria 10608
179 Ga0075430_100025145 3300006846 Bacteria 5064
180 Ga0075430_100033906 3300006846 Bacteria 4333
181 Ga0075430_100216057 3300006846 Bacteria 1591
182 Ga0075431_100003251 3300006847 Bacteria 15738
183 Ga0075431_100024649 3300006847 Bacteria 6167
184 Ga0075431_100033460 3300006847 Bacteria 5297
185 Ga0075431_100089831 3300006847 Unclassified 3171
186 Ga0075431_100306920 3300006847 Bacteria 1602
187 Ga0075433_10141827 3300006852 Bacteria 2135
188 Ga0075433_10195813 3300006852 Unclassified 1798
189 Ga0075434_100025353 3300006871 Bacteria 5801
190 Ga0075434_100028284 3300006871 Bacteria 5506
191 Ga0075434_100030564 3300006871 Bacteria 5304
192 Ga0075434_100036935 3300006871 Bacteria 4833
193 Ga0075434_100081750 3300006871 Bacteria 3227
194 Ga0075434_100111120 3300006871 Bacteria 2751
195 Ga0075434_100186365 3300006871 Bacteria 2095
196 Ga0075434_100247518 3300006871 Bacteria 1802
197 Ga0075429_100021504 3300006880 Bacteria 5592
198 Ga0075429_100032031 3300006880 Unclassified 4571
199 Ga0075429_100033185 3300006880 Bacteria 4485
200 Ga0075429_100094962 3300006880 Bacteria 2600
201 Ga0075429_100172125 3300006880 Bacteria 1896
202 Ga0075429_100188452 3300006880 Bacteria 1808
203 Ga0068865_100042664 3300006881 Bacteria 3094
204 Ga0068865_100091590 3300006881 Bacteria 2207
205 Ga0068865_100103353 3300006881 Bacteria 2090
206 Ga0068865_100140984 3300006881 Bacteria 1817
207 Ga0075436_100026418 3300006914 Bacteria 3997
208 Ga0075436_100038527 3300006914 Bacteria 3299
209 Ga0075436_100065981 3300006914 Bacteria 2501
210 Ga0097620_100011784 3300006931 Bacteria 8785
211 Ga0097620_100015539 3300006931 Bacteria 7649
212 Ga0097620_100026139 3300006931 Bacteria 5855
213 Ga0097620_100374173 3300006931 Bacteria 1520
214 Ga0097620_100399255 3300006931 Bacteria 1471
215 Ga0075435_100006662 3300007076 Bacteria 8187
216 Ga0075435_100047135 3300007076 Bacteria 3460
217 Ga0075435_100120009 3300007076 Bacteria 2193
218 Ga0075435_100262247 3300007076 Bacteria 1472
219 Ga0075435_100327901 3300007076 Bacteria 1311
220 Ga0099794_10058785 3300007265 Bacteria 1864
221 Ga0099795_10008135 3300007788 Bacteria 2971
222 Ga0099795_10030147 3300007788 Bacteria 1860
223 Ga0099795_10045526 3300007788 Bacteria 1578
224 Ga0111539_10019604 3300009094 Bacteria 8345
225 Ga0111539_10050388 3300009094 Bacteria 4960
226 Ga0111539_10056661 3300009094 Bacteria 4657
227 Ga0111539_10093502 3300009094 Unclassified 3532
228 Ga0111539_10139950 3300009094 Bacteria 2833
229 Ga0111539_10183035 3300009094 Bacteria 2447
230 Ga0111539_10217425 3300009094 Bacteria 2226
231 Ga0111539_10221593 3300009094 Bacteria 2203
232 Ga0111539_10339503 3300009094 Bacteria 1749
233 Ga0105245_10018123 3300009098 Bacteria 6155
234 Ga0105245_10080262 3300009098 Bacteria 2980
235 Ga0105245_10151106 3300009098 Unclassified 2196
236 Ga0105245_10200661 3300009098 Bacteria 1915
237 Ga0105247_10023915 3300009101 Bacteria 3681
238 Ga0114129_10001361 3300009147 Bacteria 32848
239 Ga0114129_10018128 3300009147 Bacteria 10027
240 Ga0114129_10019617 3300009147 Bacteria 9625
241 Ga0114129_10060178 3300009147 Bacteria 5310
242 Ga0114129_10067683 3300009147 Bacteria 4980
243 Ga0114129_10122311 3300009147 Bacteria 3581
244 Ga0114129_10135468 3300009147 Bacteria 3380
245 Ga0114129_10139289 3300009147 Bacteria 3327
246 Ga0114129_10191650 3300009147 Bacteria 2776
247 Ga0114129_10224516 3300009147 Bacteria 2532
248 Ga0114129_10241867 3300009147 Unclassified 2426
249 Ga0114129_10290199 3300009147 Bacteria 2183
250 Ga0114129_10388666 3300009147 Bacteria 1841
251 Ga0105243_10023838 3300009148 Bacteria 4663
252 Ga0105243_10024807 3300009148 Bacteria 4577
253 Ga0105243_10102615 3300009148 Bacteria 2377
254 Ga0105243_10227202 3300009148 Bacteria 1653
255 Ga0105241_10138980 3300009174 Bacteria 1976
256 Ga0105242_10110989 3300009176 Bacteria 2337
257 Ga0105248_10092868 3300009177 Bacteria 3399
258 Ga0105248_10355764 3300009177 Bacteria 1649
259 Ga0105237_10092746 3300009545 Bacteria 3010
260 Ga0105237_10172535 3300009545 Bacteria 2163
261 Ga0105238_10227084 3300009551 Bacteria 1844
262 Ga0105238_10369122 3300009551 Bacteria 1425
263 Ga0105249_10001202 3300009553 Bacteria 22841
264 Ga0105249_10004703 3300009553 Bacteria 11787
265 Ga0105249_10170610 3300009553 Bacteria 2109
266 Ga0099796_10002201 3300010159 Bacteria 4220
267 Ga0099796_10011742 3300010159 Bacteria 2453
268 Ga0099796_10043251 3300010159 Bacteria 1534
269 Ga0099796_10055653 3300010159 Bacteria 1386
270 Ga0099796_10077165 3300010159 Bacteria 1215
271 Ga0105239_10038686 3300010375 Bacteria 5227
272 Ga0105246_10028785 3300011119 Bacteria 3652
273 Ga0157369_10098667 3300013105 Bacteria 3114
274 Ga0157374_10029861 3300013296 Bacteria 4944
275 Ga0157374_10363650 3300013296 Bacteria 1439
276 Ga0157378_10438577 3300013297 Bacteria 1294
277 Ga0163162_10020430 3300013306 Bacteria 6508
278 Ga0163162_10101481 3300013306 Bacteria 2969
279 Ga0163162_10569104 3300013306 Bacteria 1260
280 Ga0157375_10001976 3300013308 Bacteria 17687
281 Ga0163163_10004470 3300014325 Bacteria 11926
282 Ga0157380_10006570 3300014326 Bacteria 8199
283 Ga0157380_10096133 3300014326 Bacteria 2455
284 Ga0157380_10188662 3300014326 Bacteria 1818
285 Ga0157380_10266130 3300014326 Bacteria 1560
286 Ga0157377_10007373 3300014745 Bacteria 5307
287 Ga0157377_10061890 3300014745 Bacteria 2140
288 Ga0157379_10022371 3300014968 Bacteria 5600
289 Ga0157379_10099663 3300014968 Bacteria 2608
290 Ga0157379_10106831 3300014968 Unclassified 2513
291 Ga0157379_10110816 3300014968 Unclassified 2465
292 Ga0157379_10568639 3300014968 Bacteria 1056
293 Ga0157376_10077244 3300014969 Bacteria 2848
294 Ga0157376_10288578 3300014969 Bacteria 1548
295 Ga0163161_10015548 3300017792 Bacteria 5307
296 Ga0163161_10190127 3300017792 Bacteria 1578
297 Ga0213875_10001582 3300021388 Bacteria 14506
298 Ga0207697_10048086 3300025315 Bacteria 1759
299 Ga0207656_10037715 3300025321 Bacteria 2035
300 Ga0207682_10002879 3300025893 Bacteria 7595
301 Ga0207682_10005626 3300025893 Bacteria 5096
302 Ga0207692_10167411 3300025898 Bacteria 1271
303 Ga0207642_10005418 3300025899 Bacteria 4165
304 Ga0207642_10064879 3300025899 Bacteria 1713
305 Ga0207710_10004935 3300025900 Bacteria 5783
306 Ga0207688_10002345 3300025901 Bacteria 10174
307 Ga0207688_10002434 3300025901 Bacteria 10026
308 Ga0207680_10012006 3300025903 Bacteria 4400
309 Ga0207647_10040649 3300025904 Bacteria 2927
310 Ga0207685_10023712 3300025905 Bacteria 2093
311 Ga0207699_10134983 3300025906 Bacteria 1615
312 Ga0207645_10029000 3300025907 Bacteria 3568
313 Ga0207645_10040266 3300025907 Bacteria 2993
314 Ga0207643_10000341 3300025908 Bacteria 31667
315 Ga0207643_10003085 3300025908 Bacteria 8958
316 Ga0207643_10004633 3300025908 Bacteria 7388
317 Ga0207643_10005100 3300025908 Bacteria 7029
318 Ga0207684_10008665 3300025910 Bacteria 9030
319 Ga0207684_10347328 3300025910 Bacteria 1277
320 Ga0207707_10182128 3300025912 Bacteria 1834
321 Ga0207671_10258899 3300025914 Bacteria 1369
322 Ga0207693_10073454 3300025915 Bacteria 2677
323 Ga0207693_10296200 3300025915 Unclassified 1267
324 Ga0207662_10001094 3300025918 Bacteria 12754
325 Ga0207662_10004667 3300025918 Bacteria 7230
326 Ga0207662_10020459 3300025918 Bacteria 3777
327 Ga0207662_10075092 3300025918 Bacteria 2053
328 Ga0207657_10218748 3300025919 Bacteria 1527
329 Ga0207652_10016988 3300025921 Bacteria 5952
330 Ga0207646_10027373 3300025922 Bacteria 5199
331 Ga0207646_10127334 3300025922 Bacteria 2290
332 Ga0207646_10354785 3300025922 Bacteria 1325
333 Ga0207681_10001204 3300025923 Bacteria 16639
334 Ga0207681_10032113 3300025923 Bacteria 3436
335 Ga0207681_10058569 3300025923 Bacteria 2638
336 Ga0207650_10002383 3300025925 Bacteria 13085
337 Ga0207659_10002109 3300025926 Bacteria 11783
338 Ga0207659_10031905 3300025926 Bacteria 3611
339 Ga0207659_10065914 3300025926 Unclassified 2626
340 Ga0207659_10107253 3300025926 Bacteria 2117
341 Ga0207659_10140661 3300025926 Bacteria 1873
342 Ga0207687_10080121 3300025927 Bacteria 2356
343 Ga0207687_10089707 3300025927 Bacteria 2239
344 Ga0207700_10005412 3300025928 Bacteria 7634
345 Ga0207644_10021453 3300025931 Bacteria 4400
346 Ga0207690_10058525 3300025932 Bacteria 2606
347 Ga0207690_10171218 3300025932 Bacteria 1627
348 Ga0207706_10005044 3300025933 Bacteria 12331
349 Ga0207706_10011190 3300025933 Bacteria 8180
350 Ga0207706_10022917 3300025933 Bacteria 5606
351 Ga0207706_10046766 3300025933 Bacteria 3831
352 Ga0207686_10086692 3300025934 Bacteria 2057
353 Ga0207709_10013423 3300025935 Bacteria 4521
354 Ga0207709_10113969 3300025935 Bacteria 1813
355 Ga0207709_10153934 3300025935 Bacteria 1596
356 Ga0207709_10163769 3300025935 Bacteria 1554
357 Ga0207670_10007980 3300025936 Bacteria 5948
358 Ga0207670_10014789 3300025936 Bacteria 4644
359 Ga0207669_10006349 3300025937 Bacteria 5394
360 Ga0207669_10072395 3300025937 Bacteria 2170
361 Ga0207704_10073950 3300025938 Bacteria 2172
362 Ga0207704_10165625 3300025938 Unclassified 1578
363 Ga0207691_10009770 3300025940 Bacteria 9210
364 Ga0207691_10015222 3300025940 Bacteria 7318
365 Ga0207691_10030380 3300025940 Bacteria 5050
366 Ga0207691_10051304 3300025940 Bacteria 3773
367 Ga0207691_10067745 3300025940 Bacteria 3227
368 Ga0207711_10016189 3300025941 Bacteria 6191
369 Ga0207711_10058034 3300025941 Bacteria 3329
370 Ga0207689_10005583 3300025942 Bacteria 11212
371 Ga0207689_10006278 3300025942 Bacteria 10531
372 Ga0207689_10020478 3300025942 Bacteria 5567
373 Ga0207689_10022097 3300025942 Bacteria 5350
374 Ga0207679_10038181 3300025945 Bacteria 3420
375 Ga0207679_10038741 3300025945 Bacteria 3399
376 Ga0207679_10420400 3300025945 Bacteria 1179
377 Ga0207667_10496258 3300025949 Bacteria 1238
378 Ga0207651_10046953 3300025960 Bacteria 2908
379 Ga0207651_10114994 3300025960 Unclassified 2028
380 Ga0207651_10123633 3300025960 Unclassified 1967
381 Ga0207651_10127999 3300025960 Bacteria 1938
382 Ga0207712_10005964 3300025961 Bacteria 7686
383 Ga0207640_10013680 3300025981 Bacteria 4655
384 Ga0207640_10052222 3300025981 Bacteria 2661
385 Ga0207658_10174379 3300025986 Unclassified 1775
386 Ga0207658_10226455 3300025986 Bacteria 1576
387 Ga0207677_10027565 3300026023 Bacteria 3580
388 Ga0207677_10051826 3300026023 Bacteria 2784
389 Ga0207703_10004950 3300026035 Bacteria 10814
390 Ga0207703_10410095 3300026035 Bacteria 1259
391 Ga0207639_10099218 3300026041 Bacteria 2349
392 Ga0207678_10016966 3300026067 Bacteria 6395
393 Ga0207708_10050774 3300026075 Bacteria 3158
394 Ga0207708_10051802 3300026075 Bacteria 3126
395 Ga0207708_10078430 3300026075 Bacteria 2536
396 Ga0207708_10092855 3300026075 Bacteria 2329
397 Ga0207702_10210741 3300026078 Bacteria 1806
398 Ga0207702_10609978 3300026078 Bacteria 1071
399 Ga0207641_10050831 3300026088 Bacteria 3509
400 Ga0207641_10286418 3300026088 Bacteria 1551
401 Ga0207648_10000663 3300026089 Bacteria 38545
402 Ga0207648_10001784 3300026089 Bacteria 23569
403 Ga0207648_10009558 3300026089 Bacteria 9276
404 Ga0207648_10021060 3300026089 Bacteria 5865
405 Ga0207648_10066676 3300026089 Bacteria 3139
406 Ga0207648_10141128 3300026089 Bacteria 2123
407 Ga0207648_10335986 3300026089 Bacteria 1360
408 Ga0207676_10013360 3300026095 Bacteria 5898
409 Ga0207676_10015619 3300026095 Bacteria 5483
410 Ga0207676_10039411 3300026095 Bacteria 3614
411 Ga0207676_10152385 3300026095 Unclassified 1993
412 Ga0207674_10006149 3300026116 Bacteria 14178
413 Ga0207674_10034624 3300026116 Bacteria 5278
414 Ga0207674_10113370 3300026116 Bacteria 2684
415 Ga0207675_100020423 3300026118 Bacteria 6174
416 Ga0207675_100022660 3300026118 Bacteria 5845
417 Ga0207675_100034931 3300026118 Bacteria 4688
418 Ga0207675_100080797 3300026118 Bacteria 3048
419 Ga0207675_100230443 3300026118 Unclassified 1787
420 Ga0207683_10005913 3300026121 Bacteria 10486
421 Ga0207683_10014274 3300026121 Bacteria 6767
422 Ga0207683_10034515 3300026121 Bacteria 4396
423 Ga0207683_10035549 3300026121 Unclassified 4334
424 Ga0207698_10180656 3300026142 Bacteria 1869
425 Ga0209179_1004445 3300027512 Bacteria 2116
426 Ga0209588_1040542 3300027671 Bacteria 1502
427 Ga0207428_10003778 3300027907 Bacteria 14530
428 Ga0207428_10010627 3300027907 Bacteria 8212
429 Ga0207428_10024437 3300027907 Bacteria 5074
430 Ga0207428_10046796 3300027907 Bacteria 3477
431 Ga0207428_10156215 3300027907 Bacteria 1735
432 Ga0268266_10110610 3300028379 Bacteria 2434
433 Ga0268266_10215374 3300028379 Bacteria 1763
434 Ga0268265_10012272 3300028380 Bacteria 5807
435 Ga0268265_10012872 3300028380 Bacteria 5677
436 Ga0268265_10206722 3300028380 Bacteria 1707
437 Ga0268264_10002080 3300028381 Bacteria 17874
438 Ga0268264_10342928 3300028381 Bacteria 1420
439 Ga0265337_1001171 3300028556 Bacteria 13377
440 Ga0265334_10002338 3300028573 Bacteria 8921
441 Ga0265338_10042611 3300028800 Bacteria 4224
442 Ga0265314_10112167 3300031711 Bacteria 1731
443 Ga0373938_0044857 3300034957 Bacteria 993
444 Ga0373926_0000756 3300035083 Bacteria 9030
445 Ga0373940_0010897 3300035088 Bacteria 2149
446 Ga0373949_0011116 3300035090 Bacteria 1979
447 Ga0373932_0022109 3300035112 Bacteria 1686
448 Ga0373936_0030253 3300035113 Bacteria 2135
449 Ga0373939_0007294 3300035114 Bacteria 2683
450 Ga0373939_0028649 3300035114 Unclassified 1587
451 Ga0373945_0001424 3300035116 Bacteria 7283
452 Ga0373945_0021917 3300035116 Bacteria 2198
453 Ga0373943_0013819 3300035170 Bacteria 3650
454 Ga0373943_0021184 3300035170 Bacteria 3001
455 Ga0373943_0085306 3300035170 Bacteria 1626
456 Ga0373946_0007006 3300035171 Bacteria 4109
457 Ga0373946_0035434 3300035171 Bacteria 2019
458 Ga0373961_0021494 3300035241 Bacteria 1717
459 Ga0373961_0034673 3300035241 Bacteria 1428
460 Ga0373962_0012441 3300035242 Bacteria 2145
461 Ga0373931_0049108 3300035691 Unclassified 2239
462 Ga0373935_0001314 3300035692 Bacteria 13745
463 Ga0373927_0017996 3300035695 Bacteria 4648
464 Ga0373927_0041035 3300035695 Bacteria 3001
465 Ga0373927_0046418 3300035695 Bacteria 2810
466 Ga0373927_0205975 3300035695 Bacteria 1292
467 Ga0373927_0319876 3300035695 Bacteria 1022
468 Ga0373947_0016867 3300035725 Bacteria 4196
469 Ga0373947_0029423 3300035725 Bacteria 3223
470 Ga0373947_0174148 3300035725 Bacteria 1398
471 Ga0373925_0007447 3300037068 Bacteria 7986
472 Ga0373925_0009825 3300037068 Bacteria 6949
473 Ga0373925_0011265 3300037068 Bacteria 6486
474 Ga0373925_0137954 3300037068 Bacteria 1907
475 Ga0373925_0209629 3300037068 Bacteria 1552
476 Ga0436364_0694410 3300037853 Bacteria 38233
477 Ga0439453_0015767 3300041408 Unclassified 1311
478 Ga0439440_0020599 3300042993 Bacteria 1480
479 Ga0451576_0005960 3300045051 Bacteria 15094
480 Ga0451576_0011227 3300045051 Bacteria 10203
481 Ga0451576_0026777 3300045051 Bacteria 6197
482 Ga0495617_069384 3300046452 Bacteria 1160
483 Ga0495603_0004289 3300046455 Bacteria 8499
484 Ga0495603_0020633 3300046455 Bacteria 3992
485 Ga0495629_0102642 3300046459 Bacteria 1995
486 Ga0495580_0007890 3300046472 Bacteria 8515
487 Ga0495580_0019012 3300046472 Bacteria 5109
488 Ga0495582_0039517 3300046473 Bacteria 2597
489 Ga0495582_0098889 3300046473 Bacteria 1633
490 Ga0495639_0011222 3300046475 Bacteria 3860
491 Ga0495662_0054947 3300046476 Bacteria 1924
492 Ga0495662_0068953 3300046476 Bacteria 1713
493 Ga0495584_0025097 3300046491 Bacteria 3021
494 Ga0495584_0158790 3300046491 Bacteria 1149
495 Ga0495585_0075743 3300046492 Bacteria 1829
496 Ga0495585_0118443 3300046492 Bacteria 1403
497 Ga0495594_0202496 3300046499 Bacteria 1131
498 Ga0495630_0137936 3300046517 Bacteria 1854
499 Ga0495630_0241546 3300046517 Bacteria 1380
500 Ga0495666_0088974 3300046526 Bacteria 1458
501 Ga0495665_0014647 3300046531 Bacteria 4227
502 Ga0495640_0050576 3300046533 Bacteria 2862
503 Ga0495640_0124383 3300046533 Bacteria 1673
504 Ga0495586_0023929 3300046535 Bacteria 3261
505 Ga0495586_0150676 3300046535 Bacteria 1308
506 Ga0495598_0026605 3300046537 Bacteria 1588
507 Ga0495609_0070569 3300046538 Unclassified 1536
508 Ga0495621_0035195 3300046539 Bacteria 1733
509 Ga0495634_0067035 3300046642 Bacteria 2375
510 Ga0495659_0001163 3300046664 Bacteria 9135
511 Ga0495647_0006749 3300046681 Bacteria 3821
512 Ga0495647_0013593 3300046681 Bacteria 2823
513 Ga0495647_0033778 3300046681 Bacteria 1913
514 Ga0495658_0011598 3300046683 Bacteria 4439
515 Ga0495658_0043230 3300046683 Bacteria 2519
516 Ga0495658_0178987 3300046683 Bacteria 1315
517 Ga0495669_0080416 3300046684 Bacteria 1495
518 Ga0495613_0171786 3300046689 Bacteria 1538
519 Ga0495624_0016501 3300046690 Bacteria 4972
520 Ga0495670_0052173 3300046691 Bacteria 2047
521 Ga0495671_0091159 3300046692 Bacteria 1492
522 Ga0495581_0086395 3300047315 Bacteria 1819
523 Ga0495581_0157771 3300047315 Bacteria 1326
524 Ga0495604_0272152 3300047317 Bacteria 1147
525 Ga0495674_0095156 3300047319 Bacteria 2540
526 Ga0495676_0016209 3300047321 Bacteria 6619
527 Ga0495677_0079806 3300047445 Bacteria 1226
528 Ga0495593_0075285 3300047673 Bacteria 1750
529 Ga0495614_0090192 3300048089 Bacteria 1333
530 Ga0496100_0020108 3300048903 Bacteria 3997
531 Ga0496102_0028710 3300048905 Bacteria 4971
532 Ga0496102_0393836 3300048905 Unclassified 1303
533 Ga0496103_0034913 3300048906 Bacteria 3076
534 Ga0496103_0075929 3300048906 Bacteria 2108
535 Ga0496104_0024341 3300048907 Bacteria 5569
536 Ga0496104_0043779 3300048907 Bacteria 4204
537 Ga0496104_0156291 3300048907 Bacteria 2188
538 Ga0496104_0222219 3300048907 Bacteria 1801
539 Ga0496104_0422135 3300048907 Bacteria 1246
540 Ga0496105_0011514 3300048908 Bacteria 6991
541 Ga0496105_0092550 3300048908 Bacteria 2496
542 Ga0496106_0015469 3300048909 Bacteria 5647
543 Ga0496106_0030862 3300048909 Bacteria 3995
544 Ga0496106_0204908 3300048909 Bacteria 1570
545 Ga0496106_0298848 3300048909 Bacteria 1291
546 Ga0496107_0007009 3300048910 Bacteria 7766
547 Ga0496108_0057250 3300048911 Bacteria 3275
548 Ga0496108_0060873 3300048911 Bacteria 3176
549 Ga0496109_0016760 3300048912 Bacteria 6411
550 Ga0496110_0010859 3300048913 Bacteria 7426
551 Ga0496111_0011849 3300048914 Bacteria 5888
552 Ga0496111_0267044 3300048914 Bacteria 1269
553 Ga0496112_0003529 3300048915 Bacteria 12970
554 Ga0496112_0022707 3300048915 Bacteria 5984
555 Ga0496112_0072554 3300048915 Bacteria 3403
556 Ga0496113_0000939 3300048916 Bacteria 15474
557 Ga0496113_0042291 3300048916 Bacteria 3366
558 Ga0496114_0024715 3300048917 Bacteria 4905
559 Ga0496114_0376230 3300048917 Bacteria 1257
560 Ga0496115_0030562 3300048918 Bacteria 4238
561 Ga0501033_0162323 3300049570 Bacteria 1608
562 Ga0501036_0128873 3300049572 Bacteria 2136
563 Ga0501039_0106779 3300049575 Bacteria 2187
564 Ga0501040_0009167 3300049576 Bacteria 6445
565 Ga0501040_0095125 3300049576 Bacteria 2073
566 Ga0501041_0003792 3300049577 Bacteria 8703
567 Ga0501041_0054829 3300049577 Bacteria 2432
568 Ga0501042_0017919 3300049578 Bacteria 4895
569 Ga0501042_0173581 3300049578 Bacteria 1555
570 Ga0501046_0023707 3300049580 Bacteria 5043
571 Ga0501046_0141696 3300049580 Bacteria 1819
572 Ga0501048_0084035 3300049582 Bacteria 2245
573 Ga0501071_0014804 3300049587 Bacteria 5342
574 Ga0501072_0092555 3300049588 Bacteria 2401
575 Ga0501075_0018215 3300049591 Bacteria 5079
576 Ga0501076_0018682 3300049592 Bacteria 5290
577 Ga0501077_0167566 3300049593 Bacteria 1396
578 Ga0501079_0041472 3300049741 Bacteria 3553
579 Ga0501080_0020000 3300049742 Bacteria 6197
580 Ga0501081_0020384 3300049743 Bacteria 4419
581 Ga0501035_0248896 3300049822 Bacteria 1510
582 Ga0501045_0000165 3300049824 Bacteria 36095
583 nmdc:mga0yw44_134375_c1 3300050492 Bacteria 1604
584 nmdc:mga0yw44_246797_c1 3300050492 Bacteria 1187
585 nmdc:mga06z11_18467_c1 3300050494 Bacteria 3185
586 nmdc:mga05p37_12282_c1 3300050507 Bacteria 10227
587 nmdc:mga05p37_28065_c1 3300050507 Bacteria 6859
588 nmdc:mga05p37_325014_c1 3300050507 Unclassified 1819
589 nmdc:mga05p37_328120_c1 3300050507 Bacteria 1809
590 nmdc:mga05p37_332634_c1 3300050507 Bacteria 1794
591 nmdc:mga05p37_52016_c1 3300050507 Bacteria 5037
592 nmdc:mga05p37_568406_c1 3300050507 Unclassified 1287
593 nmdc:mga05p37_88695_c1 3300050507 Bacteria 3812
594 nmdc:mga05p37_93998_c1 3300050507 Unclassified 3694
595 nmdc:mga09592_105373_c1 3300050508 Bacteria 2418
596 nmdc:mga09592_13908_c1 3300050508 Bacteria 6575
597 nmdc:mga09592_260493_c1 3300050508 Unclassified 1504
598 nmdc:mga09592_304829_c1 3300050508 Unclassified 1381
599 nmdc:mga09592_40336_c1 3300050508 Bacteria 3921
600 nmdc:mga09592_60111_c1 3300050508 Bacteria 3213
601 nmdc:mga0qj67_750_c1 3300050509 Bacteria 22040
602 nmdc:mga0qj67_99786_c1 3300050509 Bacteria 2340
603 nmdc:mga06r32_12748_c1 3300050510 Bacteria 7600
604 nmdc:mga06r32_14954_c1 3300050510 Bacteria 7043
605 nmdc:mga06r32_288508_c1 3300050510 Unclassified 1628
606 nmdc:mga06r32_301588_c1 3300050510 Unclassified 1588
607 nmdc:mga06r32_42107_c1 3300050510 Bacteria 4341
608 nmdc:mga06r32_9017_c2 3300050510 Bacteria 5128
609 nmdc:mga08y16_187080_c1 3300050511 Bacteria 2149
610 nmdc:mga08y16_20458_c1 3300050511 Bacteria 6986
611 nmdc:mga08y16_245404_c1 3300050511 Bacteria 1850
612 nmdc:mga08y16_344907_c1 3300050511 Bacteria 1531
613 nmdc:mga08y16_38534_c1 3300050511 Bacteria 5019
614 nmdc:mga08y16_40680_c1 3300050511 Bacteria 4871
615 nmdc:mga08y16_41846_c1 3300050511 Bacteria 4798
616 nmdc:mga08y16_87701_c1 3300050511 Bacteria 3242
617 nmdc:mga08y16_88888_c1 3300050511 Bacteria 3219
618 nmdc:mga0n895_122979_c1 3300050512 Unclassified 2617
619 nmdc:mga0n895_152324_c1 3300050512 Bacteria 2343
620 nmdc:mga0n895_260775_c1 3300050512 Bacteria 1759
621 nmdc:mga0n895_28192_c1 3300050512 Bacteria 5342
622 nmdc:mga0n895_46368_c1 3300050512 Bacteria 4246
623 nmdc:mga0n895_88102_c1 3300050512 Bacteria 3103
624 nmdc:mga0n895_95445_c1 3300050512 Bacteria 2978
625 nmdc:mga0rr50_128648_c1 3300050513 Unclassified 2025
626 nmdc:mga0rr50_162454_c1 3300050513 Bacteria 1814
627 nmdc:mga0rr50_211176_c1 3300050513 Bacteria 1599
628 nmdc:mga0rr50_34042_c1 3300050513 Bacteria 3645
629 nmdc:mga0rr50_9108_c1 3300050513 Bacteria 6216
630 nmdc:mga08x19_47129_c1 3300050514 Bacteria 2758
631 nmdc:mga08x19_49975_c1 3300050514 Bacteria 2682
632 nmdc:mga08x19_77888_c1 3300050514 Bacteria 2172
633 nmdc:mga0a205_117758_c1 3300050515 Bacteria 2555
634 nmdc:mga0a205_15803_c1 3300050515 Bacteria 7058
635 nmdc:mga0a205_32952_c1 3300050515 Unclassified 4969
636 nmdc:mga0a205_61978_c1 3300050515 Bacteria 3613
637 Ga0495655_0006564 3300053083 Bacteria 2120
638 Ga0495655_0017062 3300053083 Bacteria 1575
639 Ga0495619_0019971 3300053085 Bacteria 4263
640 Ga0495619_0072178 3300053085 Bacteria 2311
641 Ga0501084_0009946 3300054114 Bacteria 7863
642 Ga0501084_0196683 3300054114 Bacteria 1701
643 Ga0501084_0383727 3300054114 Bacteria 1187
644 Ga0501082_0011293 3300060353 Bacteria 7677
645 Ga0501082_0387668 3300060353 Bacteria 1219
646 Ga0530510_0003785 3300061734 Bacteria 10421
647 Ga0207663_10041753
648 JGI24744J21845_10010887
649 Ga0065704_10084618
650 Ga0065715_10090937
651 Ga0065707_10114686
652 Ga0070676_10025438
653 Ga0070690_100074321
654 Ga0070690_100076518
655 Ga0070690_100228938
656 Ga0070670_100007261
657 Ga0068869_100127460
658 Ga0070666_10028070
659 Ga0070666_10223571
660 Ga0070682_100032889
661 Ga0068868_100010987
662 Ga0068868_100018035
663 Ga0070689_100001704
664 Ga0070689_100009786
665 Ga0070689_100018002
666 Ga0070691_10015393
667 Ga0070691_10052678
668 Ga0070691_10183766
669 Ga0070687_100000718
670 Ga0070687_100059819
671 Ga0070687_100121356
672 Ga0070668_100058017
673 Ga0070668_100220865
674 Ga0070668_100317911
675 Ga0070669_100000469
676 Ga0070669_100002359
677 Ga0070669_100026388
678 Ga0070669_100166021
679 Ga0070669_100295088
680 Ga0070675_100000434
681 Ga0070675_100060366
682 Ga0070671_100053169
683 Ga0070671_100224887
684 Ga0070674_100031920
685 Ga0070674_100094967
686 Ga0070673_100065451
687 Ga0070673_100208207
688 Ga0070688_100006960
689 Ga0070659_100030626
690 Ga0070659_100172741
691 Ga0070667_100026982
692 Ga0070667_100055138
693 Ga0070667_100343247
694 Ga0070709_10249941
695 Ga0070714_100463900
696 Ga0070710_10147800
697 Ga0070710_10225292
698 Ga0070701_10008060
699 Ga0070701_10008191
700 Ga0070701_10024029
701 Ga0070705_100000087
702 Ga0070705_100005897
703 Ga0070705_100032990
704 Ga0070705_100116184
705 Ga0070700_100027233
706 Ga0070700_100039904
707 Ga0070700_100044034
708 Ga0070700_100073340
709 Ga0070694_100000103
710 Ga0070708_100029369
711 Ga0070708_100056261
712 Ga0070678_100022073
713 Ga0070678_100026346
714 Ga0070678_100056611
715 Ga0070678_100129966
716 Ga0070662_100017443
717 Ga0070662_100055998
718 Ga0070681_10180219
719 Ga0068867_100026065
720 Ga0068867_100036438
721 Ga0068867_100049666
722 Ga0068867_100096726
723 Ga0070685_10012676
724 Ga0070706_100008793
725 Ga0070706_100210070
726 Ga0070706_100289092
727 Ga0070707_100095323
728 Ga0070707_100135893
729 Ga0070698_100007256
730 Ga0070698_100010997
731 Ga0070698_100016189
732 Ga0070698_100064007
733 Ga0070698_100187345
734 Ga0070698_100338879
735 Ga0070699_100017207
736 Ga0070699_100066060
737 Ga0070699_100070734
738 Ga0070699_100078241
739 Ga0070699_100220891
740 Ga0070679_100005004
741 Ga0070697_100034887
742 Ga0070697_100038196
743 Ga0068853_100153637
744 Ga0070672_100027999
745 Ga0070672_100049009
746 Ga0070672_100158415
747 Ga0070686_100038434
748 Ga0070686_100056065
749 Ga0070686_100094247
750 Ga0070686_100104822
751 Ga0070695_100000116
752 Ga0070695_100037549
753 Ga0070696_100000345
754 Ga0070696_100001426
755 Ga0070696_100077579
756 Ga0070696_100152962
757 Ga0070696_100165745
758 Ga0070704_100000258
759 Ga0070704_100001068
760 Ga0070704_100228098
761 Ga0070664_100012100
762 Ga0070664_100038150
763 Ga0070664_100156300
764 Ga0070664_100398216
765 Ga0068857_100134986
766 Ga0068857_100199001
767 Ga0068854_100019198
768 Ga0068856_100066336
769 Ga0068856_100135015
770 Ga0070702_100035194
771 Ga0070702_100064569
772 Ga0068852_100022763
773 Ga0068852_100031308
774 Ga0068859_100011783
775 Ga0068859_100015539
776 Ga0068859_100026138
777 Ga0068859_100374142
778 Ga0068859_100399206
779 Ga0068864_100012076
780 Ga0068864_100019652
781 Ga0068866_10001364
782 Ga0068866_10006714
783 Ga0068861_100013268
784 Ga0068861_100045060
785 Ga0068861_100105419
786 Ga0068870_10001492
787 Ga0068870_10002270
788 Ga0068863_100022288
789 Ga0068863_100129613
790 Ga0068858_100031820
791 Ga0068858_100033662
792 Ga0068858_100270418
793 Ga0068858_100362929
794 Ga0068860_100009000
795 Ga0068860_100309814
796 Ga0068862_100003067
797 Ga0068862_100010563
798 Ga0068862_100086031
799 Ga0068862_100107394
800 Ga0081455_10002744
801 Ga0081455_10037892
802 Ga0081455_10053278
803 Ga0081538_10007260
804 Ga0081540_1020328
805 Ga0081540_1039895
806 Ga0081539_10002992
807 Ga0070717_10234405
808 Ga0070717_10261406
809 Ga0075365_10015095
810 Ga0075365_10125402
811 Ga0070715_10016945
812 Ga0070712_100093398
813 Ga0097621_100038830
814 Ga0097621_100126965
815 Ga0068871_100045834
816 Ga0068871_100164460
817 Ga0075428_100003941
818 Ga0075428_100012537
819 Ga0075428_100019135
820 Ga0075428_100022546
821 Ga0075428_100055848
822 Ga0075428_100116314
823 Ga0075428_100587768
824 Ga0075430_100005600
825 Ga0075430_100025145
826 Ga0075430_100033906
827 Ga0075430_100216057
828 Ga0075431_100003251
829 Ga0075431_100024649
830 Ga0075431_100033460
831 Ga0075431_100089831
832 Ga0075431_100306920
833 Ga0075433_10141827
834 Ga0075433_10195813
835 Ga0075434_100025353
836 Ga0075434_100028284
837 Ga0075434_100030564
838 Ga0075434_100036935
839 Ga0075434_100081750
840 Ga0075434_100111120
841 Ga0075434_100186365
842 Ga0075434_100247518
843 Ga0075429_100021504
844 Ga0075429_100032031
845 Ga0075429_100033185
846 Ga0075429_100094962
847 Ga0075429_100172125
848 Ga0075429_100188452
849 Ga0068865_100042664
850 Ga0068865_100091590
851 Ga0068865_100103353
852 Ga0068865_100140984
853 Ga0075436_100026418
854 Ga0075436_100038527
855 Ga0075436_100065981
856 Ga0097620_100011784
857 Ga0097620_100015539
858 Ga0097620_100026139
859 Ga0097620_100374173
860 Ga0097620_100399255
861 Ga0075435_100006662
862 Ga0075435_100047135
863 Ga0075435_100120009
864 Ga0075435_100262247
865 Ga0075435_100327901
866 Ga0099794_10058785
867 Ga0099795_10008135
868 Ga0099795_10030147
869 Ga0099795_10045526
870 Ga0111539_10019604
871 Ga0111539_10050388
872 Ga0111539_10056661
873 Ga0111539_10093502
874 Ga0111539_10139950
875 Ga0111539_10183035
876 Ga0111539_10217425
877 Ga0111539_10221593
878 Ga0111539_10339503
879 Ga0105245_10018123
880 Ga0105245_10080262
881 Ga0105245_10151106
882 Ga0105245_10200661
883 Ga0105247_10023915
884 Ga0114129_10001361
885 Ga0114129_10018128
886 Ga0114129_10019617
887 Ga0114129_10060178
888 Ga0114129_10067683
889 Ga0114129_10122311
890 Ga0114129_10135468
891 Ga0114129_10139289
892 Ga0114129_10191650
893 Ga0114129_10224516
894 Ga0114129_10241867
895 Ga0114129_10290199
896 Ga0114129_10388666
897 Ga0105243_10023838
898 Ga0105243_10024807
899 Ga0105243_10102615
900 Ga0105243_10227202
901 Ga0105241_10138980
902 Ga0105242_10110989
903 Ga0105248_10092868
904 Ga0105248_10355764
905 Ga0105237_10092746
906 Ga0105237_10172535
907 Ga0105238_10227084
908 Ga0105238_10369122
909 Ga0105249_10001202
910 Ga0105249_10004703
911 Ga0105249_10170610
912 Ga0099796_10002201
913 Ga0099796_10011742
914 Ga0099796_10043251
915 Ga0099796_10055653
916 Ga0099796_10077165
917 Ga0105239_10038686
918 Ga0105246_10028785
919 Ga0157369_10098667
920 Ga0157374_10029861
921 Ga0157374_10363650
922 Ga0157378_10438577
923 Ga0163162_10020430
924 Ga0163162_10101481
925 Ga0163162_10569104
926 Ga0157375_10001976
927 Ga0163163_10004470
928 Ga0157380_10006570
929 Ga0157380_10096133
930 Ga0157380_10188662
931 Ga0157380_10266130
932 Ga0157377_10007373
933 Ga0157377_10061890
934 Ga0157379_10022371
935 Ga0157379_10099663
936 Ga0157379_10106831
937 Ga0157379_10110816
938 Ga0157379_10568639
939 Ga0157376_10077244
940 Ga0157376_10288578
941 Ga0163161_10015548
942 Ga0163161_10190127
943 Ga0213875_10001582
944 Ga0207697_10048086
945 Ga0207656_10037715
946 Ga0207682_10002879
947 Ga0207682_10005626
948 Ga0207692_10167411
949 Ga0207642_10005418
950 Ga0207642_10064879
951 Ga0207710_10004935
952 Ga0207688_10002345
953 Ga0207688_10002434
954 Ga0207680_10012006
955 Ga0207647_10040649
956 Ga0207685_10023712
957 Ga0207699_10134983
958 Ga0207645_10029000
959 Ga0207645_10040266
960 Ga0207643_10000341
961 Ga0207643_10003085
962 Ga0207643_10004633
963 Ga0207643_10005100
964 Ga0207684_10008665
965 Ga0207684_10347328
966 Ga0207707_10182128
967 Ga0207671_10258899
968 Ga0207693_10073454
969 Ga0207693_10296200
970 Ga0207662_10001094
971 Ga0207662_10004667
972 Ga0207662_10020459
973 Ga0207662_10075092
974 Ga0207657_10218748
975 Ga0207652_10016988
976 Ga0207646_10027373
977 Ga0207646_10127334
978 Ga0207646_10354785
979 Ga0207681_10001204
980 Ga0207681_10032113
981 Ga0207681_10058569
982 Ga0207650_10002383
983 Ga0207659_10002109
984 Ga0207659_10031905
985 Ga0207659_10065914
986 Ga0207659_10107253
987 Ga0207659_10140661
988 Ga0207687_10080121
989 Ga0207687_10089707
990 Ga0207700_10005412
991 Ga0207644_10021453
992 Ga0207690_10058525
993 Ga0207690_10171218
994 Ga0207706_10005044
995 Ga0207706_10011190
996 Ga0207706_10022917
997 Ga0207706_10046766
998 Ga0207686_10086692
999 Ga0207709_10013423
1000 Ga0207709_10113969
1001 Ga0207709_10153934
1002 Ga0207709_10163769
1003 Ga0207670_10007980
1004 Ga0207670_10014789
1005 Ga0207669_10006349
1006 Ga0207669_10072395
1007 Ga0207704_10073950
1008 Ga0207704_10165625
1009 Ga0207691_10009770
1010 Ga0207691_10015222
1011 Ga0207691_10030380
1012 Ga0207691_10051304
1013 Ga0207691_10067745
1014 Ga0207711_10016189
1015 Ga0207711_10058034
1016 Ga0207689_10005583
1017 Ga0207689_10006278
1018 Ga0207689_10020478
1019 Ga0207689_10022097
1020 Ga0207679_10038181
1021 Ga0207679_10038741
1022 Ga0207679_10420400
1023 Ga0207667_10496258
1024 Ga0207651_10046953
1025 Ga0207651_10114994
1026 Ga0207651_10123633
1027 Ga0207651_10127999
1028 Ga0207712_10005964
1029 Ga0207640_10013680
1030 Ga0207640_10052222
1031 Ga0207658_10174379
1032 Ga0207658_10226455
1033 Ga0207677_10027565
1034 Ga0207677_10051826
1035 Ga0207703_10004950
1036 Ga0207703_10410095
1037 Ga0207639_10099218
1038 Ga0207678_10016966
1039 Ga0207708_10050774
1040 Ga0207708_10051802
1041 Ga0207708_10078430
1042 Ga0207708_10092855
1043 Ga0207702_10210741
1044 Ga0207702_10609978
1045 Ga0207641_10050831
1046 Ga0207641_10286418
1047 Ga0207648_10000663
1048 Ga0207648_10001784
1049 Ga0207648_10009558
1050 Ga0207648_10021060
1051 Ga0207648_10066676
1052 Ga0207648_10141128
1053 Ga0207648_10335986
1054 Ga0207676_10013360
1055 Ga0207676_10015619
1056 Ga0207676_10039411
1057 Ga0207676_10152385
1058 Ga0207674_10006149
1059 Ga0207674_10034624
1060 Ga0207674_10113370
1061 Ga0207675_100020423
1062 Ga0207675_100022660
1063 Ga0207675_100034931
1064 Ga0207675_100080797
1065 Ga0207675_100230443
1066 Ga0207683_10005913
1067 Ga0207683_10014274
1068 Ga0207683_10034515
1069 Ga0207683_10035549
1070 Ga0207698_10180656
1071 Ga0209179_1004445
1072 Ga0209588_1040542
1073 Ga0207428_10003778
1074 Ga0207428_10010627
1075 Ga0207428_10024437
1076 Ga0207428_10046796
1077 Ga0207428_10156215
1078 Ga0268266_10110610
1079 Ga0268266_10215374
1080 Ga0268265_10012272
1081 Ga0268265_10012872
1082 Ga0268265_10206722
1083 Ga0268264_10002080
1084 Ga0268264_10342928
1085 Ga0265337_1001171
1086 Ga0265334_10002338
1087 Ga0265338_10042611
1088 Ga0265314_10112167
1089 Ga0373938_0044857
1090 Ga0373926_0000756
1091 Ga0373940_0010897
1092 Ga0373949_0011116
1093 Ga0373932_0022109
1094 Ga0373936_0030253
1095 Ga0373939_0007294
1096 Ga0373939_0028649
1097 Ga0373945_0001424
1098 Ga0373945_0021917
1099 Ga0373943_0013819
1100 Ga0373943_0021184
1101 Ga0373943_0085306
1102 Ga0373946_0007006
1103 Ga0373946_0035434
1104 Ga0373961_0021494
1105 Ga0373961_0034673
1106 Ga0373962_0012441
1107 Ga0373931_0049108
1108 Ga0373935_0001314
1109 Ga0373927_0017996
1110 Ga0373927_0041035
1111 Ga0373927_0046418
1112 Ga0373927_0205975
1113 Ga0373927_0319876
1114 Ga0373947_0016867
1115 Ga0373947_0029423
1116 Ga0373947_0174148
1117 Ga0373925_0007447
1118 Ga0373925_0009825
1119 Ga0373925_0011265
1120 Ga0373925_0137954
1121 Ga0373925_0209629
1122 Ga0436364_0694410
1123 Ga0439453_0015767
1124 Ga0439440_0020599
1125 Ga0451576_0005960
1126 Ga0451576_0011227
1127 Ga0451576_0026777
1128 Ga0495617_069384
1129 Ga0495603_0004289
1130 Ga0495603_0020633
1131 Ga0495629_0102642
1132 Ga0495580_0007890
1133 Ga0495580_0019012
1134 Ga0495582_0039517
1135 Ga0495582_0098889
1136 Ga0495639_0011222
1137 Ga0495662_0054947
1138 Ga0495662_0068953
1139 Ga0495584_0025097
1140 Ga0495584_0158790
1141 Ga0495585_0075743
1142 Ga0495585_0118443
1143 Ga0495594_0202496
1144 Ga0495630_0137936
1145 Ga0495630_0241546
1146 Ga0495666_0088974
1147 Ga0495665_0014647
1148 Ga0495640_0050576
1149 Ga0495640_0124383
1150 Ga0495586_0023929
1151 Ga0495586_0150676
1152 Ga0495598_0026605
1153 Ga0495609_0070569
1154 Ga0495621_0035195
1155 Ga0495634_0067035
1156 Ga0495659_0001163
1157 Ga0495647_0006749
1158 Ga0495647_0013593
1159 Ga0495647_0033778
1160 Ga0495658_0011598
1161 Ga0495658_0043230
1162 Ga0495658_0178987
1163 Ga0495669_0080416
1164 Ga0495613_0171786
1165 Ga0495624_0016501
1166 Ga0495670_0052173
1167 Ga0495671_0091159
1168 Ga0495581_0086395
1169 Ga0495581_0157771
1170 Ga0495604_0272152
1171 Ga0495674_0095156
1172 Ga0495676_0016209
1173 Ga0495677_0079806
1174 Ga0495593_0075285
1175 Ga0495614_0090192
1176 Ga0496100_0020108
1177 Ga0496102_0028710
1178 Ga0496102_0393836
1179 Ga0496103_0034913
1180 Ga0496103_0075929
1181 Ga0496104_0024341
1182 Ga0496104_0043779
1183 Ga0496104_0156291
1184 Ga0496104_0222219
1185 Ga0496104_0422135
1186 Ga0496105_0011514
1187 Ga0496105_0092550
1188 Ga0496106_0015469
1189 Ga0496106_0030862
1190 Ga0496106_0204908
1191 Ga0496106_0298848
1192 Ga0496107_0007009
1193 Ga0496108_0057250
1194 Ga0496108_0060873
1195 Ga0496109_0016760
1196 Ga0496110_0010859
1197 Ga0496111_0011849
1198 Ga0496111_0267044
1199 Ga0496112_0003529
1200 Ga0496112_0022707
1201 Ga0496112_0072554
1202 Ga0496113_0000939
1203 Ga0496113_0042291
1204 Ga0496114_0024715
1205 Ga0496114_0376230
1206 Ga0496115_0030562
1207 Ga0501033_0162323
1208 Ga0501036_0128873
1209 Ga0501039_0106779
1210 Ga0501040_0009167
1211 Ga0501040_0095125
1212 Ga0501041_0003792
1213 Ga0501041_0054829
1214 Ga0501042_0017919
1215 Ga0501042_0173581
1216 Ga0501046_0023707
1217 Ga0501046_0141696
1218 Ga0501048_0084035
1219 Ga0501071_0014804
1220 Ga0501072_0092555
1221 Ga0501075_0018215
1222 Ga0501076_0018682
1223 Ga0501077_0167566
1224 Ga0501079_0041472
1225 Ga0501080_0020000
1226 Ga0501081_0020384
1227 Ga0501035_0248896
1228 Ga0501045_0000165
1229 nmdc:mga0yw44_134375_c1
1230 nmdc:mga0yw44_246797_c1
1231 nmdc:mga06z11_18467_c1
1232 nmdc:mga05p37_12282_c1
1233 nmdc:mga05p37_28065_c1
1234 nmdc:mga05p37_325014_c1
1235 nmdc:mga05p37_328120_c1
1236 nmdc:mga05p37_332634_c1
1237 nmdc:mga05p37_52016_c1
1238 nmdc:mga05p37_568406_c1
1239 nmdc:mga05p37_88695_c1
1240 nmdc:mga05p37_93998_c1
1241 nmdc:mga09592_105373_c1
1242 nmdc:mga09592_13908_c1
1243 nmdc:mga09592_260493_c1
1244 nmdc:mga09592_304829_c1
1245 nmdc:mga09592_40336_c1
1246 nmdc:mga09592_60111_c1
1247 nmdc:mga0qj67_750_c1
1248 nmdc:mga0qj67_99786_c1
1249 nmdc:mga06r32_12748_c1
1250 nmdc:mga06r32_14954_c1
1251 nmdc:mga06r32_288508_c1
1252 nmdc:mga06r32_301588_c1
1253 nmdc:mga06r32_42107_c1
1254 nmdc:mga06r32_9017_c2
1255 nmdc:mga08y16_187080_c1
1256 nmdc:mga08y16_20458_c1
1257 nmdc:mga08y16_245404_c1
1258 nmdc:mga08y16_344907_c1
1259 nmdc:mga08y16_38534_c1
1260 nmdc:mga08y16_40680_c1
1261 nmdc:mga08y16_41846_c1
1262 nmdc:mga08y16_87701_c1
1263 nmdc:mga08y16_88888_c1
1264 nmdc:mga0n895_122979_c1
1265 nmdc:mga0n895_152324_c1
1266 nmdc:mga0n895_260775_c1
1267 nmdc:mga0n895_28192_c1
1268 nmdc:mga0n895_46368_c1
1269 nmdc:mga0n895_88102_c1
1270 nmdc:mga0n895_95445_c1
1271 nmdc:mga0rr50_128648_c1
1272 nmdc:mga0rr50_162454_c1
1273 nmdc:mga0rr50_211176_c1
1274 nmdc:mga0rr50_34042_c1
1275 nmdc:mga0rr50_9108_c1
1276 nmdc:mga08x19_47129_c1
1277 nmdc:mga08x19_49975_c1
1278 nmdc:mga08x19_77888_c1
1279 nmdc:mga0a205_117758_c1
1280 nmdc:mga0a205_15803_c1
1281 nmdc:mga0a205_32952_c1
1282 nmdc:mga0a205_61978_c1
1283 Ga0495655_0006564
1284 Ga0495655_0017062
1285 Ga0495619_0019971
1286 Ga0495619_0072178
1287 Ga0501084_0009946
1288 Ga0501084_0196683
1289 Ga0501084_0383727
1290 Ga0501082_0011293
1291 Ga0501082_0387668
1292 Ga0530510_0003785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08450

SGL

SMP-30/Gluconolactonase/LRE-like region

69

319

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.9071 39 332
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.8982 39 332
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.8911 35 326
3dr2-assembly1.cif.gz_A structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.8838 38 326
7ris-assembly1.cif.gz_A crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound phosphate 0.8617 57 338
ID Description Score Start End Superfamily
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9004 39 332 2.120.10.30
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8914 39 332 2.120.10.30
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8838 38 326 2.120.10.30
5chbC00 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8407 111 202 2.40.10.500
af_P0CG21_5_122_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8364 111 234 2.40.10.500
ID Description Score Start End GO Terms
AF-A0A382I197-F1-model_v4 SMP-30/Gluconolactonase/LRE-like region domain-containing protein 0.9823 38 311 GO:0016787
AF-A0A5N9E5Q4-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9776 38 131 GO:0016787
AF-A0A382I197-F1-model_v4 SMP-30/Gluconolactonase/LRE-like region domain-containing protein 0.9752 38 311 GO:0016787
AF-A0A5N9EGL9-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9738 38 156 GO:0016787
AF-A0A7X3WJ33-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9729 39 333 GO:0016787
GO:0046872

Map