F472007

General Info

Members Datasets Scaffolds Average Seq Length
644 223 643 99

Family's Representative Sequence

Representative Sequence 3300001915|JGI24741J21665_1009690|JGI24741J21665_10096902
Length 89
Sequence MIAVFQIIQLLLSVVTWIIFNVINTHNDFVRQLLYALSRMTEPMYRPIRRIMPDFGALDFSPLVVLLLIQIVSGIIIPHLEVSLLTAGA

Samples

Sample ID Description Type Environment
1 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
96 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
175 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
176 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
177 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
178 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
192 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
216 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
217 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
218 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
219 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
220 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
221 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.4
Nodule 0
Rhizoplane 4.04
Rhizosphere 93.79
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1004057 3300000549 Bacteria 1925
2 JGI24736J21556_1059420 3300001904 Bacteria 591
3 JGI24741J21665_1009690 3300001915 Bacteria 1757
4 JGI24741J21665_1056114 3300001915 Bacteria 580
5 JGI24740J21852_10043130 3300001979 Bacteria 1347
6 JGI24740J21852_10094440 3300001979 Bacteria 768
7 JGI24739J22299_10008673 3300001989 Bacteria 3792
8 JGI24739J22299_10055781 3300001989 Bacteria 1262
9 JGI24739J22299_10151468 3300001989 Bacteria 686
10 JGI24737J22298_10001243 3300001990 Bacteria 9004
11 JGI24737J22298_10057625 3300001990 Bacteria 1172
12 JGI24743J22301_10059234 3300001991 Bacteria 787
13 JGI24735J21928_10002241 3300002067 Bacteria 6764
14 JGI24735J21928_10047889 3300002067 Bacteria 1238
15 JGI24735J21928_10055269 3300002067 Bacteria 1144
16 JGI24735J21928_10091729 3300002067 Bacteria 871
17 JGI24735J21928_10136456 3300002067 Bacteria 707
18 JGI24735J21928_10210420 3300002067 Bacteria 564
19 JGI24738J21930_10001440 3300002075 Bacteria 6610
20 JGI24738J21930_10015042 3300002075 Bacteria 1651
21 JGI24738J21930_10041125 3300002075 Bacteria 939
22 JGI24744J21845_10007524 3300002077 Bacteria 2250
23 JGI24742J22300_10105622 3300002244 Bacteria 548
24 JGI25157J39369_1013249 3300002741 Bacteria 1040
25 JGI25165J46597_1000040 3300003214 Bacteria 277491
26 Ga0055542_1001654 3300003762 Bacteria 9990
27 Ga0055529_1005922 3300003763 Bacteria 1739
28 Ga0065715_10512583 3300005293 Bacteria 770
29 Ga0070658_10000022 3300005327 Bacteria 186706
30 Ga0070658_10003723 3300005327 Bacteria 12473
31 Ga0070658_10007308 3300005327 Bacteria 8922
32 Ga0070658_10030124 3300005327 Bacteria 4361
33 Ga0070658_10050893 3300005327 Bacteria 3358
34 Ga0070658_10057701 3300005327 Bacteria 3158
35 Ga0070658_10491993 3300005327 Bacteria 1059
36 Ga0070658_11026774 3300005327 Bacteria 717
37 Ga0070676_10188562 3300005328 Bacteria 1345
38 Ga0070683_100157353 3300005329 Bacteria 2155
39 Ga0070683_100775204 3300005329 Bacteria 919
40 Ga0070690_100007013 3300005330 Bacteria 6423
41 Ga0070690_100846865 3300005330 Bacteria 712
42 Ga0070670_100053682 3300005331 Bacteria 3461
43 Ga0070670_100466547 3300005331 Bacteria 1120
44 Ga0070677_10521097 3300005333 Bacteria 647
45 Ga0070666_10004292 3300005335 Bacteria 8676
46 Ga0070666_10043239 3300005335 Bacteria 3016
47 Ga0070680_100000683 3300005336 Bacteria 23493
48 Ga0070680_100005956 3300005336 Bacteria 9250
49 Ga0070680_100111365 3300005336 Bacteria 2279
50 Ga0070682_100022704 3300005337 Bacteria 3719
51 Ga0068868_100128441 3300005338 Bacteria 2072
52 Ga0068868_101970044 3300005338 Bacteria 554
53 Ga0070660_100000212 3300005339 Bacteria 39028
54 Ga0070660_100000751 3300005339 Bacteria 21524
55 Ga0070660_100009089 3300005339 Bacteria 6976
56 Ga0070660_100036201 3300005339 Bacteria 3737
57 Ga0070660_100058544 3300005339 Bacteria 2986
58 Ga0070660_100059159 3300005339 Bacteria 2971
59 Ga0070660_100087592 3300005339 Bacteria 2451
60 Ga0070660_100101033 3300005339 Bacteria 2285
61 Ga0070660_100142921 3300005339 Bacteria 1921
62 Ga0070660_100204728 3300005339 Bacteria 1601
63 Ga0070660_101229501 3300005339 Unclassified 635
64 Ga0070660_101356752 3300005339 Bacteria 604
65 Ga0070689_100191079 3300005340 Bacteria 1667
66 Ga0070687_100449035 3300005343 Bacteria 857
67 Ga0070661_100092611 3300005344 Bacteria 2239
68 Ga0070661_101214502 3300005344 Bacteria 631
69 Ga0070661_101732613 3300005344 Bacteria 530
70 Ga0070692_10018011 3300005345 Bacteria 3388
71 Ga0070692_10405270 3300005345 Bacteria 862
72 Ga0070692_10500975 3300005345 Unclassified 787
73 Ga0070668_100000009 3300005347 Bacteria 136884
74 Ga0070668_101749405 3300005347 Bacteria 571
75 Ga0070675_100014931 3300005354 Bacteria 6133
76 Ga0070675_100635906 3300005354 Bacteria 969
77 Ga0070675_101268679 3300005354 Bacteria 679
78 Ga0070671_100000098 3300005355 Bacteria 55077
79 Ga0070671_100007591 3300005355 Bacteria 8672
80 Ga0070671_100037988 3300005355 Bacteria 3996
81 Ga0070671_100589986 3300005355 Bacteria 960
82 Ga0070674_100014374 3300005356 Bacteria 4922
83 Ga0070674_100058710 3300005356 Bacteria 2675
84 Ga0070673_100003346 3300005364 Bacteria 9964
85 Ga0070673_101104519 3300005364 Bacteria 741
86 Ga0070673_101230150 3300005364 Bacteria 702
87 Ga0070673_101740011 3300005364 Bacteria 590
88 Ga0070688_100394290 3300005365 Bacteria 1023
89 Ga0070659_100075326 3300005366 Bacteria 2690
90 Ga0070659_100212273 3300005366 Bacteria 1595
91 Ga0070659_100234456 3300005366 Bacteria 1517
92 Ga0070659_100371804 3300005366 Bacteria 1203
93 Ga0070659_101308496 3300005366 Bacteria 643
94 Ga0070667_100014991 3300005367 Bacteria 6404
95 Ga0070667_100721756 3300005367 Bacteria 923
96 Ga0070663_100004783 3300005455 Bacteria 7986
97 Ga0070663_100062771 3300005455 Bacteria 2680
98 Ga0070663_100771104 3300005455 Bacteria 823
99 Ga0070663_101245291 3300005455 Bacteria 655
100 Ga0070663_101928583 3300005455 Bacteria 531
101 Ga0070678_100033684 3300005456 Bacteria 3560
102 Ga0070678_100046037 3300005456 Bacteria 3125
103 Ga0070662_100197093 3300005457 Bacteria 1596
104 Ga0070662_101887963 3300005457 Bacteria 516
105 Ga0070681_10224690 3300005458 Bacteria 1792
106 Ga0068867_100002136 3300005459 Bacteria 13892
107 Ga0070679_100211558 3300005530 Bacteria 1903
108 Ga0070679_101060232 3300005530 Bacteria 755
109 Ga0070679_101509512 3300005530 Unclassified 619
110 Ga0070684_100021129 3300005535 Bacteria 5409
111 Ga0068853_100014991 3300005539 Bacteria 6368
112 Ga0068853_100039431 3300005539 Bacteria 4028
113 Ga0068853_100142436 3300005539 Bacteria 2153
114 Ga0068853_100399728 3300005539 Bacteria 1286
115 Ga0068853_101568583 3300005539 Bacteria 638
116 Ga0070672_100011066 3300005543 Bacteria 6281
117 Ga0070672_100086454 3300005543 Bacteria 2521
118 Ga0070672_101943151 3300005543 Bacteria 530
119 Ga0070686_100147263 3300005544 Bacteria 1645
120 Ga0070686_100168303 3300005544 Bacteria 1548
121 Ga0070693_100311889 3300005547 Bacteria 1064
122 Ga0070693_101347580 3300005547 Bacteria 553
123 Ga0070665_100154914 3300005548 Bacteria 2293
124 Ga0070665_100222949 3300005548 Bacteria 1886
125 Ga0070665_100556885 3300005548 Bacteria 1159
126 Ga0068855_100000079 3300005563 Bacteria 117264
127 Ga0068855_100001164 3300005563 Bacteria 32603
128 Ga0068855_100074321 3300005563 Bacteria 3948
129 Ga0068855_100135870 3300005563 Bacteria 2806
130 Ga0068855_100381789 3300005563 Bacteria 1547
131 Ga0068855_101106566 3300005563 Bacteria 828
132 Ga0068857_100043136 3300005577 Bacteria 4001
133 Ga0068857_100058302 3300005577 Bacteria 3428
134 Ga0068854_100003204 3300005578 Bacteria 10212
135 Ga0068854_100107471 3300005578 Bacteria 2100
136 Ga0068854_100875848 3300005578 Bacteria 788
137 Ga0068856_100013426 3300005614 Bacteria 7930
138 Ga0068856_100015289 3300005614 Bacteria 7416
139 Ga0068856_100124219 3300005614 Bacteria 2583
140 Ga0068856_100169948 3300005614 Bacteria 2192
141 Ga0068856_100601597 3300005614 Bacteria 1120
142 Ga0068856_100834864 3300005614 Bacteria 941
143 Ga0068856_101022253 3300005614 Bacteria 845
144 Ga0068856_101803531 3300005614 Unclassified 623
145 Ga0068852_100045398 3300005616 Bacteria 3737
146 Ga0068852_100104429 3300005616 Bacteria 2564
147 Ga0068852_100414295 3300005616 Bacteria 1328
148 Ga0068852_102269602 3300005616 Unclassified 564
149 Ga0068859_100025222 3300005617 Bacteria 5966
150 Ga0068859_100028499 3300005617 Bacteria 5598
151 Ga0068859_100060239 3300005617 Bacteria 3825
152 Ga0068859_100282737 3300005617 Bacteria 1752
153 Ga0068859_101487985 3300005617 Bacteria 747
154 Ga0068864_100091289 3300005618 Bacteria 2686
155 Ga0068866_10009481 3300005718 Bacteria 4134
156 Ga0068851_10013745 3300005834 Bacteria 3832
157 Ga0068851_10076113 3300005834 Bacteria 1745
158 Ga0068851_10170800 3300005834 Bacteria 1200
159 Ga0068851_10270961 3300005834 Bacteria 968
160 Ga0068851_10671319 3300005834 Bacteria 636
161 Ga0068863_100000040 3300005841 Bacteria 158465
162 Ga0068863_100011841 3300005841 Bacteria 8430
163 Ga0068858_100074689 3300005842 Bacteria 3148
164 Ga0068858_100147612 3300005842 Bacteria 2209
165 Ga0068860_100039460 3300005843 Bacteria 4516
166 Ga0068860_100150631 3300005843 Bacteria 2240
167 Ga0068860_100246295 3300005843 Bacteria 1739
168 Ga0068862_100026335 3300005844 Bacteria 4887
169 Ga0068862_101180886 3300005844 Bacteria 763
170 Ga0081539_10023429 3300005985 Bacteria 4046
171 Ga0097621_100001388 3300006237 Bacteria 16665
172 Ga0097621_100013189 3300006237 Bacteria 6149
173 Ga0097621_100955552 3300006237 Bacteria 800
174 Ga0068871_100002654 3300006358 Bacteria 12217
175 Ga0068871_100508967 3300006358 Bacteria 1086
176 Ga0068865_100001550 3300006881 Bacteria 13415
177 Ga0097620_100025222 3300006931 Bacteria 5966
178 Ga0097620_100028499 3300006931 Bacteria 5598
179 Ga0097620_100060239 3300006931 Bacteria 3825
180 Ga0097620_100282735 3300006931 Bacteria 1752
181 Ga0097620_101487880 3300006931 Bacteria 747
182 Ga0105240_10195311 3300009093 Bacteria 2377
183 Ga0105240_10523701 3300009093 Bacteria 1315
184 Ga0105240_11016101 3300009093 Bacteria 886
185 Ga0105240_11479079 3300009093 Bacteria 713
186 Ga0105240_11772168 3300009093 Bacteria 644
187 Ga0105245_10006481 3300009098 Bacteria 10291
188 Ga0105247_11284427 3300009101 Bacteria 587
189 Ga0105243_10008878 3300009148 Bacteria 7692
190 Ga0105243_10556538 3300009148 Bacteria 1097
191 Ga0105241_10407683 3300009174 Bacteria 1194
192 Ga0105241_10411987 3300009174 Bacteria 1188
193 Ga0105241_12656254 3300009174 Bacteria 504
194 Ga0105242_10468643 3300009176 Bacteria 1191
195 Ga0105238_10115889 3300009551 Bacteria 2659
196 Ga0105238_10120121 3300009551 Bacteria 2608
197 Ga0105238_10212626 3300009551 Bacteria 1910
198 Ga0105238_10213649 3300009551 Bacteria 1905
199 Ga0105238_10654371 3300009551 Bacteria 1061
200 Ga0105238_10771949 3300009551 Bacteria 976
201 Ga0105238_11166722 3300009551 Bacteria 794
202 Ga0105238_11322918 3300009551 Bacteria 747
203 Ga0105249_10001735 3300009553 Bacteria 19048
204 Ga0105239_10110863 3300010375 Bacteria 3041
205 Ga0105239_10223798 3300010375 Bacteria 2110
206 Ga0105239_10544033 3300010375 Bacteria 1322
207 Ga0105239_10823445 3300010375 Bacteria 1064
208 Ga0105246_10823511 3300011119 Bacteria 826
209 Ga0105246_11427634 3300011119 Bacteria 647
210 Ga0157373_10039126 3300013100 Bacteria 3396
211 Ga0157373_10089696 3300013100 Bacteria 2165
212 Ga0157373_10185883 3300013100 Bacteria 1464
213 Ga0157373_10317179 3300013100 Bacteria 1108
214 Ga0157371_10000558 3300013102 Bacteria 44161
215 Ga0157371_10038395 3300013102 Bacteria 3426
216 Ga0157371_10073063 3300013102 Bacteria 2429
217 Ga0157371_10466437 3300013102 Bacteria 930
218 Ga0157371_10729058 3300013102 Unclassified 743
219 Ga0157371_11516260 3300013102 Unclassified 523
220 Ga0157370_10000117 3300013104 Bacteria 92168
221 Ga0157370_10097405 3300013104 Bacteria 2759
222 Ga0157370_10148254 3300013104 Bacteria 2184
223 Ga0157370_10152799 3300013104 Bacteria 2148
224 Ga0157370_10834916 3300013104 Bacteria 838
225 Ga0157370_11370216 3300013104 Bacteria 637
226 Ga0157370_11480549 3300013104 Bacteria 610
227 Ga0157369_10007204 3300013105 Bacteria 12816
228 Ga0157369_10014466 3300013105 Bacteria 8907
229 Ga0157369_10042284 3300013105 Bacteria 4972
230 Ga0157369_10224048 3300013105 Bacteria 1967
231 Ga0157369_10666497 3300013105 Bacteria 1072
232 Ga0157369_10945017 3300013105 Bacteria 883
233 Ga0157369_10981418 3300013105 Bacteria 865
234 Ga0157369_11616413 3300013105 Bacteria 659
235 Ga0157374_10062500 3300013296 Bacteria 3490
236 Ga0157374_10332629 3300013296 Bacteria 1507
237 Ga0157374_10365541 3300013296 Bacteria 1435
238 Ga0157374_10694771 3300013296 Bacteria 1030
239 Ga0157374_12771071 3300013296 Unclassified 518
240 Ga0157378_10031009 3300013297 Bacteria 4721
241 Ga0163162_10148849 3300013306 Bacteria 2458
242 Ga0163162_10787967 3300013306 Bacteria 1068
243 Ga0163162_11920567 3300013306 Bacteria 678
244 Ga0157372_10093707 3300013307 Bacteria 3418
245 Ga0157372_10346343 3300013307 Bacteria 1731
246 Ga0157372_10379691 3300013307 Bacteria 1647
247 Ga0157372_10431458 3300013307 Bacteria 1536
248 Ga0157372_11220442 3300013307 Bacteria 869
249 Ga0157372_12103677 3300013307 Bacteria 648
250 Ga0157375_10123420 3300013308 Bacteria 2702
251 Ga0157375_11586263 3300013308 Bacteria 774
252 Ga0157375_11728614 3300013308 Bacteria 741
253 Ga0163163_10227938 3300014325 Bacteria 1912
254 Ga0163163_10956102 3300014325 Bacteria 920
255 Ga0157380_12648270 3300014326 Bacteria 568
256 Ga0157377_10172911 3300014745 Bacteria 1352
257 Ga0157379_10100287 3300014968 Bacteria 2599
258 Ga0157376_10053115 3300014969 Bacteria 3372
259 Ga0157376_12071827 3300014969 Bacteria 607
260 Ga0209026_1003463 3300025250 Bacteria 5157
261 Ga0209148_1000147 3300025254 Bacteria 160231
262 Ga0209148_1002428 3300025254 Bacteria 6428
263 Ga0209233_1000003 3300025261 Bacteria 1607366
264 Ga0209455_1000707 3300025272 Bacteria 19438
265 Ga0209455_1048315 3300025272 Bacteria 609
266 Ga0207697_10063527 3300025315 Bacteria 1539
267 Ga0207697_10111110 3300025315 Bacteria 1173
268 Ga0207697_10406936 3300025315 Bacteria 604
269 Ga0207656_10006606 3300025321 Bacteria 4184
270 Ga0207656_10045322 3300025321 Bacteria 1882
271 Ga0207656_10286700 3300025321 Bacteria 813
272 Ga0207656_10334602 3300025321 Bacteria 754
273 Ga0207642_10215243 3300025899 Bacteria 1070
274 Ga0207688_10094932 3300025901 Bacteria 1716
275 Ga0207688_10388288 3300025901 Bacteria 864
276 Ga0207680_10001410 3300025903 Bacteria 11373
277 Ga0207680_10028087 3300025903 Bacteria 3143
278 Ga0207647_10000389 3300025904 Bacteria 35906
279 Ga0207647_10036599 3300025904 Bacteria 3118
280 Ga0207647_10040305 3300025904 Bacteria 2943
281 Ga0207647_10041178 3300025904 Bacteria 2906
282 Ga0207647_10099232 3300025904 Bacteria 1730
283 Ga0207647_10136122 3300025904 Bacteria 1441
284 Ga0207647_10238899 3300025904 Bacteria 1044
285 Ga0207647_10314069 3300025904 Bacteria 891
286 Ga0207645_11154264 3300025907 Bacteria 521
287 Ga0207705_10000042 3300025909 Bacteria 182120
288 Ga0207705_10000190 3300025909 Bacteria 62546
289 Ga0207705_10000236 3300025909 Bacteria 54788
290 Ga0207705_10025910 3300025909 Bacteria 4185
291 Ga0207705_10031773 3300025909 Bacteria 3770
292 Ga0207705_10051142 3300025909 Bacteria 2974
293 Ga0207705_10066088 3300025909 Bacteria 2615
294 Ga0207705_10099013 3300025909 Bacteria 2143
295 Ga0207705_10778554 3300025909 Bacteria 743
296 Ga0207705_11085188 3300025909 Bacteria 617
297 Ga0207654_10129120 3300025911 Bacteria 1597
298 Ga0207654_10400388 3300025911 Bacteria 954
299 Ga0207707_10085195 3300025912 Bacteria 2761
300 Ga0207695_10430693 3300025913 Bacteria 1203
301 Ga0207695_10442927 3300025913 Bacteria 1182
302 Ga0207695_10465647 3300025913 Bacteria 1147
303 Ga0207695_10789810 3300025913 Bacteria 829
304 Ga0207660_10000438 3300025917 Bacteria 27496
305 Ga0207660_10000522 3300025917 Bacteria 25663
306 Ga0207660_10102050 3300025917 Bacteria 2144
307 Ga0207660_10752164 3300025917 Unclassified 795
308 Ga0207662_10432312 3300025918 Bacteria 897
309 Ga0207657_10000407 3300025919 Bacteria 45521
310 Ga0207657_10000837 3300025919 Bacteria 32516
311 Ga0207657_10000900 3300025919 Bacteria 31430
312 Ga0207657_10002570 3300025919 Bacteria 19633
313 Ga0207657_10018127 3300025919 Bacteria 6735
314 Ga0207657_10020043 3300025919 Bacteria 6334
315 Ga0207657_10039196 3300025919 Bacteria 4212
316 Ga0207657_10083525 3300025919 Bacteria 2679
317 Ga0207657_10097055 3300025919 Bacteria 2451
318 Ga0207657_10223823 3300025919 Bacteria 1506
319 Ga0207657_10233197 3300025919 Bacteria 1471
320 Ga0207657_10282996 3300025919 Bacteria 1316
321 Ga0207657_11338154 3300025919 Bacteria 540
322 Ga0207649_10083466 3300025920 Bacteria 2074
323 Ga0207649_10258583 3300025920 Bacteria 1257
324 Ga0207649_10450870 3300025920 Bacteria 971
325 Ga0207649_11589476 3300025920 Bacteria 517
326 Ga0207652_10220558 3300025921 Bacteria 1709
327 Ga0207694_10154179 3300025924 Bacteria 1852
328 Ga0207694_10188064 3300025924 Bacteria 1677
329 Ga0207694_10653280 3300025924 Bacteria 886
330 Ga0207650_10056039 3300025925 Bacteria 2928
331 Ga0207650_10297939 3300025925 Bacteria 1316
332 Ga0207659_10011390 3300025926 Bacteria 5616
333 Ga0207659_11303820 3300025926 Bacteria 623
334 Ga0207687_10077386 3300025927 Bacteria 2392
335 Ga0207664_10765907 3300025929 Bacteria 868
336 Ga0207644_10000035 3300025931 Bacteria 131979
337 Ga0207644_10000243 3300025931 Bacteria 37412
338 Ga0207644_10031405 3300025931 Bacteria 3700
339 Ga0207644_10083461 3300025931 Bacteria 2366
340 Ga0207644_11605169 3300025931 Bacteria 545
341 Ga0207690_10017235 3300025932 Bacteria 4407
342 Ga0207690_10026346 3300025932 Bacteria 3660
343 Ga0207690_10076381 3300025932 Bacteria 2326
344 Ga0207690_10079099 3300025932 Bacteria 2290
345 Ga0207690_10187820 3300025932 Bacteria 1561
346 Ga0207690_10432011 3300025932 Bacteria 1055
347 Ga0207690_10890155 3300025932 Bacteria 738
348 Ga0207690_10937505 3300025932 Bacteria 719
349 Ga0207690_10970573 3300025932 Bacteria 706
350 Ga0207690_11056963 3300025932 Bacteria 676
351 Ga0207706_10020396 3300025933 Bacteria 5959
352 Ga0207706_10059624 3300025933 Bacteria 3360
353 Ga0207706_10646928 3300025933 Bacteria 906
354 Ga0207706_11186055 3300025933 Bacteria 635
355 Ga0207706_11736789 3300025933 Bacteria 501
356 Ga0207686_10261038 3300025934 Bacteria 1270
357 Ga0207709_10247551 3300025935 Bacteria 1300
358 Ga0207709_10700947 3300025935 Bacteria 810
359 Ga0207670_10152951 3300025936 Bacteria 1714
360 Ga0207670_11257025 3300025936 Bacteria 627
361 Ga0207669_10003142 3300025937 Bacteria 7123
362 Ga0207669_10038189 3300025937 Bacteria 2762
363 Ga0207704_10087688 3300025938 Bacteria 2033
364 Ga0207691_10023185 3300025940 Bacteria 5845
365 Ga0207691_10130402 3300025940 Bacteria 2221
366 Ga0207691_11340474 3300025940 Bacteria 590
367 Ga0207711_10083245 3300025941 Bacteria 2798
368 Ga0207679_10380275 3300025945 Bacteria 1238
369 Ga0207679_11275308 3300025945 Bacteria 674
370 Ga0207667_10000017 3300025949 Bacteria 390654
371 Ga0207667_10001479 3300025949 Bacteria 29480
372 Ga0207667_10017260 3300025949 Bacteria 8130
373 Ga0207667_10059444 3300025949 Bacteria 4003
374 Ga0207667_10825763 3300025949 Bacteria 922
375 Ga0207667_11330699 3300025949 Unclassified 694
376 Ga0207651_10000201 3300025960 Bacteria 26086
377 Ga0207651_11164489 3300025960 Bacteria 692
378 Ga0207712_10533105 3300025961 Bacteria 1008
379 Ga0207668_10000147 3300025972 Bacteria 48279
380 Ga0207640_10000695 3300025981 Bacteria 19606
381 Ga0207640_10043181 3300025981 Bacteria 2880
382 Ga0207640_10071428 3300025981 Bacteria 2338
383 Ga0207658_10038221 3300025986 Bacteria 3455
384 Ga0207658_10494441 3300025986 Bacteria 1089
385 Ga0207658_11166533 3300025986 Bacteria 704
386 Ga0207677_10000529 3300026023 Bacteria 24143
387 Ga0207677_11712686 3300026023 Bacteria 583
388 Ga0207703_10010627 3300026035 Bacteria 7191
389 Ga0207703_12397499 3300026035 Bacteria 503
390 Ga0207639_10004222 3300026041 Bacteria 9682
391 Ga0207639_10084827 3300026041 Bacteria 2517
392 Ga0207639_10108095 3300026041 Bacteria 2261
393 Ga0207639_10393508 3300026041 Bacteria 1247
394 Ga0207639_11200294 3300026041 Bacteria 712
395 Ga0207639_12005662 3300026041 Bacteria 540
396 Ga0207678_10031342 3300026067 Bacteria 4638
397 Ga0207678_10033366 3300026067 Bacteria 4485
398 Ga0207678_10130693 3300026067 Bacteria 2142
399 Ga0207678_10684054 3300026067 Bacteria 902
400 Ga0207702_10029627 3300026078 Bacteria 4556
401 Ga0207702_10039551 3300026078 Bacteria 3952
402 Ga0207702_10047060 3300026078 Bacteria 3633
403 Ga0207702_10129064 3300026078 Bacteria 2273
404 Ga0207702_11983711 3300026078 Bacteria 573
405 Ga0207641_10000039 3300026088 Bacteria 199453
406 Ga0207641_10006115 3300026088 Bacteria 10188
407 Ga0207648_10002999 3300026089 Bacteria 17838
408 Ga0207676_10012915 3300026095 Bacteria 5998
409 Ga0207676_12503279 3300026095 Bacteria 513
410 Ga0207674_10002528 3300026116 Bacteria 23055
411 Ga0207674_10006868 3300026116 Bacteria 13343
412 Ga0207675_101624108 3300026118 Bacteria 667
413 Ga0207683_10005838 3300026121 Bacteria 10554
414 Ga0207683_10015611 3300026121 Bacteria 6464
415 Ga0207683_11276747 3300026121 Bacteria 680
416 Ga0207698_10013037 3300026142 Bacteria 5469
417 Ga0207698_10037299 3300026142 Bacteria 3578
418 Ga0207698_11258509 3300026142 Bacteria 754
419 Ga0207698_11534602 3300026142 Bacteria 681
420 Ga0207698_11881960 3300026142 Unclassified 613
421 Ga0207698_12398835 3300026142 Unclassified 539
422 Ga0268266_10050799 3300028379 Bacteria 3558
423 Ga0268266_10114108 3300028379 Bacteria 2397
424 Ga0268266_10372165 3300028379 Bacteria 1346
425 Ga0268265_11575593 3300028380 Unclassified 661
426 Ga0268264_10019471 3300028381 Bacteria 5545
427 Ga0268264_10037320 3300028381 Bacteria 4006
428 Ga0268264_10611282 3300028381 Bacteria 1075
429 Ga0307408_100040343 3300031548 Bacteria 3305
430 Ga0307408_100047429 3300031548 Bacteria 3077
431 Ga0307408_100397364 3300031548 Bacteria 1183
432 Ga0307408_100461846 3300031548 Bacteria 1103
433 Ga0307408_101484831 3300031548 Bacteria 640
434 Ga0307405_10100468 3300031731 Bacteria 1939
435 Ga0307405_10139409 3300031731 Bacteria 1688
436 Ga0307405_10309673 3300031731 Bacteria 1201
437 Ga0307405_10385830 3300031731 Bacteria 1092
438 Ga0307405_10396931 3300031731 Bacteria 1078
439 Ga0307405_10821181 3300031731 Bacteria 780
440 Ga0307405_11208982 3300031731 Bacteria 654
441 Ga0307405_11380424 3300031731 Bacteria 615
442 Ga0307405_11394649 3300031731 Bacteria 612
443 Ga0307413_10048332 3300031824 Bacteria 2542
444 Ga0307413_10135903 3300031824 Bacteria 1690
445 Ga0307413_10141851 3300031824 Bacteria 1661
446 Ga0307413_10287008 3300031824 Bacteria 1241
447 Ga0307413_10545541 3300031824 Bacteria 939
448 Ga0307413_10982486 3300031824 Bacteria 722
449 Ga0307413_11874966 3300031824 Bacteria 538
450 Ga0307410_10093803 3300031852 Bacteria 2136
451 Ga0307410_10098476 3300031852 Bacteria 2091
452 Ga0307410_10161486 3300031852 Bacteria 1679
453 Ga0307410_10177137 3300031852 Bacteria 1611
454 Ga0307410_10190679 3300031852 Bacteria 1558
455 Ga0307410_10197305 3300031852 Bacteria 1534
456 Ga0307410_10396561 3300031852 Bacteria 1114
457 Ga0307410_11539038 3300031852 Bacteria 586
458 Ga0307406_10043181 3300031901 Bacteria 2818
459 Ga0307406_10045476 3300031901 Bacteria 2756
460 Ga0307406_10130569 3300031901 Bacteria 1763
461 Ga0307406_10233323 3300031901 Bacteria 1375
462 Ga0307406_10334114 3300031901 Bacteria 1177
463 Ga0307406_10388564 3300031901 Bacteria 1102
464 Ga0307406_10804482 3300031901 Bacteria 793
465 Ga0307407_10028847 3300031903 Bacteria 2972
466 Ga0307407_10056215 3300031903 Bacteria 2277
467 Ga0307407_10409771 3300031903 Bacteria 974
468 Ga0307407_10685584 3300031903 Bacteria 770
469 Ga0307412_10063834 3300031911 Bacteria 2486
470 Ga0307412_10340962 3300031911 Bacteria 1199
471 Ga0307412_10388726 3300031911 Bacteria 1132
472 Ga0307412_10454055 3300031911 Bacteria 1056
473 Ga0307412_11499563 3300031911 Bacteria 613
474 Ga0307412_11567756 3300031911 Bacteria 600
475 Ga0307412_11833187 3300031911 Bacteria 558
476 Ga0307409_100047977 3300031995 Bacteria 3246
477 Ga0307409_100151387 3300031995 Bacteria 2014
478 Ga0307409_100323434 3300031995 Bacteria 1444
479 Ga0307409_100428078 3300031995 Bacteria 1271
480 Ga0307409_100863326 3300031995 Bacteria 916
481 Ga0307409_101478518 3300031995 Bacteria 706
482 Ga0307416_100147272 3300032002 Bacteria 2152
483 Ga0307416_100320559 3300032002 Bacteria 1551
484 Ga0307416_100470966 3300032002 Bacteria 1314
485 Ga0307416_100521463 3300032002 Bacteria 1256
486 Ga0307416_101291646 3300032002 Bacteria 836
487 Ga0307416_102075588 3300032002 Bacteria 670
488 Ga0307416_102630846 3300032002 Bacteria 600
489 Ga0307414_10024487 3300032004 Bacteria 3850
490 Ga0307414_10313180 3300032004 Bacteria 1333
491 Ga0307414_10704404 3300032004 Bacteria 914
492 Ga0307414_10747555 3300032004 Bacteria 888
493 Ga0307414_11103828 3300032004 Bacteria 732
494 Ga0307411_10029635 3300032005 Bacteria 3345
495 Ga0307411_10127685 3300032005 Bacteria 1852
496 Ga0307411_10282885 3300032005 Bacteria 1321
497 Ga0307411_10309089 3300032005 Bacteria 1271
498 Ga0307411_10318070 3300032005 Bacteria 1255
499 Ga0307411_10374777 3300032005 Bacteria 1168
500 Ga0307411_10515049 3300032005 Bacteria 1014
501 Ga0307411_10532184 3300032005 Bacteria 999
502 Ga0307415_100034992 3300032126 Bacteria 3276
503 Ga0307415_100094767 3300032126 Bacteria 2171
504 Ga0307415_100153146 3300032126 Bacteria 1777
505 Ga0307415_100242574 3300032126 Bacteria 1458
506 Ga0307415_100444212 3300032126 Bacteria 1119
507 Ga0307415_101351882 3300032126 Bacteria 676
508 Ga0373941_0242527 3300035115 Unclassified 701
509 Ga0373960_0132326 3300035121 Bacteria 838
510 Ga0373962_0166696 3300035242 Bacteria 729
511 Ga0373931_0007668 3300035691 Bacteria 5092
512 Ga0395899_0000737 3300037312 Bacteria 32666
513 Ga0395899_0006708 3300037312 Bacteria 8921
514 Ga0395899_0090094 3300037312 Bacteria 2224
515 Ga0395899_0117922 3300037312 Bacteria 1903
516 Ga0395899_0302023 3300037312 Bacteria 1083
517 Ga0395899_0324456 3300037312 Bacteria 1036
518 Ga0395900_0000364 3300037418 Bacteria 65068
519 Ga0395900_0103263 3300037418 Bacteria 2928
520 Ga0395900_0116787 3300037418 Bacteria 2738
521 Ga0395900_0222354 3300037418 Bacteria 1902
522 Ga0395900_0237224 3300037418 Bacteria 1831
523 Ga0395900_0312391 3300037418 Bacteria 1554
524 Ga0395900_0337512 3300037418 Bacteria 1483
525 Ga0395900_0424485 3300037418 Bacteria 1290
526 Ga0395900_0604202 3300037418 Bacteria 1037
527 Ga0395900_1542533 3300037418 Unclassified 576
528 Ga0395898_0019963 3300037466 Bacteria 6814
529 Ga0395898_0037743 3300037466 Bacteria 4790
530 Ga0395898_0054496 3300037466 Bacteria 3902
531 Ga0395898_0152477 3300037466 Bacteria 2211
532 Ga0395898_0437046 3300037466 Bacteria 1247
533 Ga0395898_0479076 3300037466 Bacteria 1184
534 Ga0395905_0004090 3300037471 Bacteria 15281
535 Ga0395905_0069318 3300037471 Bacteria 3303
536 Ga0395905_0085211 3300037471 Bacteria 2961
537 Ga0395905_0105843 3300037471 Bacteria 2641
538 Ga0395905_0191865 3300037471 Bacteria 1916
539 Ga0395905_0266828 3300037471 Bacteria 1597
540 Ga0395905_0465051 3300037471 Bacteria 1163
541 Ga0395905_0528357 3300037471 Bacteria 1080
542 Ga0395905_0705636 3300037471 Bacteria 911
543 Ga0395901_0000209 3300038443 Bacteria 73635
544 Ga0395901_0041174 3300038443 Bacteria 4786
545 Ga0395901_0061759 3300038443 Bacteria 3899
546 Ga0395901_0183756 3300038443 Bacteria 2193
547 Ga0395901_0194923 3300038443 Bacteria 2124
548 Ga0395901_0202798 3300038443 Bacteria 2079
549 Ga0395901_0292981 3300038443 Bacteria 1688
550 Ga0395901_0789351 3300038443 Bacteria 939
551 Ga0395901_0812363 3300038443 Unclassified 923
552 Ga0451853_1622396 3300041512 Bacteria 877
553 Ga0451853_2233164 3300041512 Bacteria 795
554 Ga0439445_0056267 3300042004 Bacteria 1069
555 Ga0439448_0000627 3300042005 Bacteria 8335
556 Ga0439455_0006710 3300042012 Bacteria 2402
557 Ga0439455_0019716 3300042012 Bacteria 1592
558 Ga0450923_039052 3300042125 Bacteria 992
559 Ga0439458_0000006 3300042157 Bacteria 32402
560 Ga0439458_0013505 3300042157 Bacteria 1837
561 Ga0466969_0068840 3300044656 Bacteria 1705
562 Ga0466966_0029842 3300044684 Bacteria 3545
563 Ga0466966_0282546 3300044684 Bacteria 998
564 Ga0466961_0003923 3300044693 Bacteria 9306
565 Ga0466961_0398464 3300044693 Bacteria 835
566 Ga0466961_0648078 3300044693 Bacteria 634
567 Ga0466963_0015928 3300044694 Bacteria 4667
568 Ga0466963_0029255 3300044694 Bacteria 3544
569 Ga0466963_0155247 3300044694 Bacteria 1591
570 Ga0466963_0284246 3300044694 Bacteria 1163
571 Ga0466963_0323865 3300044694 Bacteria 1085
572 Ga0466971_0019587 3300044719 Bacteria 3006
573 Ga0466971_0081863 3300044719 Bacteria 1473
574 Ga0466968_0407919 3300044735 Bacteria 667
575 Ga0466968_0577836 3300044735 Bacteria 566
576 Ga0466970_0312759 3300044765 Bacteria 887
577 Ga0466957_0083970 3300044842 Bacteria 1987
578 Ga0466957_0298965 3300044842 Bacteria 1081
579 Ga0466957_1324379 3300044842 Bacteria 523
580 Ga0466959_0102969 3300045049 Bacteria 2043
581 Ga0466959_0164656 3300045049 Bacteria 1557
582 Ga0466959_0811545 3300045049 Bacteria 625
583 Ga0466958_0021712 3300045836 Bacteria 3754
584 Ga0466958_0522665 3300045836 Bacteria 770
585 Ga0466958_1018360 3300045836 Unclassified 540
586 Ga0466967_0063010 3300045976 Bacteria 3293
587 Ga0466967_0147134 3300045976 Bacteria 2198
588 Ga0466967_0284433 3300045976 Bacteria 1587
589 Ga0466967_0331006 3300045976 Bacteria 1471
590 Ga0466967_0453447 3300045976 Bacteria 1254
591 Ga0466967_1040800 3300045976 Bacteria 815
592 Ga0466967_1139225 3300045976 Bacteria 777
593 Ga0466967_1319082 3300045976 Bacteria 719
594 Ga0495606_0230352 3300046507 Bacteria 1039
595 Ga0495620_0061502 3300046515 Bacteria 1562
596 Ga0495620_0159926 3300046515 Bacteria 875
597 Ga0495642_0049369 3300046528 Bacteria 1728
598 Ga0495625_0162784 3300046660 Bacteria 1493
599 Ga0495669_0009712 3300046684 Bacteria 4060
600 Ga0495669_0409371 3300046684 Bacteria 657
601 Ga0496100_0001319 3300048903 Bacteria 12124
602 Ga0496100_0018297 3300048903 Bacteria 4154
603 Ga0496100_1080378 3300048903 Bacteria 632
604 Ga0496101_0000256 3300048904 Bacteria 37912
605 Ga0496102_0006759 3300048905 Bacteria 9793
606 Ga0496102_0468227 3300048905 Bacteria 1181
607 Ga0496103_0113653 3300048906 Bacteria 1721
608 Ga0496104_0022966 3300048907 Bacteria 5733
609 Ga0496104_1449284 3300048907 Bacteria 590
610 Ga0496105_0038015 3300048908 Bacteria 3965
611 Ga0496106_0011259 3300048909 Bacteria 6620
612 Ga0496107_0000623 3300048910 Bacteria 19871
613 Ga0496107_0836365 3300048910 Bacteria 673
614 Ga0496108_0000673 3300048911 Bacteria 26408
615 Ga0496109_1015345 3300048912 Bacteria 767
616 Ga0496111_0000247 3300048914 Bacteria 25998
617 Ga0496111_0597522 3300048914 Bacteria 808
618 Ga0496112_0000369 3300048915 Bacteria 29388
619 Ga0496112_0061660 3300048915 Bacteria 3698
620 Ga0496112_0795083 3300048915 Bacteria 871
621 Ga0496113_0000242 3300048916 Bacteria 25756
622 Ga0496113_1025725 3300048916 Bacteria 649
623 Ga0496114_0358866 3300048917 Bacteria 1289
624 Ga0496114_0525480 3300048917 Bacteria 1046
625 Ga0496115_0002137 3300048918 Bacteria 14132
626 Ga0496115_0903018 3300048918 Bacteria 681
627 Ga0496126_0093822 3300048929 Bacteria 2635
628 Ga0501034_1418953 3300049571 Bacteria 569
629 Ga0501036_0209588 3300049572 Bacteria 1638
630 Ga0501038_0226703 3300049574 Bacteria 1489
631 Ga0501046_0350006 3300049580 Bacteria 1073
632 Ga0501235_161766 3300049669 Bacteria 586
633 Ga0501248_039577 3300049678 Bacteria 572
634 Ga0501253_028165 3300049683 Bacteria 1050
635 Ga0501261_132299 3300049690 Unclassified 504
636 Ga0501268_009695 3300049765 Bacteria 1484
637 Ga0501268_104240 3300049765 Bacteria 611
638 Ga0501268_125088 3300049765 Bacteria 573
639 Ga0501204_051317 3300049850 Bacteria 633
640 Ga0500577_0013766 3300053142 Bacteria 2481
641 Ga0466962_0021183 3300061719 Bacteria 3122
642 Ga0466962_0219004 3300061719 Bacteria 932
643 Ga0530510_0760299 3300061734 Bacteria 739

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006237 Ga0097621_100955552 Ga0097621_1009555521 71
2 3300053142 Ga0500577_0013766 Ga0500577_0013766_908_1201 71
3 3300005616 Ga0068852_100414295 Ga0068852_1004142952 72
4 3300009093 Ga0105240_11479079 Ga0105240_114790792 72
5 3300009551 Ga0105238_10213649 Ga0105238_102136493 72
6 3300013105 Ga0157369_10981418 Ga0157369_109814182 72
7 3300026041 Ga0207639_11200294 Ga0207639_112002942 72
8 3300026142 Ga0207698_11258509 Ga0207698_112585092 72
9 3300025924 Ga0207694_10653280 Ga0207694_106532802 73
10 3300001915 JGI24741J21665_1009690 JGI24741J21665_10096902 74
11 3300001979 JGI24740J21852_10043130 JGI24740J21852_100431302 74
12 3300001989 JGI24739J22299_10151468 JGI24739J22299_101514682 74
13 3300001990 JGI24737J22298_10057625 JGI24737J22298_100576252 74
14 3300002075 JGI24738J21930_10001440 JGI24738J21930_100014402 74
15 3300005327 Ga0070658_10491993 Ga0070658_104919932 74
16 3300005339 Ga0070660_101356752 Ga0070660_1013567522 74
17 3300005455 Ga0070663_100004783 Ga0070663_1000047839 74
18 3300005539 Ga0068853_100014991 Ga0068853_1000149912 74
19 3300005563 Ga0068855_100001164 Ga0068855_10000116429 74
20 3300005578 Ga0068854_100003204 Ga0068854_1000032049 74
21 3300005834 Ga0068851_10170800 Ga0068851_101708002 74
22 3300006237 Ga0097621_100013189 Ga0097621_1000131892 74
23 3300006358 Ga0068871_100508967 Ga0068871_1005089672 74
24 3300009174 Ga0105241_10407683 Ga0105241_104076832 74
25 3300009551 Ga0105238_10115889 Ga0105238_101158892 74
26 3300010375 Ga0105239_10823445 Ga0105239_108234451 74
27 3300013100 Ga0157373_10039126 Ga0157373_100391264 74
28 3300013296 Ga0157374_10332629 Ga0157374_103326292 74
29 3300013307 Ga0157372_10093707 Ga0157372_100937075 74
30 3300025321 Ga0207656_10286700 Ga0207656_102867002 74
31 3300025909 Ga0207705_11085188 Ga0207705_110851882 74
32 3300025911 Ga0207654_10129120 Ga0207654_101291202 74
33 3300025919 Ga0207657_10223823 Ga0207657_102238232 74
34 3300025919 Ga0207657_11338154 Ga0207657_113381542 74
35 3300025949 Ga0207667_10000017 Ga0207667_10000017289 74
36 3300025981 Ga0207640_10000695 Ga0207640_1000069515 74
37 3300025981 Ga0207640_10043181 Ga0207640_100431813 74
38 3300026041 Ga0207639_10004222 Ga0207639_100042226 74
39 3300026067 Ga0207678_10033366 Ga0207678_100333664 74
40 3300037471 Ga0395905_0465051 Ga0395905_0465051_204_506 74
41 3300044693 Ga0466961_0648078 Ga0466961_0648078_182_484 74
42 3300044842 Ga0466957_0298965 Ga0466957_0298965_507_809 74
43 3300045976 Ga0466967_0453447 Ga0466967_0453447_191_493 74
44 3300048903 Ga0496100_1080378 Ga0496100_1080378_269_571 74
45 3300048905 Ga0496102_0468227 Ga0496102_0468227_530_832 74
46 3300002067 JGI24735J21928_10047889 JGI24735J21928_100478892 75
47 3300002067 JGI24735J21928_10210420 JGI24735J21928_102104201 75
48 3300005617 Ga0068859_100025222 Ga0068859_1000252223 75
49 3300006931 Ga0097620_100025222 Ga0097620_1000252227 75
50 3300025904 Ga0207647_10238899 Ga0207647_102388991 75
51 3300041512 Ga0451853_2233164 Ga0451853_2233164_406_702 75
52 3300044735 Ga0466968_0407919 Ga0466968_0407919_135_437 75
53 3300049580 Ga0501046_0350006 Ga0501046_0350006_464_763 75
54 3300005327 Ga0070658_11026774 Ga0070658_110267742 76
55 3300014326 Ga0157380_12648270 Ga0157380_126482702 76
56 3300025909 Ga0207705_10778554 Ga0207705_107785542 76
57 3300037418 Ga0395900_0337512 Ga0395900_0337512_112_414 76
58 3300009551 Ga0105238_11322918 Ga0105238_113229182 77
59 3300025315 Ga0207697_10111110 Ga0207697_101111101 77
60 3300005327 Ga0070658_10050893 Ga0070658_100508932 78
61 3300025909 Ga0207705_10099013 Ga0207705_100990132 78
62 3300037418 Ga0395900_1542533 Ga0395900_1542533_188_487 78
63 3300037471 Ga0395905_0191865 Ga0395905_0191865_1190_1489 78
64 3300042004 Ga0439445_0056267 Ga0439445_0056267_267_548 78
65 3300042125 Ga0450923_039052 Ga0450923_039052_577_858 78
66 3300061734 Ga0530510_0760299 Ga0530510_0760299_271_570 78
67 3300005335 Ga0070666_10043239 Ga0070666_100432392 81
68 3300005338 Ga0068868_101970044 Ga0068868_1019700442 81
69 3300005354 Ga0070675_100635906 Ga0070675_1006359062 81
70 3300005355 Ga0070671_100037988 Ga0070671_1000379884 81
71 3300005356 Ga0070674_100058710 Ga0070674_1000587103 81
72 3300005364 Ga0070673_101740011 Ga0070673_1017400112 81
73 3300009148 Ga0105243_10556538 Ga0105243_105565382 81
74 3300011119 Ga0105246_10823511 Ga0105246_108235111 81
75 3300013100 Ga0157373_10185883 Ga0157373_101858832 81
76 3300025315 Ga0207697_10406936 Ga0207697_104069362 81
77 3300025901 Ga0207688_10388288 Ga0207688_103882882 81
78 3300025903 Ga0207680_10028087 Ga0207680_100280873 81
79 3300025931 Ga0207644_10031405 Ga0207644_100314054 81
80 3300025933 Ga0207706_10059624 Ga0207706_100596243 81
81 3300025937 Ga0207669_10038189 Ga0207669_100381893 81
82 3300025940 Ga0207691_11340474 Ga0207691_113404741 81
83 3300025986 Ga0207658_10494441 Ga0207658_104944412 81
84 3300026023 Ga0207677_11712686 Ga0207677_117126862 81
85 3300026118 Ga0207675_101624108 Ga0207675_1016241082 81
86 3300026121 Ga0207683_11276747 Ga0207683_112767472 81
87 iso_pu_bacteria 2896429255 2896431682 81
88 3300002067 JGI24735J21928_10002241 JGI24735J21928_100022413 82
89 3300002067 JGI24735J21928_10091729 JGI24735J21928_100917292 82
90 3300002075 JGI24738J21930_10041125 JGI24738J21930_100411252 82
91 3300003763 Ga0055529_1005922 Ga0055529_10059223 82
92 3300005327 Ga0070658_10007308 Ga0070658_100073087 82
93 3300005331 Ga0070670_100466547 Ga0070670_1004665472 82
94 3300005339 Ga0070660_100036201 Ga0070660_1000362013 82
95 3300005347 Ga0070668_100000009 Ga0070668_10000000925 82
96 3300005355 Ga0070671_100000098 Ga0070671_10000009819 82
97 3300005539 Ga0068853_101568583 Ga0068853_1015685832 82
98 3300005547 Ga0070693_101347580 Ga0070693_1013475802 82
99 3300005548 Ga0070665_100154914 Ga0070665_1001549143 82
100 3300005617 Ga0068859_100060239 Ga0068859_1000602392 82
101 3300005841 Ga0068863_100000040 Ga0068863_10000004025 82
102 3300005843 Ga0068860_100246295 Ga0068860_1002462952 82
103 3300005844 Ga0068862_100026335 Ga0068862_1000263352 82
104 3300006931 Ga0097620_100060239 Ga0097620_1000602392 82
105 3300009551 Ga0105238_10212626 Ga0105238_102126262 82
106 3300009551 Ga0105238_11166722 Ga0105238_111667222 82
107 3300009553 Ga0105249_10001735 Ga0105249_1000173513 82
108 3300013307 Ga0157372_10346343 Ga0157372_103463433 82
109 3300025254 Ga0209148_1002428 Ga0209148_10024282 82
110 3300025272 Ga0209455_1000707 Ga0209455_10007077 82
111 3300025904 Ga0207647_10000389 Ga0207647_1000038920 82
112 3300025904 Ga0207647_10040305 Ga0207647_100403053 82
113 3300025909 Ga0207705_10025910 Ga0207705_100259105 82
114 3300025919 Ga0207657_10233197 Ga0207657_102331972 82
115 3300025924 Ga0207694_10154179 Ga0207694_101541792 82
116 3300025925 Ga0207650_10297939 Ga0207650_102979392 82
117 3300025931 Ga0207644_10000035 Ga0207644_1000003525 82
118 3300025932 Ga0207690_10937505 Ga0207690_109375052 82
119 3300025932 Ga0207690_11056963 Ga0207690_110569631 82
120 3300025961 Ga0207712_10533105 Ga0207712_105331052 82
121 3300025972 Ga0207668_10000147 Ga0207668_1000014711 82
122 3300026067 Ga0207678_10130693 Ga0207678_101306931 82
123 3300026088 Ga0207641_10000039 Ga0207641_10000039160 82
124 3300028379 Ga0268266_10114108 Ga0268266_101141083 82
125 3300028380 Ga0268265_11575593 Ga0268265_115755932 82
126 3300028381 Ga0268264_10037320 Ga0268264_100373203 82
127 3300037466 Ga0395898_0437046 Ga0395898_0437046_566_868 82
128 3300042012 Ga0439455_0006710 Ga0439455_0006710_624_926 82
129 3300042157 Ga0439458_0013505 Ga0439458_0013505_39_341 82
130 3300046515 Ga0495620_0159926 Ga0495620_0159926_381_704 82
131 3300005354 Ga0070675_101268679 Ga0070675_1012686792 83
132 3300005364 Ga0070673_101104519 Ga0070673_1011045191 83
133 3300005364 Ga0070673_101230150 Ga0070673_1012301501 83
134 3300005367 Ga0070667_100721756 Ga0070667_1007217562 83
135 3300005543 Ga0070672_101943151 Ga0070672_1019431511 83
136 3300005614 Ga0068856_100013426 Ga0068856_1000134266 83
137 3300005614 Ga0068856_100601597 Ga0068856_1006015972 83
138 3300005616 Ga0068852_102269602 Ga0068852_1022696021 83
139 3300005617 Ga0068859_101487985 Ga0068859_1014879852 83
140 3300005843 Ga0068860_100039460 Ga0068860_1000394602 83
141 3300006931 Ga0097620_101487880 Ga0097620_1014878802 83
142 3300009551 Ga0105238_10771949 Ga0105238_107719492 83
143 3300013102 Ga0157371_10466437 Ga0157371_104664372 83
144 3300013104 Ga0157370_10097405 Ga0157370_100974053 83
145 3300013104 Ga0157370_11370216 Ga0157370_113702162 83
146 3300013105 Ga0157369_10042284 Ga0157369_100422842 83
147 3300013105 Ga0157369_10224048 Ga0157369_102240482 83
148 3300013307 Ga0157372_10379691 Ga0157372_103796913 83
149 3300014969 Ga0157376_12071827 Ga0157376_120718272 83
150 3300025935 Ga0207709_10700947 Ga0207709_107009471 83
151 3300025936 Ga0207670_11257025 Ga0207670_112570252 83
152 3300025945 Ga0207679_11275308 Ga0207679_112753082 83
153 3300025949 Ga0207667_11330699 Ga0207667_113306992 83
154 3300025960 Ga0207651_11164489 Ga0207651_111644892 83
155 3300025986 Ga0207658_11166533 Ga0207658_111665332 83
156 3300026078 Ga0207702_10039551 Ga0207702_100395516 83
157 3300026142 Ga0207698_12398835 Ga0207698_123988352 83
158 3300028381 Ga0268264_10019471 Ga0268264_100194712 83
159 3300031731 Ga0307405_10100468 Ga0307405_101004683 83
160 3300031731 Ga0307405_11380424 Ga0307405_113804241 83
161 3300031824 Ga0307413_10287008 Ga0307413_102870082 83
162 3300031901 Ga0307406_10334114 Ga0307406_103341142 83
163 3300031995 Ga0307409_100047977 Ga0307409_1000479773 83
164 3300032005 Ga0307411_10309089 Ga0307411_103090892 83
165 3300037418 Ga0395900_0237224 Ga0395900_0237224_588_890 83
166 3300038443 Ga0395901_0202798 Ga0395901_0202798_1408_1710 83
167 3300041512 Ga0451853_1622396 Ga0451853_1622396_238_543 83
168 3300044842 Ga0466957_1324379 Ga0466957_1324379_108_404 83
169 3300045976 Ga0466967_1040800 Ga0466967_1040800_432_728 83
170 3300045976 Ga0466967_1319082 Ga0466967_1319082_402_698 83
171 3300046515 Ga0495620_0061502 Ga0495620_0061502_502_801 83
172 3300046528 Ga0495642_0049369 Ga0495642_0049369_468_764 83
173 3300046660 Ga0495625_0162784 Ga0495625_0162784_540_845 83
174 3300049572 Ga0501036_0209588 Ga0501036_0209588_715_1011 83
175 3300049574 Ga0501038_0226703 Ga0501038_0226703_618_914 83
176 3300049678 Ga0501248_039577 Ga0501248_039577_101_397 83
177 3300049690 Ga0501261_132299 Ga0501261_132299_148_444 83
178 3300049850 Ga0501204_051317 Ga0501204_051317_110_406 83
179 3300001904 JGI24736J21556_1059420 JGI24736J21556_10594202 84
180 3300001915 JGI24741J21665_1056114 JGI24741J21665_10561141 84
181 3300001979 JGI24740J21852_10094440 JGI24740J21852_100944402 84
182 3300001989 JGI24739J22299_10008673 JGI24739J22299_100086736 84
183 3300001989 JGI24739J22299_10055781 JGI24739J22299_100557812 84
184 3300001990 JGI24737J22298_10001243 JGI24737J22298_100012437 84
185 3300001991 JGI24743J22301_10059234 JGI24743J22301_100592342 84
186 3300002067 JGI24735J21928_10055269 JGI24735J21928_100552692 84
187 3300002067 JGI24735J21928_10136456 JGI24735J21928_101364562 84
188 3300002075 JGI24738J21930_10015042 JGI24738J21930_100150422 84
189 3300002077 JGI24744J21845_10007524 JGI24744J21845_100075242 84
190 3300002244 JGI24742J22300_10105622 JGI24742J22300_101056222 84
191 3300002741 JGI25157J39369_1013249 JGI25157J39369_10132492 84
192 3300003214 JGI25165J46597_1000040 JGI25165J46597_1000040107 84
193 3300003762 Ga0055542_1001654 Ga0055542_10016542 84
194 3300005293 Ga0065715_10512583 Ga0065715_105125832 84
195 3300005327 Ga0070658_10000022 Ga0070658_1000002287 84
196 3300005327 Ga0070658_10003723 Ga0070658_1000372313 84
197 3300005327 Ga0070658_10030124 Ga0070658_100301242 84
198 3300005327 Ga0070658_10057701 Ga0070658_100577015 84
199 3300005328 Ga0070676_10188562 Ga0070676_101885622 84
200 3300005329 Ga0070683_100157353 Ga0070683_1001573533 84
201 3300005329 Ga0070683_100775204 Ga0070683_1007752041 84
202 3300005330 Ga0070690_100007013 Ga0070690_1000070133 84
203 3300005330 Ga0070690_100846865 Ga0070690_1008468652 84
204 3300005331 Ga0070670_100053682 Ga0070670_1000536823 84
205 3300005333 Ga0070677_10521097 Ga0070677_105210972 84
206 3300005335 Ga0070666_10004292 Ga0070666_100042925 84
207 3300005336 Ga0070680_100000683 Ga0070680_10000068311 84
208 3300005336 Ga0070680_100005956 Ga0070680_1000059564 84
209 3300005336 Ga0070680_100111365 Ga0070680_1001113653 84
210 3300005337 Ga0070682_100022704 Ga0070682_1000227044 84
211 3300005338 Ga0068868_100128441 Ga0068868_1001284413 84
212 3300005339 Ga0070660_100000751 Ga0070660_10000075120 84
213 3300005339 Ga0070660_100009089 Ga0070660_1000090896 84
214 3300005339 Ga0070660_100058544 Ga0070660_1000585442 84
215 3300005339 Ga0070660_100059159 Ga0070660_1000591593 84
216 3300005339 Ga0070660_100087592 Ga0070660_1000875924 84
217 3300005339 Ga0070660_100142921 Ga0070660_1001429213 84
218 3300005339 Ga0070660_100204728 Ga0070660_1002047282 84
219 3300005339 Ga0070660_101229501 Ga0070660_1012295011 84
220 3300005340 Ga0070689_100191079 Ga0070689_1001910792 84
221 3300005343 Ga0070687_100449035 Ga0070687_1004490352 84
222 3300005344 Ga0070661_100092611 Ga0070661_1000926113 84
223 3300005344 Ga0070661_101732613 Ga0070661_1017326131 84
224 3300005345 Ga0070692_10500975 Ga0070692_105009752 84
225 3300005347 Ga0070668_101749405 Ga0070668_1017494051 84
226 3300005354 Ga0070675_100014931 Ga0070675_1000149312 84
227 3300005355 Ga0070671_100007591 Ga0070671_1000075918 84
228 3300005355 Ga0070671_100589986 Ga0070671_1005899862 84
229 3300005356 Ga0070674_100014374 Ga0070674_1000143747 84
230 3300005364 Ga0070673_100003346 Ga0070673_1000033466 84
231 3300005365 Ga0070688_100394290 Ga0070688_1003942902 84
232 3300005366 Ga0070659_100075326 Ga0070659_1000753263 84
233 3300005366 Ga0070659_100212273 Ga0070659_1002122733 84
234 3300005366 Ga0070659_100234456 Ga0070659_1002344562 84
235 3300005366 Ga0070659_100371804 Ga0070659_1003718042 84
236 3300005366 Ga0070659_101308496 Ga0070659_1013084961 84
237 3300005367 Ga0070667_100014991 Ga0070667_1000149913 84
238 3300005455 Ga0070663_100062771 Ga0070663_1000627712 84
239 3300005455 Ga0070663_100771104 Ga0070663_1007711041 84
240 3300005455 Ga0070663_101245291 Ga0070663_1012452911 84
241 3300005455 Ga0070663_101928583 Ga0070663_1019285831 84
242 3300005456 Ga0070678_100033684 Ga0070678_1000336842 84
243 3300005456 Ga0070678_100046037 Ga0070678_1000460373 84
244 3300005457 Ga0070662_100197093 Ga0070662_1001970932 84
245 3300005457 Ga0070662_101887963 Ga0070662_1018879631 84
246 3300005458 Ga0070681_10224690 Ga0070681_102246902 84
247 3300005459 Ga0068867_100002136 Ga0068867_1000021362 84
248 3300005530 Ga0070679_100211558 Ga0070679_1002115582 84
249 3300005530 Ga0070679_101060232 Ga0070679_1010602322 84
250 3300005530 Ga0070679_101509512 Ga0070679_1015095122 84
251 3300005535 Ga0070684_100021129 Ga0070684_1000211297 84
252 3300005539 Ga0068853_100039431 Ga0068853_1000394313 84
253 3300005539 Ga0068853_100142436 Ga0068853_1001424362 84
254 3300005539 Ga0068853_100399728 Ga0068853_1003997282 84
255 3300005543 Ga0070672_100011066 Ga0070672_1000110666 84
256 3300005543 Ga0070672_100086454 Ga0070672_1000864543 84
257 3300005544 Ga0070686_100147263 Ga0070686_1001472633 84
258 3300005544 Ga0070686_100168303 Ga0070686_1001683032 84
259 3300005547 Ga0070693_100311889 Ga0070693_1003118892 84
260 3300005548 Ga0070665_100222949 Ga0070665_1002229492 84
261 3300005548 Ga0070665_100556885 Ga0070665_1005568852 84
262 3300005563 Ga0068855_100074321 Ga0068855_1000743214 84
263 3300005563 Ga0068855_100135870 Ga0068855_1001358702 84
264 3300005563 Ga0068855_100381789 Ga0068855_1003817892 84
265 3300005563 Ga0068855_101106566 Ga0068855_1011065662 84
266 3300005577 Ga0068857_100043136 Ga0068857_1000431364 84
267 3300005577 Ga0068857_100058302 Ga0068857_1000583024 84
268 3300005578 Ga0068854_100107471 Ga0068854_1001074713 84
269 3300005578 Ga0068854_100875848 Ga0068854_1008758482 84
270 3300005614 Ga0068856_100015289 Ga0068856_1000152895 84
271 3300005614 Ga0068856_100124219 Ga0068856_1001242193 84
272 3300005614 Ga0068856_100169948 Ga0068856_1001699483 84
273 3300005614 Ga0068856_100834864 Ga0068856_1008348642 84
274 3300005614 Ga0068856_101022253 Ga0068856_1010222532 84
275 3300005614 Ga0068856_101803531 Ga0068856_1018035311 84
276 3300005616 Ga0068852_100045398 Ga0068852_1000453983 84
277 3300005616 Ga0068852_100104429 Ga0068852_1001044294 84
278 3300005617 Ga0068859_100028499 Ga0068859_1000284997 84
279 3300005617 Ga0068859_100282737 Ga0068859_1002827373 84
280 3300005618 Ga0068864_100091289 Ga0068864_1000912893 84
281 3300005718 Ga0068866_10009481 Ga0068866_100094816 84
282 3300005834 Ga0068851_10013745 Ga0068851_100137453 84
283 3300005834 Ga0068851_10076113 Ga0068851_100761132 84
284 3300005834 Ga0068851_10270961 Ga0068851_102709612 84
285 3300005834 Ga0068851_10671319 Ga0068851_106713191 84
286 3300005841 Ga0068863_100011841 Ga0068863_1000118417 84
287 3300005842 Ga0068858_100074689 Ga0068858_1000746893 84
288 3300005842 Ga0068858_100147612 Ga0068858_1001476123 84
289 3300005843 Ga0068860_100150631 Ga0068860_1001506313 84
290 3300005844 Ga0068862_101180886 Ga0068862_1011808862 84
291 3300005985 Ga0081539_10023429 Ga0081539_100234292 84
292 3300006237 Ga0097621_100001388 Ga0097621_1000013887 84
293 3300006358 Ga0068871_100002654 Ga0068871_10000265410 84
294 3300006881 Ga0068865_100001550 Ga0068865_1000015507 84
295 3300006931 Ga0097620_100028499 Ga0097620_1000284992 84
296 3300006931 Ga0097620_100282735 Ga0097620_1002827353 84
297 3300009093 Ga0105240_10195311 Ga0105240_101953112 84
298 3300009093 Ga0105240_10523701 Ga0105240_105237012 84
299 3300009093 Ga0105240_11016101 Ga0105240_110161012 84
300 3300009093 Ga0105240_11772168 Ga0105240_117721681 84
301 3300009098 Ga0105245_10006481 Ga0105245_1000648110 84
302 3300009101 Ga0105247_11284427 Ga0105247_112844272 84
303 3300009148 Ga0105243_10008878 Ga0105243_100088786 84
304 3300009174 Ga0105241_10411987 Ga0105241_104119872 84
305 3300009174 Ga0105241_12656254 Ga0105241_126562542 84
306 3300009176 Ga0105242_10468643 Ga0105242_104686432 84
307 3300009551 Ga0105238_10120121 Ga0105238_101201212 84
308 3300009551 Ga0105238_10654371 Ga0105238_106543712 84
309 3300010375 Ga0105239_10110863 Ga0105239_101108632 84
310 3300010375 Ga0105239_10223798 Ga0105239_102237983 84
311 3300011119 Ga0105246_11427634 Ga0105246_114276342 84
312 3300013100 Ga0157373_10089696 Ga0157373_100896963 84
313 3300013100 Ga0157373_10317179 Ga0157373_103171792 84
314 3300013102 Ga0157371_10038395 Ga0157371_100383954 84
315 3300013102 Ga0157371_10073063 Ga0157371_100730633 84
316 3300013102 Ga0157371_10729058 Ga0157371_107290582 84
317 3300013102 Ga0157371_11516260 Ga0157371_115162601 84
318 3300013104 Ga0157370_10000117 Ga0157370_1000011771 84
319 3300013104 Ga0157370_10152799 Ga0157370_101527994 84
320 3300013104 Ga0157370_11480549 Ga0157370_114805491 84
321 3300013105 Ga0157369_10014466 Ga0157369_100144668 84
322 3300013105 Ga0157369_10666497 Ga0157369_106664972 84
323 3300013105 Ga0157369_10945017 Ga0157369_109450172 84
324 3300013105 Ga0157369_11616413 Ga0157369_116164132 84
325 3300013296 Ga0157374_10062500 Ga0157374_100625002 84
326 3300013296 Ga0157374_10365541 Ga0157374_103655412 84
327 3300013296 Ga0157374_10694771 Ga0157374_106947712 84
328 3300013297 Ga0157378_10031009 Ga0157378_100310094 84
329 3300013306 Ga0163162_10148849 Ga0163162_101488492 84
330 3300013306 Ga0163162_10787967 Ga0163162_107879672 84
331 3300013307 Ga0157372_10431458 Ga0157372_104314582 84
332 3300013307 Ga0157372_11220442 Ga0157372_112204422 84
333 3300013307 Ga0157372_12103677 Ga0157372_121036771 84
334 3300013308 Ga0157375_10123420 Ga0157375_101234202 84
335 3300013308 Ga0157375_11586263 Ga0157375_115862631 84
336 3300013308 Ga0157375_11728614 Ga0157375_117286141 84
337 3300014325 Ga0163163_10227938 Ga0163163_102279383 84
338 3300014325 Ga0163163_10956102 Ga0163163_109561022 84
339 3300014745 Ga0157377_10172911 Ga0157377_101729112 84
340 3300014968 Ga0157379_10100287 Ga0157379_101002873 84
341 3300014969 Ga0157376_10053115 Ga0157376_100531153 84
342 3300025250 Ga0209026_1003463 Ga0209026_10034637 84
343 3300025254 Ga0209148_1000147 Ga0209148_1000147109 84
344 3300025261 Ga0209233_1000003 Ga0209233_1000003377 84
345 3300025272 Ga0209455_1048315 Ga0209455_10483151 84
346 3300025315 Ga0207697_10063527 Ga0207697_100635272 84
347 3300025321 Ga0207656_10006606 Ga0207656_100066062 84
348 3300025321 Ga0207656_10045322 Ga0207656_100453222 84
349 3300025321 Ga0207656_10334602 Ga0207656_103346022 84
350 3300025899 Ga0207642_10215243 Ga0207642_102152432 84
351 3300025901 Ga0207688_10094932 Ga0207688_100949322 84
352 3300025903 Ga0207680_10001410 Ga0207680_100014109 84
353 3300025904 Ga0207647_10036599 Ga0207647_100365993 84
354 3300025904 Ga0207647_10041178 Ga0207647_100411784 84
355 3300025904 Ga0207647_10136122 Ga0207647_101361222 84
356 3300025907 Ga0207645_11154264 Ga0207645_111542641 84
357 3300025909 Ga0207705_10000042 Ga0207705_1000004292 84
358 3300025909 Ga0207705_10000236 Ga0207705_1000023621 84
359 3300025909 Ga0207705_10031773 Ga0207705_100317734 84
360 3300025909 Ga0207705_10066088 Ga0207705_100660883 84
361 3300025911 Ga0207654_10400388 Ga0207654_104003882 84
362 3300025912 Ga0207707_10085195 Ga0207707_100851953 84
363 3300025913 Ga0207695_10430693 Ga0207695_104306932 84
364 3300025913 Ga0207695_10442927 Ga0207695_104429272 84
365 3300025913 Ga0207695_10465647 Ga0207695_104656472 84
366 3300025913 Ga0207695_10789810 Ga0207695_107898102 84
367 3300025917 Ga0207660_10000438 Ga0207660_100004384 84
368 3300025917 Ga0207660_10000522 Ga0207660_1000052211 84
369 3300025917 Ga0207660_10102050 Ga0207660_101020503 84
370 3300025917 Ga0207660_10752164 Ga0207660_107521642 84
371 3300025918 Ga0207662_10432312 Ga0207662_104323122 84
372 3300025919 Ga0207657_10000837 Ga0207657_1000083729 84
373 3300025919 Ga0207657_10000900 Ga0207657_1000090026 84
374 3300025919 Ga0207657_10018127 Ga0207657_100181274 84
375 3300025919 Ga0207657_10020043 Ga0207657_100200434 84
376 3300025919 Ga0207657_10039196 Ga0207657_100391962 84
377 3300025919 Ga0207657_10083525 Ga0207657_100835253 84
378 3300025919 Ga0207657_10097055 Ga0207657_100970552 84
379 3300025919 Ga0207657_10282996 Ga0207657_102829962 84
380 3300025920 Ga0207649_10083466 Ga0207649_100834664 84
381 3300025920 Ga0207649_10258583 Ga0207649_102585832 84
382 3300025921 Ga0207652_10220558 Ga0207652_102205582 84
383 3300025924 Ga0207694_10188064 Ga0207694_101880642 84
384 3300025925 Ga0207650_10056039 Ga0207650_100560393 84
385 3300025926 Ga0207659_10011390 Ga0207659_100113903 84
386 3300025926 Ga0207659_11303820 Ga0207659_113038202 84
387 3300025927 Ga0207687_10077386 Ga0207687_100773862 84
388 3300025929 Ga0207664_10765907 Ga0207664_107659072 84
389 3300025931 Ga0207644_10000243 Ga0207644_1000024319 84
390 3300025931 Ga0207644_10083461 Ga0207644_100834612 84
391 3300025931 Ga0207644_11605169 Ga0207644_116051692 84
392 3300025932 Ga0207690_10017235 Ga0207690_100172355 84
393 3300025932 Ga0207690_10026346 Ga0207690_100263464 84
394 3300025932 Ga0207690_10076381 Ga0207690_100763814 84
395 3300025932 Ga0207690_10079099 Ga0207690_100790993 84
396 3300025932 Ga0207690_10187820 Ga0207690_101878202 84
397 3300025932 Ga0207690_10890155 Ga0207690_108901552 84
398 3300025932 Ga0207690_10970573 Ga0207690_109705732 84
399 3300025933 Ga0207706_10020396 Ga0207706_100203963 84
400 3300025933 Ga0207706_10646928 Ga0207706_106469282 84
401 3300025933 Ga0207706_11186055 Ga0207706_111860552 84
402 3300025933 Ga0207706_11736789 Ga0207706_117367891 84
403 3300025934 Ga0207686_10261038 Ga0207686_102610382 84
404 3300025935 Ga0207709_10247551 Ga0207709_102475512 84
405 3300025936 Ga0207670_10152951 Ga0207670_101529512 84
406 3300025937 Ga0207669_10003142 Ga0207669_100031426 84
407 3300025938 Ga0207704_10087688 Ga0207704_100876883 84
408 3300025940 Ga0207691_10023185 Ga0207691_100231854 84
409 3300025940 Ga0207691_10130402 Ga0207691_101304022 84
410 3300025941 Ga0207711_10083245 Ga0207711_100832453 84
411 3300025945 Ga0207679_10380275 Ga0207679_103802752 84
412 3300025949 Ga0207667_10017260 Ga0207667_100172607 84
413 3300025949 Ga0207667_10059444 Ga0207667_100594443 84
414 3300025949 Ga0207667_10825763 Ga0207667_108257632 84
415 3300025960 Ga0207651_10000201 Ga0207651_1000020119 84
416 3300025981 Ga0207640_10071428 Ga0207640_100714282 84
417 3300025986 Ga0207658_10038221 Ga0207658_100382213 84
418 3300026023 Ga0207677_10000529 Ga0207677_1000052920 84
419 3300026035 Ga0207703_10010627 Ga0207703_100106273 84
420 3300026035 Ga0207703_12397499 Ga0207703_123974992 84
421 3300026041 Ga0207639_10084827 Ga0207639_100848272 84
422 3300026041 Ga0207639_10108095 Ga0207639_101080953 84
423 3300026041 Ga0207639_10393508 Ga0207639_103935082 84
424 3300026041 Ga0207639_12005662 Ga0207639_120056622 84
425 3300026067 Ga0207678_10031342 Ga0207678_100313425 84
426 3300026067 Ga0207678_10684054 Ga0207678_106840542 84
427 3300026078 Ga0207702_10029627 Ga0207702_100296271 84
428 3300026078 Ga0207702_10047060 Ga0207702_100470602 84
429 3300026078 Ga0207702_10129064 Ga0207702_101290643 84
430 3300026078 Ga0207702_11983711 Ga0207702_119837112 84
431 3300026088 Ga0207641_10006115 Ga0207641_1000611511 84
432 3300026089 Ga0207648_10002999 Ga0207648_100029999 84
433 3300026095 Ga0207676_10012915 Ga0207676_100129157 84
434 3300026095 Ga0207676_12503279 Ga0207676_125032792 84
435 3300026116 Ga0207674_10002528 Ga0207674_1000252817 84
436 3300026116 Ga0207674_10006868 Ga0207674_100068688 84
437 3300026121 Ga0207683_10005838 Ga0207683_1000583810 84
438 3300026121 Ga0207683_10015611 Ga0207683_100156115 84
439 3300026142 Ga0207698_10013037 Ga0207698_100130375 84
440 3300026142 Ga0207698_10037299 Ga0207698_100372993 84
441 3300026142 Ga0207698_11534602 Ga0207698_115346022 84
442 3300026142 Ga0207698_11881960 Ga0207698_118819602 84
443 3300028379 Ga0268266_10050799 Ga0268266_100507993 84
444 3300028379 Ga0268266_10372165 Ga0268266_103721652 84
445 3300028381 Ga0268264_10611282 Ga0268264_106112822 84
446 3300031548 Ga0307408_100047429 Ga0307408_1000474294 84
447 3300031901 Ga0307406_10130569 Ga0307406_101305692 84
448 3300035115 Ga0373941_0242527 Ga0373941_0242527_107_406 84
449 3300035121 Ga0373960_0132326 Ga0373960_0132326_363_662 84
450 3300035242 Ga0373962_0166696 Ga0373962_0166696_218_517 84
451 3300035691 Ga0373931_0007668 Ga0373931_0007668_3684_3983 84
452 3300037312 Ga0395899_0006708 Ga0395899_0006708_7979_8287 84
453 3300037312 Ga0395899_0090094 Ga0395899_0090094_11_310 84
454 3300037312 Ga0395899_0117922 Ga0395899_0117922_939_1238 84
455 3300037312 Ga0395899_0302023 Ga0395899_0302023_339_638 84
456 3300037312 Ga0395899_0324456 Ga0395899_0324456_441_740 84
457 3300037418 Ga0395900_0103263 Ga0395900_0103263_1183_1482 84
458 3300037418 Ga0395900_0116787 Ga0395900_0116787_1550_1849 84
459 3300037418 Ga0395900_0222354 Ga0395900_0222354_1560_1868 84
460 3300037418 Ga0395900_0312391 Ga0395900_0312391_331_630 84
461 3300037418 Ga0395900_0424485 Ga0395900_0424485_669_968 84
462 3300037418 Ga0395900_0604202 Ga0395900_0604202_379_678 84
463 3300037466 Ga0395898_0037743 Ga0395898_0037743_841_1140 84
464 3300037466 Ga0395898_0054496 Ga0395898_0054496_2844_3143 84
465 3300037466 Ga0395898_0152477 Ga0395898_0152477_970_1269 84
466 3300037466 Ga0395898_0479076 Ga0395898_0479076_870_1169 84
467 3300037471 Ga0395905_0004090 Ga0395905_0004090_4527_4826 84
468 3300037471 Ga0395905_0085211 Ga0395905_0085211_1225_1524 84
469 3300037471 Ga0395905_0105843 Ga0395905_0105843_2012_2311 84
470 3300037471 Ga0395905_0266828 Ga0395905_0266828_544_843 84
471 3300037471 Ga0395905_0528357 Ga0395905_0528357_411_710 84
472 3300037471 Ga0395905_0705636 Ga0395905_0705636_89_397 84
473 3300038443 Ga0395901_0041174 Ga0395901_0041174_4379_4678 84
474 3300038443 Ga0395901_0061759 Ga0395901_0061759_1230_1529 84
475 3300038443 Ga0395901_0183756 Ga0395901_0183756_922_1227 84
476 3300038443 Ga0395901_0194923 Ga0395901_0194923_1008_1307 84
477 3300038443 Ga0395901_0292981 Ga0395901_0292981_147_446 84
478 3300038443 Ga0395901_0789351 Ga0395901_0789351_119_418 84
479 3300038443 Ga0395901_0812363 Ga0395901_0812363_461_760 84
480 3300042005 Ga0439448_0000627 Ga0439448_0000627_4436_4735 84
481 3300042012 Ga0439455_0019716 Ga0439455_0019716_384_683 84
482 3300042157 Ga0439458_0000006 Ga0439458_0000006_14339_14638 84
483 3300044656 Ga0466969_0068840 Ga0466969_0068840_793_1098 84
484 3300044684 Ga0466966_0029842 Ga0466966_0029842_1573_1878 84
485 3300044684 Ga0466966_0282546 Ga0466966_0282546_16_321 84
486 3300044693 Ga0466961_0003923 Ga0466961_0003923_1107_1412 84
487 3300044693 Ga0466961_0398464 Ga0466961_0398464_462_767 84
488 3300044694 Ga0466963_0015928 Ga0466963_0015928_3039_3344 84
489 3300044694 Ga0466963_0029255 Ga0466963_0029255_2573_2878 84
490 3300044694 Ga0466963_0155247 Ga0466963_0155247_792_1091 84
491 3300044694 Ga0466963_0284246 Ga0466963_0284246_750_1049 84
492 3300044694 Ga0466963_0323865 Ga0466963_0323865_619_918 84
493 3300044719 Ga0466971_0019587 Ga0466971_0019587_1798_2103 84
494 3300044719 Ga0466971_0081863 Ga0466971_0081863_707_1012 84
495 3300044735 Ga0466968_0577836 Ga0466968_0577836_174_479 84
496 3300044765 Ga0466970_0312759 Ga0466970_0312759_137_436 84
497 3300044842 Ga0466957_0083970 Ga0466957_0083970_904_1209 84
498 3300045049 Ga0466959_0102969 Ga0466959_0102969_342_647 84
499 3300045049 Ga0466959_0164656 Ga0466959_0164656_981_1286 84
500 3300045049 Ga0466959_0811545 Ga0466959_0811545_273_578 84
501 3300045836 Ga0466958_0021712 Ga0466958_0021712_2654_2959 84
502 3300045836 Ga0466958_0522665 Ga0466958_0522665_221_526 84
503 3300045836 Ga0466958_1018360 Ga0466958_1018360_132_437 84
504 3300045976 Ga0466967_0063010 Ga0466967_0063010_1067_1366 84
505 3300045976 Ga0466967_0147134 Ga0466967_0147134_1695_1994 84
506 3300045976 Ga0466967_0284433 Ga0466967_0284433_925_1230 84
507 3300045976 Ga0466967_0331006 Ga0466967_0331006_187_486 84
508 3300045976 Ga0466967_1139225 Ga0466967_1139225_152_451 84
509 3300046507 Ga0495606_0230352 Ga0495606_0230352_122_421 84
510 3300046684 Ga0495669_0009712 Ga0495669_0009712_3591_3890 84
511 3300046684 Ga0495669_0409371 Ga0495669_0409371_342_641 84
512 3300048903 Ga0496100_0001319 Ga0496100_0001319_1678_1977 84
513 3300048903 Ga0496100_0018297 Ga0496100_0018297_2082_2381 84
514 3300048904 Ga0496101_0000256 Ga0496101_0000256_16145_16444 84
515 3300048905 Ga0496102_0006759 Ga0496102_0006759_374_673 84
516 3300048906 Ga0496103_0113653 Ga0496103_0113653_549_848 84
517 3300048907 Ga0496104_0022966 Ga0496104_0022966_602_901 84
518 3300048907 Ga0496104_1449284 Ga0496104_1449284_210_509 84
519 3300048908 Ga0496105_0038015 Ga0496105_0038015_614_913 84
520 3300048909 Ga0496106_0011259 Ga0496106_0011259_3631_3930 84
521 3300048910 Ga0496107_0000623 Ga0496107_0000623_18469_18768 84
522 3300048910 Ga0496107_0836365 Ga0496107_0836365_325_624 84
523 3300048911 Ga0496108_0000673 Ga0496108_0000673_12762_13061 84
524 3300048914 Ga0496111_0000247 Ga0496111_0000247_11087_11386 84
525 3300048914 Ga0496111_0597522 Ga0496111_0597522_422_721 84
526 3300048915 Ga0496112_0000369 Ga0496112_0000369_17812_18111 84
527 3300048915 Ga0496112_0061660 Ga0496112_0061660_2616_2915 84
528 3300048916 Ga0496113_0000242 Ga0496113_0000242_8120_8419 84
529 3300048916 Ga0496113_1025725 Ga0496113_1025725_76_384 84
530 3300048917 Ga0496114_0358866 Ga0496114_0358866_535_834 84
531 3300048917 Ga0496114_0525480 Ga0496114_0525480_219_518 84
532 3300048918 Ga0496115_0002137 Ga0496115_0002137_8259_8558 84
533 3300048918 Ga0496115_0903018 Ga0496115_0903018_209_508 84
534 3300048929 Ga0496126_0093822 Ga0496126_0093822_1597_1905 84
535 3300061719 Ga0466962_0021183 Ga0466962_0021183_997_1302 84
536 3300061719 Ga0466962_0219004 Ga0466962_0219004_288_593 84
537 3300000549 LJQas_1004057 LJQas_10040573 85
538 3300005339 Ga0070660_100000212 Ga0070660_10000021226 85
539 3300005339 Ga0070660_100101033 Ga0070660_1001010331 85
540 3300005344 Ga0070661_101214502 Ga0070661_1012145022 85
541 3300005345 Ga0070692_10018011 Ga0070692_100180113 85
542 3300005345 Ga0070692_10405270 Ga0070692_104052702 85
543 3300005563 Ga0068855_100000079 Ga0068855_10000007996 85
544 3300010375 Ga0105239_10544033 Ga0105239_105440332 85
545 3300013102 Ga0157371_10000558 Ga0157371_1000055827 85
546 3300013104 Ga0157370_10148254 Ga0157370_101482543 85
547 3300013104 Ga0157370_10834916 Ga0157370_108349162 85
548 3300013105 Ga0157369_10007204 Ga0157369_1000720413 85
549 3300013296 Ga0157374_12771071 Ga0157374_127710711 85
550 3300013306 Ga0163162_11920567 Ga0163162_119205672 85
551 3300025904 Ga0207647_10099232 Ga0207647_100992322 85
552 3300025904 Ga0207647_10314069 Ga0207647_103140691 85
553 3300025909 Ga0207705_10000190 Ga0207705_1000019042 85
554 3300025909 Ga0207705_10051142 Ga0207705_100511422 85
555 3300025919 Ga0207657_10000407 Ga0207657_1000040728 85
556 3300025919 Ga0207657_10002570 Ga0207657_1000257011 85
557 3300025920 Ga0207649_10450870 Ga0207649_104508701 85
558 3300025920 Ga0207649_11589476 Ga0207649_115894761 85
559 3300025932 Ga0207690_10432011 Ga0207690_104320112 85
560 3300025949 Ga0207667_10001479 Ga0207667_1000147934 85
561 3300031548 Ga0307408_100040343 Ga0307408_1000403435 85
562 3300031548 Ga0307408_100397364 Ga0307408_1003973642 85
563 3300031548 Ga0307408_100461846 Ga0307408_1004618462 85
564 3300031548 Ga0307408_101484831 Ga0307408_1014848312 85
565 3300031731 Ga0307405_10139409 Ga0307405_101394093 85
566 3300031731 Ga0307405_10309673 Ga0307405_103096732 85
567 3300031731 Ga0307405_10385830 Ga0307405_103858302 85
568 3300031731 Ga0307405_10396931 Ga0307405_103969312 85
569 3300031731 Ga0307405_10821181 Ga0307405_108211811 85
570 3300031731 Ga0307405_11208982 Ga0307405_112089822 85
571 3300031731 Ga0307405_11394649 Ga0307405_113946492 85
572 3300031824 Ga0307413_10048332 Ga0307413_100483323 85
573 3300031824 Ga0307413_10135903 Ga0307413_101359032 85
574 3300031824 Ga0307413_10141851 Ga0307413_101418511 85
575 3300031824 Ga0307413_10545541 Ga0307413_105455412 85
576 3300031824 Ga0307413_10982486 Ga0307413_109824862 85
577 3300031824 Ga0307413_11874966 Ga0307413_118749661 85
578 3300031852 Ga0307410_10093803 Ga0307410_100938033 85
579 3300031852 Ga0307410_10098476 Ga0307410_100984762 85
580 3300031852 Ga0307410_10161486 Ga0307410_101614862 85
581 3300031852 Ga0307410_10177137 Ga0307410_101771372 85
582 3300031852 Ga0307410_10190679 Ga0307410_101906793 85
583 3300031852 Ga0307410_10197305 Ga0307410_101973052 85
584 3300031852 Ga0307410_10396561 Ga0307410_103965612 85
585 3300031852 Ga0307410_11539038 Ga0307410_115390382 85
586 3300031901 Ga0307406_10043181 Ga0307406_100431812 85
587 3300031901 Ga0307406_10045476 Ga0307406_100454764 85
588 3300031901 Ga0307406_10233323 Ga0307406_102333232 85
589 3300031901 Ga0307406_10388564 Ga0307406_103885642 85
590 3300031901 Ga0307406_10804482 Ga0307406_108044821 85
591 3300031903 Ga0307407_10028847 Ga0307407_100288471 85
592 3300031903 Ga0307407_10056215 Ga0307407_100562154 85
593 3300031903 Ga0307407_10409771 Ga0307407_104097712 85
594 3300031903 Ga0307407_10685584 Ga0307407_106855841 85
595 3300031911 Ga0307412_10063834 Ga0307412_100638342 85
596 3300031911 Ga0307412_10340962 Ga0307412_103409622 85
597 3300031911 Ga0307412_10388726 Ga0307412_103887262 85
598 3300031911 Ga0307412_10454055 Ga0307412_104540552 85
599 3300031911 Ga0307412_11499563 Ga0307412_114995632 85
600 3300031911 Ga0307412_11567756 Ga0307412_115677562 85
601 3300031911 Ga0307412_11833187 Ga0307412_118331871 85
602 3300031995 Ga0307409_100151387 Ga0307409_1001513873 85
603 3300031995 Ga0307409_100323434 Ga0307409_1003234342 85
604 3300031995 Ga0307409_100428078 Ga0307409_1004280782 85
605 3300031995 Ga0307409_100863326 Ga0307409_1008633262 85
606 3300031995 Ga0307409_101478518 Ga0307409_1014785182 85
607 3300032002 Ga0307416_100147272 Ga0307416_1001472723 85
608 3300032002 Ga0307416_100320559 Ga0307416_1003205592 85
609 3300032002 Ga0307416_100470966 Ga0307416_1004709662 85
610 3300032002 Ga0307416_100521463 Ga0307416_1005214632 85
611 3300032002 Ga0307416_101291646 Ga0307416_1012916462 85
612 3300032002 Ga0307416_102075588 Ga0307416_1020755882 85
613 3300032002 Ga0307416_102630846 Ga0307416_1026308462 85
614 3300032004 Ga0307414_10024487 Ga0307414_100244873 85
615 3300032004 Ga0307414_10313180 Ga0307414_103131802 85
616 3300032004 Ga0307414_10704404 Ga0307414_107044042 85
617 3300032004 Ga0307414_10747555 Ga0307414_107475552 85
618 3300032004 Ga0307414_11103828 Ga0307414_111038281 85
619 3300032005 Ga0307411_10029635 Ga0307411_100296355 85
620 3300032005 Ga0307411_10127685 Ga0307411_101276851 85
621 3300032005 Ga0307411_10282885 Ga0307411_102828852 85
622 3300032005 Ga0307411_10318070 Ga0307411_103180702 85
623 3300032005 Ga0307411_10374777 Ga0307411_103747772 85
624 3300032005 Ga0307411_10515049 Ga0307411_105150492 85
625 3300032005 Ga0307411_10532184 Ga0307411_105321842 85
626 3300032126 Ga0307415_100034992 Ga0307415_1000349925 85
627 3300032126 Ga0307415_100094767 Ga0307415_1000947673 85
628 3300032126 Ga0307415_100153146 Ga0307415_1001531462 85
629 3300032126 Ga0307415_100242574 Ga0307415_1002425742 85
630 3300032126 Ga0307415_100444212 Ga0307415_1004442122 85
631 3300032126 Ga0307415_101351882 Ga0307415_1013518821 85
632 3300037312 Ga0395899_0000737 Ga0395899_0000737_22376_22693 85
633 3300037418 Ga0395900_0000364 Ga0395900_0000364_13850_14167 85
634 3300037466 Ga0395898_0019963 Ga0395898_0019963_5184_5501 85
635 3300037471 Ga0395905_0069318 Ga0395905_0069318_1805_2122 85
636 3300038443 Ga0395901_0000209 Ga0395901_0000209_50902_51219 85
637 3300048912 Ga0496109_1015345 Ga0496109_1015345_260_562 85
638 3300048915 Ga0496112_0795083 Ga0496112_0795083_184_489 85
639 3300049571 Ga0501034_1418953 Ga0501034_1418953_191_496 85
640 3300049669 Ga0501235_161766 Ga0501235_161766_183_485 85
641 3300049683 Ga0501253_028165 Ga0501253_028165_398_700 85
642 3300049765 Ga0501268_009695 Ga0501268_009695_1014_1316 85
643 3300049765 Ga0501268_104240 Ga0501268_104240_111_413 85
644 3300049765 Ga0501268_125088 Ga0501268_125088_81_383 85

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02325

YGGT

YGGT family

1

77

0.8

Feature Viewer

pLDDT pTM Quality
69.87 0.31 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map