F471929
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 643 | 303 | 626 | 405 |
Family's Representative Sequence
| Representative Sequence | 3300005288|Ga0065714_10069413|Ga0065714_100694135 |
| Length | 440 |
| Sequence | MLKCLKAIPVACIWYNLKVDSLPLLAHSVNHKLLVMPGFEFFGSEERKEVNDVLETGILMRYGFDGPRKGIWKSKELEQAITETFGCKYAQLVSSGTAALTTALSALGVGYGDEVIIPSFTFVASFEAVLSVGAIPVLVDVDDTLTLNPAAVRNAITSKTKCLMPVHMCGSMADMDELVAICKEHELILIEDACQSIGASYKGKMLGTIGDAGTFSFDFVKTITCAEGGVVMSNREDVYISSDGYSDHGHDHKGTDRGADLHPFIGYNYRISELHAAVGLAQIKKLDSFLTIQRKNNKILRDILSGVPEITFRRVPDEAGDSCTFLSWFLPTPEITKAVVTQMRSQGIMAGSFYWFDNNWHYISKWDHLKDALTLNKLHPDLKAAVIHQASKDFSASDAVMSRCVSTLISLLWTEEQIQEKGKQMVVVIKKVLNEHAVTY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 4 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 5 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 6 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 7 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 8 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 9 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 10 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 11 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 12 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 13 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 14 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 15 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 16 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 17 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 18 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 19 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 20 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 21 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 22 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 23 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 24 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 25 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 26 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 27 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 28 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 29 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 38 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 124 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 189 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 190 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 191 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 193 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 194 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 195 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 196 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 197 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 198 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 199 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 200 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 201 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 202 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 205 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 206 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 207 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 208 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 209 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 210 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 211 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 212 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 213 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 214 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 215 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 216 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 217 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 218 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 219 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 237 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 238 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 239 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 240 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 241 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 258 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 259 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 260 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 261 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 262 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 263 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 264 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 265 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 266 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 267 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 268 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 269 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 270 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 271 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 275 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 276 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 279 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 280 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 281 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 286 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 287 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 288 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 289 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 290 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 291 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 292 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 293 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 294 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 295 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 296 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 297 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 298 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 299 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 300 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 301 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 302 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 303 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.2 |
| Metatranscriptomes | 0 |
| Isolates | 2.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.71 |
| Nodule | 0 |
| Rhizoplane | 0.62 |
| Rhizosphere | 83.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_677025 | 2162886007 | Bacteria | 181955 |
| 2 | JGI24740J21852_10000359 | 3300001979 | Bacteria | 19514 |
| 3 | JGI24740J21852_10015040 | 3300001979 | Bacteria | 2836 |
| 4 | JGI24739J22299_10000062 | 3300001989 | Bacteria | 29944 |
| 5 | JGI25154J39366_1000023 | 3300002738 | Bacteria | 219569 |
| 6 | JGI25157J39369_1008966 | 3300002741 | Bacteria | 1365 |
| 7 | JGI25153J46596_10016298 | 3300003215 | Bacteria | 2985 |
| 8 | rootH1_10078655 | 3300003316 | Bacteria | 2031 |
| 9 | rootH1_10094712 | 3300003316 | Bacteria | 3075 |
| 10 | rootH2_10005170 | 3300003320 | Bacteria | 79894 |
| 11 | rootH2_10031448 | 3300003320 | Bacteria | 32925 |
| 12 | rootH2_10048291 | 3300003320 | Bacteria | 12301 |
| 13 | rootL2_10052422 | 3300003322 | Bacteria | 10016 |
| 14 | rootL2_10066841 | 3300003322 | Bacteria | 3791 |
| 15 | rootL2_10189599 | 3300003322 | Unclassified | 1953 |
| 16 | rootH1_10005699 | 3300003316 | Bacteria | 17995 |
| 17 | rootH1_10005699 | 3300003323 | Bacteria | 16393 |
| 18 | JGI25160J50197_1003646 | 3300003354 | Bacteria | 6829 |
| 19 | JGI25160J50197_1005193 | 3300003354 | Bacteria | 5461 |
| 20 | JGI25160J50197_1010215 | 3300003354 | Bacteria | 3408 |
| 21 | Ga0055535_1004409 | 3300003761 | Bacteria | 3430 |
| 22 | Ga0055526_1018422 | 3300003771 | Bacteria | 2604 |
| 23 | Ga0055526_1033615 | 3300003771 | Bacteria | 1419 |
| 24 | Ga0055528_1003039 | 3300003790 | Bacteria | 8643 |
| 25 | Ga0055530_10000118 | 3300003791 | Bacteria | 68596 |
| 26 | Ga0055531_10000054 | 3300003794 | Bacteria | 123684 |
| 27 | Ga0055531_10029799 | 3300003794 | Bacteria | 1850 |
| 28 | Ga0065165_1000027 | 3300005262 | Bacteria | 228507 |
| 29 | Ga0065714_10069413 | 3300005288 | Bacteria | 4239 |
| 30 | Ga0065704_10070133 | 3300005289 | Bacteria | 1266035 |
| 31 | Ga0065704_10129419 | 3300005289 | Bacteria | 1649 |
| 32 | Ga0065712_10132147 | 3300005290 | Bacteria | 1534 |
| 33 | Ga0065712_10142763 | 3300005290 | Bacteria | 1435 |
| 34 | Ga0065715_10129339 | 3300005293 | Bacteria | 2047 |
| 35 | Ga0070676_10000439 | 3300005328 | Bacteria | 19781 |
| 36 | Ga0070676_10004674 | 3300005328 | Bacteria | 7237 |
| 37 | Ga0070676_10048392 | 3300005328 | Bacteria | 2486 |
| 38 | Ga0070683_100001393 | 3300005329 | Bacteria | 18553 |
| 39 | Ga0070683_100002039 | 3300005329 | Bacteria | 15909 |
| 40 | Ga0070683_100032986 | 3300005329 | Bacteria | 4719 |
| 41 | Ga0070670_100011898 | 3300005331 | Bacteria | 7441 |
| 42 | Ga0070670_100075152 | 3300005331 | Bacteria | 2903 |
| 43 | Ga0070670_100111399 | 3300005331 | Bacteria | 2358 |
| 44 | Ga0070677_10022935 | 3300005333 | Bacteria | 2305 |
| 45 | Ga0068869_100001381 | 3300005334 | Bacteria | 14366 |
| 46 | Ga0068869_100049947 | 3300005334 | Bacteria | 3030 |
| 47 | Ga0070666_10000132 | 3300005335 | Bacteria | 52718 |
| 48 | Ga0070666_10003676 | 3300005335 | Bacteria | 9296 |
| 49 | Ga0070666_10030445 | 3300005335 | Bacteria | 3556 |
| 50 | Ga0070666_10108354 | 3300005335 | Bacteria | 1919 |
| 51 | Ga0070682_100000008 | 3300005337 | Bacteria | 322125 |
| 52 | Ga0070682_100000812 | 3300005337 | Bacteria | 18337 |
| 53 | Ga0068868_100000119 | 3300005338 | Bacteria | 49590 |
| 54 | Ga0068868_100005565 | 3300005338 | Bacteria | 8860 |
| 55 | Ga0068868_100007251 | 3300005338 | Bacteria | 7885 |
| 56 | Ga0070689_100013486 | 3300005340 | Bacteria | 5915 |
| 57 | Ga0070689_100032797 | 3300005340 | Unclassified | 3952 |
| 58 | Ga0070691_10000209 | 3300005341 | Bacteria | 19696 |
| 59 | Ga0070661_100000700 | 3300005344 | Bacteria | 24597 |
| 60 | Ga0070661_100019009 | 3300005344 | Unclassified | 4891 |
| 61 | Ga0070661_100063563 | 3300005344 | Bacteria | 2711 |
| 62 | Ga0070668_100000645 | 3300005347 | Bacteria | 23563 |
| 63 | Ga0070668_100014784 | 3300005347 | Bacteria | 5833 |
| 64 | Ga0070668_100112299 | 3300005347 | Bacteria | 2170 |
| 65 | Ga0070669_100253945 | 3300005353 | Bacteria | 1401 |
| 66 | Ga0070675_100030083 | 3300005354 | Bacteria | 4382 |
| 67 | Ga0070675_100094089 | 3300005354 | Unclassified | 2514 |
| 68 | Ga0070671_100023690 | 3300005355 | Bacteria | 5026 |
| 69 | Ga0070674_100098174 | 3300005356 | Bacteria | 2129 |
| 70 | Ga0070673_100000331 | 3300005364 | Bacteria | 24760 |
| 71 | Ga0070673_100131024 | 3300005364 | Bacteria | 2104 |
| 72 | Ga0070673_100232178 | 3300005364 | Bacteria | 1601 |
| 73 | Ga0070673_100267689 | 3300005364 | Unclassified | 1495 |
| 74 | Ga0070688_100014398 | 3300005365 | Bacteria | 4480 |
| 75 | Ga0070659_100014492 | 3300005366 | Bacteria | 5891 |
| 76 | Ga0070659_100202637 | 3300005366 | Bacteria | 1634 |
| 77 | Ga0070667_100001052 | 3300005367 | Bacteria | 25199 |
| 78 | Ga0070667_100002402 | 3300005367 | Bacteria | 16395 |
| 79 | Ga0070667_100013431 | 3300005367 | Bacteria | 6770 |
| 80 | Ga0070667_100340252 | 3300005367 | Bacteria | 1357 |
| 81 | Ga0070678_100003657 | 3300005456 | Bacteria | 8586 |
| 82 | Ga0070678_100034897 | 3300005456 | Bacteria | 3507 |
| 83 | Ga0070662_100001338 | 3300005457 | Bacteria | 15148 |
| 84 | Ga0070662_100049365 | 3300005457 | Bacteria | 3034 |
| 85 | Ga0070681_10015209 | 3300005458 | Bacteria | 7654 |
| 86 | Ga0068867_100002653 | 3300005459 | Bacteria | 12624 |
| 87 | Ga0068867_100075785 | 3300005459 | Bacteria | 2524 |
| 88 | Ga0070685_10053861 | 3300005466 | Bacteria | 2332 |
| 89 | Ga0070706_100128501 | 3300005467 | Bacteria | 2364 |
| 90 | Ga0070707_100066480 | 3300005468 | Bacteria | 3465 |
| 91 | Ga0070707_100071522 | 3300005468 | Bacteria | 3342 |
| 92 | Ga0070679_100000099 | 3300005530 | Bacteria | 66873 |
| 93 | Ga0070684_100002311 | 3300005535 | Bacteria | 14052 |
| 94 | Ga0070684_100007507 | 3300005535 | Bacteria | 8485 |
| 95 | Ga0068853_100000395 | 3300005539 | Bacteria | 29784 |
| 96 | Ga0068853_100001004 | 3300005539 | Bacteria | 19895 |
| 97 | Ga0068853_100001959 | 3300005539 | Bacteria | 15174 |
| 98 | Ga0068853_100019744 | 3300005539 | Bacteria | 5595 |
| 99 | Ga0068853_100019995 | 3300005539 | Bacteria | 5562 |
| 100 | Ga0068853_100044637 | 3300005539 | Bacteria | 3794 |
| 101 | Ga0068853_100084824 | 3300005539 | Bacteria | 2776 |
| 102 | Ga0070672_100000183 | 3300005543 | Bacteria | 34362 |
| 103 | Ga0070672_100075811 | 3300005543 | Bacteria | 2686 |
| 104 | Ga0070686_100009707 | 3300005544 | Bacteria | 5410 |
| 105 | Ga0070665_100000047 | 3300005548 | Bacteria | 269702 |
| 106 | Ga0070665_100001045 | 3300005548 | Bacteria | 34668 |
| 107 | Ga0070665_100275504 | 3300005548 | Bacteria | 1684 |
| 108 | Ga0068855_100018034 | 3300005563 | Bacteria | 8482 |
| 109 | Ga0068855_100028092 | 3300005563 | Bacteria | 6728 |
| 110 | Ga0068855_100067120 | 3300005563 | Bacteria | 4180 |
| 111 | Ga0068855_100077021 | 3300005563 | Bacteria | 3869 |
| 112 | Ga0068855_100143636 | 3300005563 | Bacteria | 2718 |
| 113 | Ga0070664_100015826 | 3300005564 | Bacteria | 6173 |
| 114 | Ga0068857_100001502 | 3300005577 | Bacteria | 18597 |
| 115 | Ga0068857_100002865 | 3300005577 | Bacteria | 14180 |
| 116 | Ga0068857_100084803 | 3300005577 | Bacteria | 2831 |
| 117 | Ga0068857_100224112 | 3300005577 | Bacteria | 1718 |
| 118 | Ga0068854_100019088 | 3300005578 | Bacteria | 4615 |
| 119 | Ga0068854_100021090 | 3300005578 | Bacteria | 4418 |
| 120 | Ga0068854_100071353 | 3300005578 | Bacteria | 2540 |
| 121 | Ga0068856_100014397 | 3300005614 | Bacteria | 7645 |
| 122 | Ga0068856_100041025 | 3300005614 | Bacteria | 4547 |
| 123 | Ga0068856_100475293 | 3300005614 | Bacteria | 1271 |
| 124 | Ga0070702_100008510 | 3300005615 | Bacteria | 4974 |
| 125 | Ga0068852_100006330 | 3300005616 | Bacteria | 8543 |
| 126 | Ga0068852_100015185 | 3300005616 | Bacteria | 5960 |
| 127 | Ga0068852_100064901 | 3300005616 | Bacteria | 3184 |
| 128 | Ga0068852_100198184 | 3300005616 | Bacteria | 1899 |
| 129 | Ga0068859_100000003 | 3300005617 | Bacteria | 479218 |
| 130 | Ga0068859_100000933 | 3300005617 | Bacteria | 29963 |
| 131 | Ga0068859_100005582 | 3300005617 | Bacteria | 12812 |
| 132 | Ga0068859_100006236 | 3300005617 | Bacteria | 12106 |
| 133 | Ga0068859_100061943 | 3300005617 | Bacteria | 3770 |
| 134 | Ga0068859_100064203 | 3300005617 | Bacteria | 3704 |
| 135 | Ga0068859_100146288 | 3300005617 | Bacteria | 2438 |
| 136 | Ga0068864_100002400 | 3300005618 | Bacteria | 15470 |
| 137 | Ga0068864_100005055 | 3300005618 | Bacteria | 10799 |
| 138 | Ga0068864_100008752 | 3300005618 | Bacteria | 8345 |
| 139 | Ga0068864_100012271 | 3300005618 | Bacteria | 7082 |
| 140 | Ga0068864_100111223 | 3300005618 | Bacteria | 2440 |
| 141 | Ga0068864_100167268 | 3300005618 | Bacteria | 2003 |
| 142 | Ga0068851_10019916 | 3300005834 | Bacteria | 3244 |
| 143 | Ga0068851_10027102 | 3300005834 | Bacteria | 2822 |
| 144 | Ga0068851_10063006 | 3300005834 | Bacteria | 1904 |
| 145 | Ga0068863_100000394 | 3300005841 | Bacteria | 44355 |
| 146 | Ga0068863_100001935 | 3300005841 | Bacteria | 20565 |
| 147 | Ga0068863_100049856 | 3300005841 | Bacteria | 3970 |
| 148 | Ga0068863_100092206 | 3300005841 | Bacteria | 2874 |
| 149 | Ga0068858_100023584 | 3300005842 | Bacteria | 5732 |
| 150 | Ga0068858_100034237 | 3300005842 | Unclassified | 4711 |
| 151 | Ga0068860_100000003 | 3300005843 | Bacteria | 575741 |
| 152 | Ga0068860_100000829 | 3300005843 | Bacteria | 34616 |
| 153 | Ga0068860_100002234 | 3300005843 | Bacteria | 20388 |
| 154 | Ga0068860_100002493 | 3300005843 | Bacteria | 19315 |
| 155 | Ga0068860_100006719 | 3300005843 | Bacteria | 11541 |
| 156 | Ga0068860_100032165 | 3300005843 | Bacteria | 5042 |
| 157 | Ga0068860_100087290 | 3300005843 | Bacteria | 2969 |
| 158 | Ga0081540_1007577 | 3300005983 | Bacteria | 7712 |
| 159 | Ga0081539_10000534 | 3300005985 | Bacteria | 78990 |
| 160 | Ga0081539_10014443 | 3300005985 | Bacteria | 5840 |
| 161 | Ga0075366_10006015 | 3300006195 | Bacteria | 6612 |
| 162 | Ga0075366_10134520 | 3300006195 | Bacteria | 1493 |
| 163 | Ga0097621_100000352 | 3300006237 | Bacteria | 31757 |
| 164 | Ga0097621_100003204 | 3300006237 | Bacteria | 11241 |
| 165 | Ga0097621_100084541 | 3300006237 | Bacteria | 2645 |
| 166 | Ga0068871_100001720 | 3300006358 | Bacteria | 14724 |
| 167 | Ga0068871_100011054 | 3300006358 | Bacteria | 6617 |
| 168 | Ga0068871_100011985 | 3300006358 | Bacteria | 6380 |
| 169 | Ga0068871_100023716 | 3300006358 | Bacteria | 4749 |
| 170 | Ga0075428_100257605 | 3300006844 | Unclassified | 1879 |
| 171 | Ga0075431_100001819 | 3300006847 | Bacteria | 20141 |
| 172 | Ga0075434_100004332 | 3300006871 | Bacteria | 12765 |
| 173 | Ga0075429_100127361 | 3300006880 | Unclassified | 2227 |
| 174 | Ga0068865_100000660 | 3300006881 | Bacteria | 19448 |
| 175 | Ga0068865_100021362 | 3300006881 | Bacteria | 4207 |
| 176 | Ga0068865_100105288 | 3300006881 | Bacteria | 2072 |
| 177 | Ga0097620_100000003 | 3300006931 | Bacteria | 479218 |
| 178 | Ga0097620_100000933 | 3300006931 | Bacteria | 29963 |
| 179 | Ga0097620_100005582 | 3300006931 | Bacteria | 12812 |
| 180 | Ga0097620_100006236 | 3300006931 | Bacteria | 12106 |
| 181 | Ga0097620_100061941 | 3300006931 | Bacteria | 3770 |
| 182 | Ga0097620_100064203 | 3300006931 | Bacteria | 3704 |
| 183 | Ga0097620_100146283 | 3300006931 | Bacteria | 2438 |
| 184 | Ga0105240_10000098 | 3300009093 | Bacteria | 178435 |
| 185 | Ga0105240_10000356 | 3300009093 | Bacteria | 85978 |
| 186 | Ga0105240_10000383 | 3300009093 | Bacteria | 83057 |
| 187 | Ga0105240_10000401 | 3300009093 | Bacteria | 80500 |
| 188 | Ga0105240_10002820 | 3300009093 | Bacteria | 27478 |
| 189 | Ga0105240_10003287 | 3300009093 | Bacteria | 25283 |
| 190 | Ga0105240_10004458 | 3300009093 | Bacteria | 21346 |
| 191 | Ga0105240_10006383 | 3300009093 | Bacteria | 17357 |
| 192 | Ga0105240_10009536 | 3300009093 | Bacteria | 13745 |
| 193 | Ga0105240_10056040 | 3300009093 | Bacteria | 4934 |
| 194 | Ga0105240_10294082 | 3300009093 | Bacteria | 1860 |
| 195 | Ga0111539_10035856 | 3300009094 | Bacteria | 6004 |
| 196 | Ga0111539_10086011 | 3300009094 | Bacteria | 3695 |
| 197 | Ga0111539_10260602 | 3300009094 | Bacteria | 2018 |
| 198 | Ga0105245_10064448 | 3300009098 | Bacteria | 3311 |
| 199 | Ga0105245_10120666 | 3300009098 | Unclassified | 2449 |
| 200 | Ga0105247_10000408 | 3300009101 | Bacteria | 36396 |
| 201 | Ga0105247_10015502 | 3300009101 | Bacteria | 4564 |
| 202 | Ga0114129_10000267 | 3300009147 | Bacteria | 59005 |
| 203 | Ga0114129_10085891 | 3300009147 | Unclassified | 4365 |
| 204 | Ga0105243_10239158 | 3300009148 | Unclassified | 1615 |
| 205 | Ga0105241_10000056 | 3300009174 | Bacteria | 84758 |
| 206 | Ga0105241_10000507 | 3300009174 | Bacteria | 29349 |
| 207 | Ga0105241_10073450 | 3300009174 | Bacteria | 2661 |
| 208 | Ga0105241_10220049 | 3300009174 | Bacteria | 1595 |
| 209 | Ga0105242_10113983 | 3300009176 | Bacteria | 2309 |
| 210 | Ga0105248_10122259 | 3300009177 | Bacteria | 2936 |
| 211 | Ga0105237_10000284 | 3300009545 | Bacteria | 69955 |
| 212 | Ga0105237_10001393 | 3300009545 | Bacteria | 31945 |
| 213 | Ga0105237_10002285 | 3300009545 | Bacteria | 23813 |
| 214 | Ga0105237_10002753 | 3300009545 | Bacteria | 21392 |
| 215 | Ga0105237_10019243 | 3300009545 | Bacteria | 7054 |
| 216 | Ga0105237_10026005 | 3300009545 | Bacteria | 5983 |
| 217 | Ga0105237_10034875 | 3300009545 | Bacteria | 5091 |
| 218 | Ga0105237_10122366 | 3300009545 | Bacteria | 2596 |
| 219 | Ga0105237_10146206 | 3300009545 | Bacteria | 2359 |
| 220 | Ga0105237_10444421 | 3300009545 | Unclassified | 1302 |
| 221 | Ga0105238_10006282 | 3300009551 | Bacteria | 11809 |
| 222 | Ga0105238_10020905 | 3300009551 | Bacteria | 6668 |
| 223 | Ga0105238_10364711 | 3300009551 | Unclassified | 1434 |
| 224 | Ga0105249_10000561 | 3300009553 | Bacteria | 34246 |
| 225 | Ga0105249_10024147 | 3300009553 | Bacteria | 5462 |
| 226 | Ga0105249_10052388 | 3300009553 | Bacteria | 3726 |
| 227 | Ga0105249_10130049 | 3300009553 | Bacteria | 2402 |
| 228 | Ga0105249_10159469 | 3300009553 | Bacteria | 2179 |
| 229 | Ga0105239_10000129 | 3300010375 | Bacteria | 106549 |
| 230 | Ga0105239_10000664 | 3300010375 | Bacteria | 48926 |
| 231 | Ga0105239_10002123 | 3300010375 | Bacteria | 25586 |
| 232 | Ga0105239_10004942 | 3300010375 | Bacteria | 15731 |
| 233 | Ga0105239_10010397 | 3300010375 | Bacteria | 10412 |
| 234 | Ga0105239_10039359 | 3300010375 | Bacteria | 5181 |
| 235 | Ga0105239_10148255 | 3300010375 | Unclassified | 2618 |
| 236 | Ga0105246_10006084 | 3300011119 | Bacteria | 7364 |
| 237 | Ga0105246_10031846 | 3300011119 | Bacteria | 3492 |
| 238 | Ga0105246_10140933 | 3300011119 | Bacteria | 1813 |
| 239 | Ga0157370_10005131 | 3300013104 | Bacteria | 14768 |
| 240 | Ga0157370_10020254 | 3300013104 | Bacteria | 6644 |
| 241 | Ga0157370_10064348 | 3300013104 | Bacteria | 3472 |
| 242 | Ga0157370_10081369 | 3300013104 | Bacteria | 3047 |
| 243 | Ga0157369_10047886 | 3300013105 | Bacteria | 4640 |
| 244 | Ga0157369_10070633 | 3300013105 | Bacteria | 3751 |
| 245 | Ga0157369_10118065 | 3300013105 | Bacteria | 2815 |
| 246 | Ga0157374_10000027 | 3300013296 | Bacteria | 233444 |
| 247 | Ga0157374_10000505 | 3300013296 | Bacteria | 35194 |
| 248 | Ga0157374_10001463 | 3300013296 | Bacteria | 19961 |
| 249 | Ga0157374_10020839 | 3300013296 | Bacteria | 5823 |
| 250 | Ga0157374_10058271 | 3300013296 | Bacteria | 3609 |
| 251 | Ga0157374_10095642 | 3300013296 | Bacteria | 2840 |
| 252 | Ga0157378_10023940 | 3300013297 | Bacteria | 5370 |
| 253 | Ga0157378_10027435 | 3300013297 | Bacteria | 5026 |
| 254 | Ga0163162_10000096 | 3300013306 | Bacteria | 80090 |
| 255 | Ga0163162_10000237 | 3300013306 | Bacteria | 50279 |
| 256 | Ga0163162_10001869 | 3300013306 | Bacteria | 19804 |
| 257 | Ga0163162_10002092 | 3300013306 | Bacteria | 18741 |
| 258 | Ga0163162_10021066 | 3300013306 | Bacteria | 6413 |
| 259 | Ga0163162_10266884 | 3300013306 | Bacteria | 1843 |
| 260 | Ga0157372_10001911 | 3300013307 | Bacteria | 22615 |
| 261 | Ga0157372_10004879 | 3300013307 | Bacteria | 14259 |
| 262 | Ga0157372_10043707 | 3300013307 | Bacteria | 4962 |
| 263 | Ga0157372_10084624 | 3300013307 | Bacteria | 3595 |
| 264 | Ga0157372_10122817 | 3300013307 | Bacteria | 2984 |
| 265 | Ga0157372_10123655 | 3300013307 | Bacteria | 2974 |
| 266 | Ga0157372_10133008 | 3300013307 | Bacteria | 2863 |
| 267 | Ga0157372_10182077 | 3300013307 | Bacteria | 2432 |
| 268 | Ga0157375_10000512 | 3300013308 | Bacteria | 34894 |
| 269 | Ga0157375_10000599 | 3300013308 | Bacteria | 31988 |
| 270 | Ga0157375_10004990 | 3300013308 | Bacteria | 11536 |
| 271 | Ga0157375_10045989 | 3300013308 | Bacteria | 4252 |
| 272 | Ga0157375_10057399 | 3300013308 | Bacteria | 3848 |
| 273 | Ga0157375_10058515 | 3300013308 | Bacteria | 3813 |
| 274 | Ga0157375_10096253 | 3300013308 | Bacteria | 3033 |
| 275 | Ga0157375_10191113 | 3300013308 | Bacteria | 2202 |
| 276 | Ga0163163_10000251 | 3300014325 | Bacteria | 54526 |
| 277 | Ga0163163_10000343 | 3300014325 | Bacteria | 44866 |
| 278 | Ga0163163_10000703 | 3300014325 | Bacteria | 28430 |
| 279 | Ga0163163_10065499 | 3300014325 | Bacteria | 3607 |
| 280 | Ga0163163_10081529 | 3300014325 | Bacteria | 3237 |
| 281 | Ga0163163_10290409 | 3300014325 | Bacteria | 1687 |
| 282 | Ga0163163_10356475 | 3300014325 | Unclassified | 1519 |
| 283 | Ga0157380_10028049 | 3300014326 | Bacteria | 4289 |
| 284 | Ga0157380_10370000 | 3300014326 | Bacteria | 1348 |
| 285 | Ga0157377_10013019 | 3300014745 | Bacteria | 4200 |
| 286 | Ga0157377_10037406 | 3300014745 | Bacteria | 2674 |
| 287 | Ga0157379_10000128 | 3300014968 | Bacteria | 53403 |
| 288 | Ga0157379_10022805 | 3300014968 | Bacteria | 5548 |
| 289 | Ga0157376_10000971 | 3300014969 | Bacteria | 18693 |
| 290 | Ga0157376_10001725 | 3300014969 | Bacteria | 14540 |
| 291 | Ga0157376_10002110 | 3300014969 | Bacteria | 13382 |
| 292 | Ga0157376_10048324 | 3300014969 | Bacteria | 3518 |
| 293 | Ga0157376_10120861 | 3300014969 | Bacteria | 2321 |
| 294 | Ga0157376_10136876 | 3300014969 | Bacteria | 2193 |
| 295 | Ga0157376_10257764 | 3300014969 | Bacteria | 1632 |
| 296 | Ga0163161_10008813 | 3300017792 | Bacteria | 6974 |
| 297 | Ga0163161_10017752 | 3300017792 | Bacteria | 4985 |
| 298 | Ga0213876_10001503 | 3300021384 | Bacteria | 14453 |
| 299 | Ga0209436_100675 | 3300025208 | Bacteria | 14517 |
| 300 | Ga0209436_101411 | 3300025208 | Bacteria | 8449 |
| 301 | Ga0209258_100302 | 3300025242 | Bacteria | 79794 |
| 302 | Ga0209646_1000004 | 3300025246 | Bacteria | 786587 |
| 303 | Ga0209646_1001797 | 3300025246 | Bacteria | 5351 |
| 304 | Ga0209026_1000095 | 3300025250 | Bacteria | 164309 |
| 305 | Ga0209148_1000131 | 3300025254 | Bacteria | 174079 |
| 306 | Ga0209673_1000078 | 3300025273 | Bacteria | 227727 |
| 307 | Ga0209130_1000611 | 3300025284 | Bacteria | 34241 |
| 308 | Ga0209564_1003616 | 3300025295 | Bacteria | 10288 |
| 309 | Ga0209564_1004884 | 3300025295 | Bacteria | 7950 |
| 310 | Ga0209758_1005348 | 3300025297 | Bacteria | 9961 |
| 311 | Ga0209758_1005622 | 3300025297 | Bacteria | 9519 |
| 312 | Ga0209758_1009342 | 3300025297 | Bacteria | 6116 |
| 313 | Ga0209050_1000097 | 3300025298 | Bacteria | 239919 |
| 314 | Ga0207426_1000033 | 3300025302 | Bacteria | 455976 |
| 315 | Ga0207426_1000040 | 3300025302 | Bacteria | 433920 |
| 316 | Ga0207426_1000313 | 3300025302 | Bacteria | 94934 |
| 317 | Ga0207426_1000541 | 3300025302 | Bacteria | 54110 |
| 318 | Ga0209257_1000070 | 3300025304 | Bacteria | 336454 |
| 319 | Ga0209257_1004414 | 3300025304 | Bacteria | 10921 |
| 320 | Ga0207656_10001991 | 3300025321 | Bacteria | 6804 |
| 321 | Ga0207710_10003686 | 3300025900 | Bacteria | 6791 |
| 322 | Ga0207710_10008208 | 3300025900 | Bacteria | 4409 |
| 323 | Ga0207688_10005557 | 3300025901 | Bacteria | 6855 |
| 324 | Ga0207680_10000014 | 3300025903 | Bacteria | 179035 |
| 325 | Ga0207680_10000223 | 3300025903 | Bacteria | 27399 |
| 326 | Ga0207680_10008850 | 3300025903 | Bacteria | 4963 |
| 327 | Ga0207647_10031525 | 3300025904 | Bacteria | 3410 |
| 328 | Ga0207647_10077389 | 3300025904 | Bacteria | 1999 |
| 329 | Ga0207645_10000193 | 3300025907 | Bacteria | 49552 |
| 330 | Ga0207645_10002708 | 3300025907 | Bacteria | 13802 |
| 331 | Ga0207645_10055658 | 3300025907 | Unclassified | 2525 |
| 332 | Ga0207643_10001613 | 3300025908 | Bacteria | 12724 |
| 333 | Ga0207705_10001296 | 3300025909 | Bacteria | 20071 |
| 334 | Ga0207654_10000267 | 3300025911 | Bacteria | 31855 |
| 335 | Ga0207654_10001931 | 3300025911 | Bacteria | 10741 |
| 336 | Ga0207707_10000026 | 3300025912 | Bacteria | 175026 |
| 337 | Ga0207707_10000067 | 3300025912 | Bacteria | 105764 |
| 338 | Ga0207695_10000041 | 3300025913 | Bacteria | 450902 |
| 339 | Ga0207695_10000209 | 3300025913 | Bacteria | 157802 |
| 340 | Ga0207695_10000300 | 3300025913 | Bacteria | 122104 |
| 341 | Ga0207695_10000365 | 3300025913 | Bacteria | 103398 |
| 342 | Ga0207695_10000483 | 3300025913 | Bacteria | 85395 |
| 343 | Ga0207695_10014824 | 3300025913 | Bacteria | 9207 |
| 344 | Ga0207695_10036840 | 3300025913 | Bacteria | 5283 |
| 345 | Ga0207695_10071261 | 3300025913 | Bacteria | 3550 |
| 346 | Ga0207695_10252253 | 3300025913 | Bacteria | 1664 |
| 347 | Ga0207671_10000650 | 3300025914 | Bacteria | 45400 |
| 348 | Ga0207671_10000746 | 3300025914 | Bacteria | 41287 |
| 349 | Ga0207671_10001292 | 3300025914 | Bacteria | 29407 |
| 350 | Ga0207671_10004601 | 3300025914 | Bacteria | 13097 |
| 351 | Ga0207671_10017675 | 3300025914 | Bacteria | 5493 |
| 352 | Ga0207671_10030627 | 3300025914 | Bacteria | 4011 |
| 353 | Ga0207671_10097972 | 3300025914 | Bacteria | 2217 |
| 354 | Ga0207660_10000165 | 3300025917 | Bacteria | 41631 |
| 355 | Ga0207662_10045061 | 3300025918 | Bacteria | 2606 |
| 356 | Ga0207657_10106125 | 3300025919 | Bacteria | 2324 |
| 357 | Ga0207649_10001123 | 3300025920 | Bacteria | 16235 |
| 358 | Ga0207652_10000109 | 3300025921 | Bacteria | 89337 |
| 359 | Ga0207646_10071629 | 3300025922 | Bacteria | 3096 |
| 360 | Ga0207694_10012170 | 3300025924 | Bacteria | 6487 |
| 361 | Ga0207694_10090634 | 3300025924 | Bacteria | 2412 |
| 362 | Ga0207650_10176392 | 3300025925 | Bacteria | 1701 |
| 363 | Ga0207659_10033525 | 3300025926 | Bacteria | 3535 |
| 364 | Ga0207659_10049252 | 3300025926 | Bacteria | 2988 |
| 365 | Ga0207687_10032775 | 3300025927 | Bacteria | 3520 |
| 366 | Ga0207687_10074837 | 3300025927 | Unclassified | 2428 |
| 367 | Ga0207644_10062203 | 3300025931 | Bacteria | 2706 |
| 368 | Ga0207644_10269886 | 3300025931 | Bacteria | 1363 |
| 369 | Ga0207690_10172279 | 3300025932 | Bacteria | 1623 |
| 370 | Ga0207706_10003423 | 3300025933 | Bacteria | 15150 |
| 371 | Ga0207706_10004991 | 3300025933 | Bacteria | 12392 |
| 372 | Ga0207706_10045685 | 3300025933 | Bacteria | 3879 |
| 373 | Ga0207670_10028798 | 3300025936 | Bacteria | 3531 |
| 374 | Ga0207704_10001257 | 3300025938 | Bacteria | 11322 |
| 375 | Ga0207691_10000057 | 3300025940 | Bacteria | 89823 |
| 376 | Ga0207691_10002498 | 3300025940 | Bacteria | 17985 |
| 377 | Ga0207691_10027457 | 3300025940 | Bacteria | 5336 |
| 378 | Ga0207691_10176648 | 3300025940 | Bacteria | 1867 |
| 379 | Ga0207689_10001011 | 3300025942 | Bacteria | 27034 |
| 380 | Ga0207689_10001062 | 3300025942 | Bacteria | 26443 |
| 381 | Ga0207689_10002471 | 3300025942 | Bacteria | 17199 |
| 382 | Ga0207689_10009342 | 3300025942 | Bacteria | 8473 |
| 383 | Ga0207661_10001596 | 3300025944 | Bacteria | 15402 |
| 384 | Ga0207679_10000768 | 3300025945 | Bacteria | 21047 |
| 385 | Ga0207679_10143315 | 3300025945 | Bacteria | 1934 |
| 386 | Ga0207667_10000902 | 3300025949 | Bacteria | 37879 |
| 387 | Ga0207667_10005516 | 3300025949 | Bacteria | 15432 |
| 388 | Ga0207667_10023943 | 3300025949 | Bacteria | 6717 |
| 389 | Ga0207667_10110908 | 3300025949 | Bacteria | 2830 |
| 390 | Ga0207667_10119567 | 3300025949 | Bacteria | 2715 |
| 391 | Ga0207651_10000330 | 3300025960 | Bacteria | 20100 |
| 392 | Ga0207651_10053824 | 3300025960 | Bacteria | 2754 |
| 393 | Ga0207712_10001226 | 3300025961 | Bacteria | 17716 |
| 394 | Ga0207712_10004325 | 3300025961 | Bacteria | 8970 |
| 395 | Ga0207712_10007476 | 3300025961 | Bacteria | 6898 |
| 396 | Ga0207712_10036310 | 3300025961 | Bacteria | 3355 |
| 397 | Ga0207712_10132861 | 3300025961 | Bacteria | 1899 |
| 398 | Ga0207712_10196381 | 3300025961 | Bacteria | 1596 |
| 399 | Ga0207668_10000170 | 3300025972 | Bacteria | 45140 |
| 400 | Ga0207668_10048121 | 3300025972 | Bacteria | 2924 |
| 401 | Ga0207668_10050564 | 3300025972 | Bacteria | 2865 |
| 402 | Ga0207640_10017137 | 3300025981 | Bacteria | 4232 |
| 403 | Ga0207640_10041378 | 3300025981 | Bacteria | 2930 |
| 404 | Ga0207658_10003501 | 3300025986 | Bacteria | 11076 |
| 405 | Ga0207658_10069821 | 3300025986 | Bacteria | 2656 |
| 406 | Ga0207658_10098934 | 3300025986 | Unclassified | 2280 |
| 407 | Ga0207677_10011555 | 3300026023 | Bacteria | 5041 |
| 408 | Ga0207677_10011966 | 3300026023 | Bacteria | 4969 |
| 409 | Ga0207677_10135180 | 3300026023 | Bacteria | 1879 |
| 410 | Ga0207703_10001287 | 3300026035 | Bacteria | 23239 |
| 411 | Ga0207703_10009204 | 3300026035 | Bacteria | 7767 |
| 412 | Ga0207703_10097482 | 3300026035 | Bacteria | 2484 |
| 413 | Ga0207639_10000365 | 3300026041 | Bacteria | 31332 |
| 414 | Ga0207639_10001406 | 3300026041 | Bacteria | 16243 |
| 415 | Ga0207639_10013395 | 3300026041 | Bacteria | 5740 |
| 416 | Ga0207639_10016897 | 3300026041 | Bacteria | 5169 |
| 417 | Ga0207639_10019658 | 3300026041 | Bacteria | 4821 |
| 418 | Ga0207639_10020656 | 3300026041 | Bacteria | 4717 |
| 419 | Ga0207639_10059847 | 3300026041 | Bacteria | 2936 |
| 420 | Ga0207639_10066112 | 3300026041 | Bacteria | 2809 |
| 421 | Ga0207678_10293046 | 3300026067 | Bacteria | 1398 |
| 422 | Ga0207702_10024235 | 3300026078 | Bacteria | 5035 |
| 423 | Ga0207702_10030893 | 3300026078 | Bacteria | 4464 |
| 424 | Ga0207641_10000015 | 3300026088 | Bacteria | 321332 |
| 425 | Ga0207641_10075219 | 3300026088 | Bacteria | 2916 |
| 426 | Ga0207648_10000914 | 3300026089 | Bacteria | 33242 |
| 427 | Ga0207648_10003815 | 3300026089 | Bacteria | 15758 |
| 428 | Ga0207648_10018863 | 3300026089 | Bacteria | 6233 |
| 429 | Ga0207648_10141101 | 3300026089 | Bacteria | 2123 |
| 430 | Ga0207676_10002484 | 3300026095 | Bacteria | 13139 |
| 431 | Ga0207676_10005366 | 3300026095 | Bacteria | 9077 |
| 432 | Ga0207676_10009485 | 3300026095 | Bacteria | 6928 |
| 433 | Ga0207676_10022662 | 3300026095 | Bacteria | 4620 |
| 434 | Ga0207676_10224315 | 3300026095 | Bacteria | 1676 |
| 435 | Ga0207674_10012617 | 3300026116 | Bacteria | 9444 |
| 436 | Ga0207674_10062236 | 3300026116 | Unclassified | 3769 |
| 437 | Ga0207674_10117376 | 3300026116 | Bacteria | 2631 |
| 438 | Ga0207674_10248285 | 3300026116 | Bacteria | 1726 |
| 439 | Ga0207674_10278091 | 3300026116 | Bacteria | 1622 |
| 440 | Ga0207675_100121016 | 3300026118 | Unclassified | 2476 |
| 441 | Ga0207675_100335664 | 3300026118 | Bacteria | 1478 |
| 442 | Ga0207683_10005618 | 3300026121 | Bacteria | 10757 |
| 443 | Ga0207683_10054292 | 3300026121 | Bacteria | 3514 |
| 444 | Ga0207683_10198414 | 3300026121 | Bacteria | 1823 |
| 445 | Ga0207698_10001356 | 3300026142 | Bacteria | 14268 |
| 446 | Ga0207698_10013713 | 3300026142 | Bacteria | 5360 |
| 447 | Ga0207698_10356267 | 3300026142 | Bacteria | 1384 |
| 448 | Ga0268266_10000104 | 3300028379 | Bacteria | 178320 |
| 449 | Ga0268266_10016754 | 3300028379 | Bacteria | 6265 |
| 450 | Ga0268265_10041574 | 3300028380 | Bacteria | 3404 |
| 451 | Ga0268264_10000028 | 3300028381 | Bacteria | 426662 |
| 452 | Ga0268264_10003959 | 3300028381 | Bacteria | 12685 |
| 453 | Ga0268264_10003990 | 3300028381 | Bacteria | 12636 |
| 454 | Ga0268264_10005074 | 3300028381 | Bacteria | 11154 |
| 455 | Ga0268264_10010286 | 3300028381 | Bacteria | 7744 |
| 456 | Ga0268264_10031862 | 3300028381 | Bacteria | 4324 |
| 457 | Ga0307517_10001269 | 3300028786 | Bacteria | 42402 |
| 458 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 459 | Ga0307515_10000118 | 3300028794 | Bacteria | 190444 |
| 460 | Ga0307511_10000002 | 3300030521 | Bacteria | 199923 |
| 461 | Ga0265327_10000024 | 3300031251 | Bacteria | 382499 |
| 462 | Ga0265327_10000030 | 3300031251 | Bacteria | 333531 |
| 463 | Ga0265327_10000089 | 3300031251 | Bacteria | 197227 |
| 464 | Ga0265327_10029361 | 3300031251 | Bacteria | 3129 |
| 465 | Ga0265316_10146743 | 3300031344 | Bacteria | 1769 |
| 466 | Ga0307513_10178640 | 3300031456 | Bacteria | 1989 |
| 467 | Ga0307509_10027688 | 3300031507 | Bacteria | 6305 |
| 468 | Ga0307509_10048189 | 3300031507 | Bacteria | 4578 |
| 469 | Ga0307509_10094673 | 3300031507 | Bacteria | 3045 |
| 470 | Ga0307508_10052570 | 3300031616 | Bacteria | 3617 |
| 471 | Ga0316576_10186613 | 3300031727 | Bacteria | 1564 |
| 472 | Ga0307516_10003475 | 3300031730 | Bacteria | 20196 |
| 473 | Ga0307516_10097703 | 3300031730 | Bacteria | 2756 |
| 474 | Ga0307413_10241963 | 3300031824 | Bacteria | 1333 |
| 475 | Ga0307510_10000141 | 3300033180 | Bacteria | 59562 |
| 476 | Ga0316574_0033167 | 3300035398 | Unclassified | 3143 |
| 477 | Ga0373927_0012939 | 3300035695 | Bacteria | 5549 |
| 478 | Ga0395905_0013037 | 3300037471 | Bacteria | 7985 |
| 479 | Ga0395905_0058158 | 3300037471 | Bacteria | 3616 |
| 480 | Ga0436365_0640323 | 3300039437 | Bacteria | 3205 |
| 481 | Ga0436365_1881620 | 3300039437 | Bacteria | 14517 |
| 482 | Ga0439436_0001889 | 3300041404 | Bacteria | 6185 |
| 483 | Ga0439439_0011411 | 3300041406 | Bacteria | 2138 |
| 484 | Ga0439449_0023477 | 3300042007 | Bacteria | 2306 |
| 485 | Ga0451577_0070836 | 3300042876 | Bacteria | 3109 |
| 486 | Ga0466969_0001216 | 3300044656 | Bacteria | 13901 |
| 487 | Ga0466969_0106721 | 3300044656 | Bacteria | 1314 |
| 488 | Ga0466972_0000009 | 3300044658 | Bacteria | 256374 |
| 489 | Ga0466972_0000069 | 3300044658 | Bacteria | 100746 |
| 490 | Ga0466972_0006015 | 3300044658 | Bacteria | 6096 |
| 491 | Ga0466972_0042810 | 3300044658 | Bacteria | 2200 |
| 492 | Ga0466965_0042212 | 3300044683 | Bacteria | 2249 |
| 493 | Ga0466966_0000184 | 3300044684 | Bacteria | 41499 |
| 494 | Ga0466966_0062828 | 3300044684 | Bacteria | 2341 |
| 495 | Ga0466961_0018283 | 3300044693 | Unclassified | 4506 |
| 496 | Ga0466971_0017484 | 3300044719 | Unclassified | 3173 |
| 497 | Ga0466971_0058830 | 3300044719 | Bacteria | 1735 |
| 498 | Ga0466968_0018554 | 3300044735 | Bacteria | 2791 |
| 499 | Ga0466968_0036057 | 3300044735 | Bacteria | 2071 |
| 500 | Ga0466970_0002738 | 3300044765 | Bacteria | 8521 |
| 501 | Ga0466957_0000547 | 3300044842 | Bacteria | 18983 |
| 502 | Ga0466957_0001692 | 3300044842 | Bacteria | 11593 |
| 503 | Ga0466959_0000097 | 3300045049 | Bacteria | 55620 |
| 504 | Ga0466959_0000330 | 3300045049 | Bacteria | 27908 |
| 505 | Ga0466959_0011869 | 3300045049 | Bacteria | 6275 |
| 506 | Ga0466958_0013461 | 3300045836 | Unclassified | 4658 |
| 507 | Ga0495627_006679 | 3300046453 | Bacteria | 4493 |
| 508 | Ga0495638_0015704 | 3300046460 | Bacteria | 5079 |
| 509 | Ga0495638_0110135 | 3300046460 | Bacteria | 1636 |
| 510 | Ga0495606_0004246 | 3300046507 | Bacteria | 14488 |
| 511 | Ga0495648_0018192 | 3300046524 | Bacteria | 4991 |
| 512 | Ga0495633_0000125 | 3300046558 | Bacteria | 104459 |
| 513 | Ga0495668_0000068 | 3300046616 | Bacteria | 176297 |
| 514 | Ga0495668_0001044 | 3300046616 | Bacteria | 29358 |
| 515 | Ga0495611_0000030 | 3300046648 | Bacteria | 111786 |
| 516 | Ga0495625_0045225 | 3300046660 | Bacteria | 3184 |
| 517 | Ga0495658_0011489 | 3300046683 | Bacteria | 4455 |
| 518 | Ga0495670_0016797 | 3300046691 | Bacteria | 3599 |
| 519 | Ga0495649_0005129 | 3300046694 | Bacteria | 8404 |
| 520 | Ga0495636_0000006 | 3300047318 | Bacteria | 107323 |
| 521 | Ga0495672_0013217 | 3300047320 | Bacteria | 5705 |
| 522 | Ga0495672_0105770 | 3300047320 | Unclassified | 1518 |
| 523 | Ga0495687_000726 | 3300047443 | Bacteria | 36440 |
| 524 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 525 | Ga0495686_0002275 | 3300047472 | Bacteria | 18481 |
| 526 | Ga0495686_0014570 | 3300047472 | Bacteria | 5408 |
| 527 | Ga0496101_0075668 | 3300048904 | Bacteria | 2479 |
| 528 | Ga0496109_0037417 | 3300048912 | Bacteria | 4384 |
| 529 | Ga0496115_0024727 | 3300048918 | Bacteria | 4671 |
| 530 | Ga0496115_0306375 | 3300048918 | Bacteria | 1301 |
| 531 | Ga0496121_0000081 | 3300048924 | Bacteria | 229506 |
| 532 | Ga0496126_0012204 | 3300048929 | Bacteria | 8815 |
| 533 | Ga0501290_002934 | 3300049513 | Bacteria | 2170 |
| 534 | Ga0501298_003101 | 3300049521 | Bacteria | 2562 |
| 535 | Ga0501031_0017714 | 3300049568 | Bacteria | 4631 |
| 536 | Ga0501031_0058919 | 3300049568 | Bacteria | 2503 |
| 537 | Ga0501032_0002853 | 3300049569 | Bacteria | 13437 |
| 538 | Ga0501032_0003088 | 3300049569 | Bacteria | 12847 |
| 539 | Ga0501033_0027388 | 3300049570 | Bacteria | 4285 |
| 540 | Ga0501034_0003412 | 3300049571 | Bacteria | 18136 |
| 541 | Ga0501034_0005631 | 3300049571 | Bacteria | 13642 |
| 542 | Ga0501034_0118034 | 3300049571 | Bacteria | 2640 |
| 543 | Ga0501034_0149085 | 3300049571 | Unclassified | 2315 |
| 544 | Ga0501034_0280332 | 3300049571 | Bacteria | 1606 |
| 545 | Ga0501036_0055222 | 3300049572 | Bacteria | 3364 |
| 546 | Ga0501037_0012585 | 3300049573 | Bacteria | 6235 |
| 547 | Ga0501037_0012956 | 3300049573 | Bacteria | 6146 |
| 548 | Ga0501038_0021860 | 3300049574 | Bacteria | 5737 |
| 549 | Ga0501039_0029637 | 3300049575 | Bacteria | 4215 |
| 550 | Ga0501039_0048947 | 3300049575 | Bacteria | 3267 |
| 551 | Ga0501043_0007087 | 3300049579 | Bacteria | 8920 |
| 552 | Ga0501043_0014684 | 3300049579 | Bacteria | 6131 |
| 553 | Ga0501046_0047480 | 3300049580 | Bacteria | 3403 |
| 554 | Ga0501047_0015592 | 3300049581 | Bacteria | 7241 |
| 555 | Ga0501047_0034176 | 3300049581 | Bacteria | 4909 |
| 556 | Ga0501047_0182245 | 3300049581 | Bacteria | 1966 |
| 557 | Ga0501047_0200168 | 3300049581 | Bacteria | 1858 |
| 558 | Ga0501069_0067223 | 3300049585 | Unclassified | 2004 |
| 559 | Ga0501070_0044503 | 3300049586 | Bacteria | 3693 |
| 560 | Ga0501072_0130464 | 3300049588 | Bacteria | 2003 |
| 561 | Ga0501073_0014474 | 3300049589 | Bacteria | 5731 |
| 562 | Ga0501074_0004892 | 3300049590 | Bacteria | 9607 |
| 563 | Ga0501201_000464 | 3300049651 | Bacteria | 3750 |
| 564 | Ga0501202_000794 | 3300049652 | Bacteria | 4737 |
| 565 | Ga0501207_000187 | 3300049654 | Bacteria | 5981 |
| 566 | Ga0501233_000637 | 3300049668 | Bacteria | 5732 |
| 567 | Ga0501235_000793 | 3300049669 | Bacteria | 6445 |
| 568 | Ga0501243_001403 | 3300049675 | Bacteria | 3443 |
| 569 | Ga0501251_000790 | 3300049681 | Bacteria | 2885 |
| 570 | Ga0501257_005343 | 3300049686 | Bacteria | 2827 |
| 571 | Ga0501257_013353 | 3300049686 | Bacteria | 1883 |
| 572 | Ga0501259_000269 | 3300049688 | Bacteria | 8184 |
| 573 | Ga0501259_004965 | 3300049688 | Bacteria | 2110 |
| 574 | Ga0501261_003861 | 3300049690 | Bacteria | 1838 |
| 575 | Ga0501221_001602 | 3300049704 | Bacteria | 3759 |
| 576 | Ga0501225_0000322 | 3300049705 | Bacteria | 15026 |
| 577 | Ga0501225_0000930 | 3300049705 | Bacteria | 9128 |
| 578 | Ga0501225_0034088 | 3300049705 | Bacteria | 1402 |
| 579 | Ga0501234_001438 | 3300049707 | Bacteria | 3740 |
| 580 | Ga0501245_000749 | 3300049708 | Bacteria | 4030 |
| 581 | Ga0501079_0046745 | 3300049741 | Bacteria | 3340 |
| 582 | Ga0501080_0090747 | 3300049742 | Bacteria | 2837 |
| 583 | Ga0501080_0208765 | 3300049742 | Bacteria | 1790 |
| 584 | Ga0501080_0217623 | 3300049742 | Unclassified | 1748 |
| 585 | Ga0501080_0269541 | 3300049742 | Bacteria | 1550 |
| 586 | Ga0501083_0012439 | 3300049744 | Bacteria | 5955 |
| 587 | Ga0501241_002043 | 3300049758 | Bacteria | 3953 |
| 588 | Ga0501279_006477 | 3300049775 | Bacteria | 1547 |
| 589 | Ga0501035_0007031 | 3300049822 | Bacteria | 10516 |
| 590 | Ga0501035_0071510 | 3300049822 | Bacteria | 3071 |
| 591 | Ga0501035_0102324 | 3300049822 | Bacteria | 2513 |
| 592 | Ga0501044_0001096 | 3300049823 | Bacteria | 32262 |
| 593 | Ga0501044_0155196 | 3300049823 | Bacteria | 2269 |
| 594 | Ga0501044_0182384 | 3300049823 | Bacteria | 2065 |
| 595 | Ga0501044_0259217 | 3300049823 | Unclassified | 1677 |
| 596 | Ga0501212_002597 | 3300049851 | Bacteria | 2195 |
| 597 | Ga0501284_00002 | 3300050005 | Bacteria | 220402 |
| 598 | nmdc:mga0k408_5491_c1 | 3300050493 | Bacteria | 6749 |
| 599 | nmdc:mga05p37_1224_c1 | 3300050507 | Bacteria | 29706 |
| 600 | nmdc:mga06r32_1494_c1 | 3300050510 | Bacteria | 21025 |
| 601 | nmdc:mga08y16_23475_c1 | 3300050511 | Bacteria | 6515 |
| 602 | nmdc:mga0n895_115623_c1 | 3300050512 | Bacteria | 2701 |
| 603 | Ga0500578_0005247 | 3300053086 | Bacteria | 8855 |
| 604 | Ga0500644_0000026 | 3300053088 | Bacteria | 93328 |
| 605 | Ga0500583_0000078 | 3300053092 | Bacteria | 58451 |
| 606 | Ga0500583_0004221 | 3300053092 | Bacteria | 4649 |
| 607 | Ga0500583_0008611 | 3300053092 | Bacteria | 3673 |
| 608 | Ga0500583_0034389 | 3300053092 | Bacteria | 2252 |
| 609 | Ga0500562_000012 | 3300053108 | Bacteria | 168210 |
| 610 | Ga0500607_042901 | 3300053121 | Bacteria | 2441 |
| 611 | Ga0500652_014362 | 3300053131 | Bacteria | 2829 |
| 612 | Ga0500658_0002669 | 3300053134 | Bacteria | 6853 |
| 613 | Ga0500559_0010116 | 3300053136 | Bacteria | 4060 |
| 614 | Ga0500568_0006319 | 3300053139 | Bacteria | 5962 |
| 615 | Ga0500577_0002713 | 3300053142 | Bacteria | 4545 |
| 616 | Ga0500588_0002193 | 3300053146 | Bacteria | 3916 |
| 617 | Ga0500590_017376 | 3300053148 | Bacteria | 3719 |
| 618 | Ga0500616_0002242 | 3300053153 | Bacteria | 16521 |
| 619 | Ga0500616_0016419 | 3300053153 | Unclassified | 4215 |
| 620 | Ga0500622_0000404 | 3300053156 | Bacteria | 41279 |
| 621 | Ga0500622_0000692 | 3300053156 | Bacteria | 29667 |
| 622 | Ga0500622_0002382 | 3300053156 | Bacteria | 13624 |
| 623 | Ga0500636_0012621 | 3300053177 | Bacteria | 4953 |
| 624 | Ga0500611_000038 | 3300053727 | Bacteria | 71407 |
| 625 | Ga0500661_000803 | 3300055283 | Bacteria | 5843 |
| 626 | Ga0466962_0006433 | 3300061719 | Bacteria | 5639 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049758 | Ga0501241_002043 | Ga0501241_002043_17_1135 | 360 |
| 2 | 3300028794 | Ga0307515_10000118 | Ga0307515_1000011845 | 374 |
| 3 | 3300006871 | Ga0075434_100004332 | Ga0075434_10000433215 | 375 |
| 4 | 3300050512 | nmdc:mga0n895_115623_c1 | nmdc:mga0n895_115623_c1_1189_2406 | 375 |
| 5 | 3300044656 | Ga0466969_0106721 | Ga0466969_0106721_96_1286 | 376 |
| 6 | 3300047472 | Ga0495686_0002275 | Ga0495686_0002275_17032_18225 | 376 |
| 7 | 3300048918 | Ga0496115_0306375 | Ga0496115_0306375_143_1285 | 378 |
| 8 | 3300048904 | Ga0496101_0075668 | Ga0496101_0075668_1302_2447 | 379 |
| 9 | 3300053139 | Ga0500568_0006319 | Ga0500568_0006319_4805_5950 | 379 |
| 10 | 3300048912 | Ga0496109_0037417 | Ga0496109_0037417_19_1191 | 380 |
| 11 | 3300049686 | Ga0501257_013353 | Ga0501257_013353_88_1236 | 380 |
| 12 | 3300049588 | Ga0501072_0130464 | Ga0501072_0130464_336_1553 | 381 |
| 13 | 3300049742 | Ga0501080_0208765 | Ga0501080_0208765_132_1349 | 381 |
| 14 | 3300025904 | Ga0207647_10077389 | Ga0207647_100773892 | 382 |
| 15 | 3300046616 | Ga0495668_0000068 | Ga0495668_0000068_70248_71438 | 382 |
| 16 | 3300035695 | Ga0373927_0012939 | Ga0373927_0012939_2297_3514 | 383 |
| 17 | 3300053153 | Ga0500616_0002242 | Ga0500616_0002242_483_1673 | 384 |
| 18 | 3300003794 | Ga0055531_10000054 | Ga0055531_1000005453 | 385 |
| 19 | 3300025304 | Ga0209257_1000070 | Ga0209257_100007055 | 385 |
| 20 | 3300044658 | Ga0466972_0042810 | Ga0466972_0042810_1026_2189 | 385 |
| 21 | 3300053156 | Ga0500622_0000692 | Ga0500622_0000692_4612_5802 | 385 |
| 22 | 3300003320 | rootH2_10048291 | rootH2_1004829112 | 386 |
| 23 | 3300001989 | JGI24739J22299_10000062 | JGI24739J22299_1000006235 | 387 |
| 24 | 3300003354 | JGI25160J50197_1005193 | JGI25160J50197_10051932 | 387 |
| 25 | 3300003771 | Ga0055526_1018422 | Ga0055526_10184223 | 387 |
| 26 | 3300003771 | Ga0055526_1033615 | Ga0055526_10336151 | 387 |
| 27 | 3300003790 | Ga0055528_1003039 | Ga0055528_10030395 | 387 |
| 28 | 3300003791 | Ga0055530_10000118 | Ga0055530_1000011854 | 387 |
| 29 | 3300003794 | Ga0055531_10029799 | Ga0055531_100297992 | 387 |
| 30 | 3300005262 | Ga0065165_1000027 | Ga0065165_100002796 | 387 |
| 31 | 3300025273 | Ga0209673_1000078 | Ga0209673_1000078196 | 387 |
| 32 | 3300025295 | Ga0209564_1003616 | Ga0209564_10036164 | 387 |
| 33 | 3300025295 | Ga0209564_1004884 | Ga0209564_100488412 | 387 |
| 34 | 3300025297 | Ga0209758_1005348 | Ga0209758_100534811 | 387 |
| 35 | 3300025297 | Ga0209758_1005622 | Ga0209758_10056227 | 387 |
| 36 | 3300025298 | Ga0209050_1000097 | Ga0209050_1000097210 | 387 |
| 37 | 3300025302 | Ga0207426_1000541 | Ga0207426_100054112 | 387 |
| 38 | 3300025304 | Ga0209257_1004414 | Ga0209257_100441414 | 387 |
| 39 | 3300001979 | JGI24740J21852_10000359 | JGI24740J21852_1000035910 | 389 |
| 40 | 3300002738 | JGI25154J39366_1000023 | JGI25154J39366_1000023120 | 389 |
| 41 | 3300002741 | JGI25157J39369_1008966 | JGI25157J39369_10089661 | 389 |
| 42 | 3300003215 | JGI25153J46596_10016298 | JGI25153J46596_100162982 | 389 |
| 43 | 3300003354 | JGI25160J50197_1010215 | JGI25160J50197_10102153 | 389 |
| 44 | 3300005577 | Ga0068857_100084803 | Ga0068857_1000848033 | 389 |
| 45 | 3300013104 | Ga0157370_10081369 | Ga0157370_100813692 | 389 |
| 46 | 3300025246 | Ga0209646_1000004 | Ga0209646_1000004478 | 389 |
| 47 | 3300025250 | Ga0209026_1000095 | Ga0209026_100009586 | 389 |
| 48 | 3300025297 | Ga0209758_1009342 | Ga0209758_10093422 | 389 |
| 49 | 3300025302 | Ga0207426_1000313 | Ga0207426_10003139 | 389 |
| 50 | 3300026116 | Ga0207674_10278091 | Ga0207674_102780912 | 389 |
| 51 | 3300049581 | Ga0501047_0034176 | Ga0501047_0034176_1444_2634 | 389 |
| 52 | 3300049822 | Ga0501035_0102324 | Ga0501035_0102324_867_2057 | 389 |
| 53 | 3300053088 | Ga0500644_0000026 | Ga0500644_0000026_38525_39715 | 389 |
| 54 | 3300053092 | Ga0500583_0004221 | Ga0500583_0004221_1536_2726 | 389 |
| 55 | 3300053131 | Ga0500652_014362 | Ga0500652_014362_737_1927 | 389 |
| 56 | 3300053136 | Ga0500559_0010116 | Ga0500559_0010116_313_1503 | 389 |
| 57 | 3300053142 | Ga0500577_0002713 | Ga0500577_0002713_2548_3738 | 389 |
| 58 | 3300053148 | Ga0500590_017376 | Ga0500590_017376_815_2005 | 389 |
| 59 | 3300053177 | Ga0500636_0012621 | Ga0500636_0012621_954_2144 | 389 |
| 60 | 3300010375 | Ga0105239_10004942 | Ga0105239_1000494216 | 390 |
| 61 | 3300031251 | Ga0265327_10000089 | Ga0265327_1000008958 | 390 |
| 62 | 3300031730 | Ga0307516_10003475 | Ga0307516_1000347519 | 390 |
| 63 | iso_pu_bacteria | 2818991442 | 2819574897 | 390 |
| 64 | iso_pu_bacteria | 2818991460 | 2819676841 | 390 |
| 65 | iso_pu_bacteria | 2821136567 | 2821140997 | 390 |
| 66 | iso_pu_bacteria | 2840677318 | 2840678768 | 390 |
| 67 | iso_pu_bacteria | 2883068021 | 2883069580 | 390 |
| 68 | iso_pu_bacteria | 2884791551 | 2884796696 | 390 |
| 69 | iso_pu_bacteria | 2896085136 | 2896086586 | 390 |
| 70 | iso_pu_bacteria | 2896109856 | 2896113114 | 390 |
| 71 | iso_pu_bacteria | 2904467357 | 2904471497 | 390 |
| 72 | iso_pu_bacteria | 2929177148 | 2929177787 | 390 |
| 73 | iso_pu_bacteria | 2929239360 | 2929240150 | 390 |
| 74 | iso_pu_bacteria | 2929921140 | 2929921845 | 390 |
| 75 | iso_pu_bacteria | 2945977869 | 2945980134 | 390 |
| 76 | iso_pu_bacteria | 2946013367 | 2946014004 | 390 |
| 77 | iso_pu_bacteria | 8003151029 | 8003154086 | 390 |
| 78 | 3300031727 | Ga0316576_10186613 | Ga0316576_101866132 | 391 |
| 79 | 3300044719 | Ga0466971_0058830 | Ga0466971_0058830_197_1414 | 391 |
| 80 | 3300044842 | Ga0466957_0001692 | Ga0466957_0001692_9510_10727 | 391 |
| 81 | 3300053092 | Ga0500583_0008611 | Ga0500583_0008611_414_1631 | 391 |
| 82 | 3300005467 | Ga0070706_100128501 | Ga0070706_1001285012 | 392 |
| 83 | 3300013104 | Ga0157370_10005131 | Ga0157370_100051312 | 392 |
| 84 | 3300028786 | Ga0307517_10001269 | Ga0307517_1000126916 | 392 |
| 85 | 3300005468 | Ga0070707_100066480 | Ga0070707_1000664803 | 393 |
| 86 | 3300005468 | Ga0070707_100071522 | Ga0070707_1000715221 | 393 |
| 87 | 3300005614 | Ga0068856_100475293 | Ga0068856_1004752931 | 393 |
| 88 | 3300009545 | Ga0105237_10026005 | Ga0105237_100260052 | 393 |
| 89 | 3300025914 | Ga0207671_10017675 | Ga0207671_100176754 | 393 |
| 90 | 3300025922 | Ga0207646_10071629 | Ga0207646_100716291 | 393 |
| 91 | 3300031824 | Ga0307413_10241963 | Ga0307413_102419631 | 393 |
| 92 | 3300044656 | Ga0466969_0001216 | Ga0466969_0001216_856_2073 | 393 |
| 93 | 3300044684 | Ga0466966_0000184 | Ga0466966_0000184_23766_24983 | 393 |
| 94 | 3300045049 | Ga0466959_0000097 | Ga0466959_0000097_34686_35903 | 393 |
| 95 | 3300003316 | rootH1_10078655 | rootH1_100786551 | 394 |
| 96 | 3300003322 | rootL2_10052422 | rootL2_100524224 | 394 |
| 97 | 3300003761 | Ga0055535_1004409 | Ga0055535_10044093 | 394 |
| 98 | 3300025208 | Ga0209436_100675 | Ga0209436_1006755 | 394 |
| 99 | 3300025208 | Ga0209436_101411 | Ga0209436_1014114 | 394 |
| 100 | 3300025242 | Ga0209258_100302 | Ga0209258_10030234 | 394 |
| 101 | 3300025254 | Ga0209148_1000131 | Ga0209148_100013147 | 394 |
| 102 | 3300025284 | Ga0209130_1000611 | Ga0209130_100061117 | 394 |
| 103 | 3300025302 | Ga0207426_1000033 | Ga0207426_100003320 | 394 |
| 104 | 3300039437 | Ga0436365_0640323 | Ga0436365_0640323_1488_2705 | 394 |
| 105 | 3300045049 | Ga0466959_0011869 | Ga0466959_0011869_4520_5710 | 394 |
| 106 | 3300046453 | Ga0495627_006679 | Ga0495627_006679_1035_2255 | 394 |
| 107 | 3300046558 | Ga0495633_0000125 | Ga0495633_0000125_86270_87490 | 394 |
| 108 | 3300048924 | Ga0496121_0000081 | Ga0496121_0000081_43989_45179 | 394 |
| 109 | 3300048929 | Ga0496126_0012204 | Ga0496126_0012204_4636_5826 | 394 |
| 110 | 3300049571 | Ga0501034_0118034 | Ga0501034_0118034_370_1563 | 394 |
| 111 | 3300053121 | Ga0500607_042901 | Ga0500607_042901_74_1264 | 394 |
| 112 | 3300053134 | Ga0500658_0002669 | Ga0500658_0002669_2191_3381 | 394 |
| 113 | 3300055283 | Ga0500661_000803 | Ga0500661_000803_1434_2624 | 394 |
| 114 | 3300049705 | Ga0501225_0034088 | Ga0501225_0034088_18_1241 | 395 |
| 115 | 3300050005 | Ga0501284_00002 | Ga0501284_00002_189451_190674 | 395 |
| 116 | 3300005617 | Ga0068859_100000933 | Ga0068859_10000093324 | 396 |
| 117 | 3300006847 | Ga0075431_100001819 | Ga0075431_10000181918 | 396 |
| 118 | 3300006931 | Ga0097620_100000933 | Ga0097620_1000009338 | 396 |
| 119 | 3300035398 | Ga0316574_0033167 | Ga0316574_0033167_658_1851 | 396 |
| 120 | 3300013306 | Ga0163162_10021066 | Ga0163162_100210665 | 398 |
| 121 | 3300013308 | Ga0157375_10004990 | Ga0157375_100049906 | 398 |
| 122 | 3300014325 | Ga0163163_10356475 | Ga0163163_103564752 | 398 |
| 123 | 3300014968 | Ga0157379_10022805 | Ga0157379_100228053 | 398 |
| 124 | 3300025919 | Ga0207657_10106125 | Ga0207657_101061252 | 398 |
| 125 | 3300049571 | Ga0501034_0149085 | Ga0501034_0149085_635_1840 | 399 |
| 126 | 3300049742 | Ga0501080_0269541 | Ga0501080_0269541_213_1418 | 399 |
| 127 | 3300049823 | Ga0501044_0155196 | Ga0501044_0155196_181_1386 | 399 |
| 128 | 3300049823 | Ga0501044_0259217 | Ga0501044_0259217_265_1470 | 399 |
| 129 | iso_pu_bacteria | 2738541278 | 2738725230 | 399 |
| 130 | iso_pu_bacteria | 2818991444 | 2819586181 | 399 |
| 131 | iso_pu_bacteria | 2929154850 | 2929158904 | 399 |
| 132 | 3300025944 | Ga0207661_10001596 | Ga0207661_100015963 | 400 |
| 133 | 3300048918 | Ga0496115_0024727 | Ga0496115_0024727_3189_4394 | 400 |
| 134 | 3300005289 | Ga0065704_10129419 | Ga0065704_101294192 | 401 |
| 135 | 3300005290 | Ga0065712_10142763 | Ga0065712_101427631 | 401 |
| 136 | 3300005334 | Ga0068869_100001381 | Ga0068869_10000138115 | 401 |
| 137 | 3300005340 | Ga0070689_100013486 | Ga0070689_1000134867 | 401 |
| 138 | 3300005344 | Ga0070661_100019009 | Ga0070661_1000190095 | 401 |
| 139 | 3300005354 | Ga0070675_100094089 | Ga0070675_1000940891 | 401 |
| 140 | 3300005364 | Ga0070673_100232178 | Ga0070673_1002321781 | 401 |
| 141 | 3300005365 | Ga0070688_100014398 | Ga0070688_1000143984 | 401 |
| 142 | 3300005618 | Ga0068864_100008752 | Ga0068864_1000087529 | 401 |
| 143 | 3300006844 | Ga0075428_100257605 | Ga0075428_1002576051 | 401 |
| 144 | 3300006880 | Ga0075429_100127361 | Ga0075429_1001273613 | 401 |
| 145 | 3300009094 | Ga0111539_10035856 | Ga0111539_100358564 | 401 |
| 146 | 3300009147 | Ga0114129_10085891 | Ga0114129_100858914 | 401 |
| 147 | 3300013296 | Ga0157374_10001463 | Ga0157374_1000146323 | 401 |
| 148 | 3300013308 | Ga0157375_10058515 | Ga0157375_100585153 | 401 |
| 149 | 3300014325 | Ga0163163_10000343 | Ga0163163_1000034314 | 401 |
| 150 | 3300014745 | Ga0157377_10037406 | Ga0157377_100374063 | 401 |
| 151 | 3300025926 | Ga0207659_10033525 | Ga0207659_100335252 | 401 |
| 152 | 3300025933 | Ga0207706_10045685 | Ga0207706_100456852 | 401 |
| 153 | 3300025936 | Ga0207670_10028798 | Ga0207670_100287984 | 401 |
| 154 | 3300025940 | Ga0207691_10176648 | Ga0207691_101766481 | 401 |
| 155 | 3300025942 | Ga0207689_10001062 | Ga0207689_100010622 | 401 |
| 156 | 3300025945 | Ga0207679_10143315 | Ga0207679_101433152 | 401 |
| 157 | 3300025960 | Ga0207651_10053824 | Ga0207651_100538243 | 401 |
| 158 | 3300026067 | Ga0207678_10293046 | Ga0207678_102930461 | 401 |
| 159 | 3300026095 | Ga0207676_10022662 | Ga0207676_100226621 | 401 |
| 160 | 3300026116 | Ga0207674_10062236 | Ga0207674_100622363 | 401 |
| 161 | 3300047472 | Ga0495686_0000005 | Ga0495686_0000005_787110_788321 | 401 |
| 162 | 3300049569 | Ga0501032_0002853 | Ga0501032_0002853_51_1304 | 401 |
| 163 | 3300049570 | Ga0501033_0027388 | Ga0501033_0027388_2303_3610 | 401 |
| 164 | 3300049571 | Ga0501034_0003412 | Ga0501034_0003412_8183_9490 | 401 |
| 165 | 3300049573 | Ga0501037_0012956 | Ga0501037_0012956_511_1764 | 401 |
| 166 | 3300049579 | Ga0501043_0007087 | Ga0501043_0007087_3833_5044 | 401 |
| 167 | 3300049823 | Ga0501044_0001096 | Ga0501044_0001096_12893_14146 | 401 |
| 168 | 3300050510 | nmdc:mga06r32_1494_c1 | nmdc:mga06r32_1494_c1_6060_7271 | 401 |
| 169 | 3300050511 | nmdc:mga08y16_23475_c1 | nmdc:mga08y16_23475_c1_3165_4376 | 401 |
| 170 | 3300005328 | Ga0070676_10048392 | Ga0070676_100483922 | 402 |
| 171 | 3300005329 | Ga0070683_100001393 | Ga0070683_1000013934 | 402 |
| 172 | 3300005335 | Ga0070666_10108354 | Ga0070666_101083542 | 402 |
| 173 | 3300005340 | Ga0070689_100032797 | Ga0070689_1000327974 | 402 |
| 174 | 3300005344 | Ga0070661_100000700 | Ga0070661_1000007004 | 402 |
| 175 | 3300005353 | Ga0070669_100253945 | Ga0070669_1002539451 | 402 |
| 176 | 3300005466 | Ga0070685_10053861 | Ga0070685_100538612 | 402 |
| 177 | 3300005535 | Ga0070684_100002311 | Ga0070684_10000231112 | 402 |
| 178 | 3300005539 | Ga0068853_100000395 | Ga0068853_1000003959 | 402 |
| 179 | 3300005577 | Ga0068857_100001502 | Ga0068857_1000015022 | 402 |
| 180 | 3300005842 | Ga0068858_100034237 | Ga0068858_1000342376 | 402 |
| 181 | 3300013296 | Ga0157374_10095642 | Ga0157374_100956424 | 402 |
| 182 | 3300013308 | Ga0157375_10045989 | Ga0157375_100459896 | 402 |
| 183 | 3300025920 | Ga0207649_10001123 | Ga0207649_100011233 | 402 |
| 184 | 3300025945 | Ga0207679_10000768 | Ga0207679_100007683 | 402 |
| 185 | 3300025986 | Ga0207658_10098934 | Ga0207658_100989341 | 402 |
| 186 | 3300026023 | Ga0207677_10011966 | Ga0207677_100119663 | 402 |
| 187 | 3300026041 | Ga0207639_10000365 | Ga0207639_1000036522 | 402 |
| 188 | 3300026116 | Ga0207674_10117376 | Ga0207674_101173763 | 402 |
| 189 | 3300026118 | Ga0207675_100335664 | Ga0207675_1003356641 | 402 |
| 190 | 3300030521 | Ga0307511_10000002 | Ga0307511_10000002125 | 402 |
| 191 | 3300031730 | Ga0307516_10097703 | Ga0307516_100977033 | 402 |
| 192 | 3300046460 | Ga0495638_0110135 | Ga0495638_0110135_193_1407 | 402 |
| 193 | 3300049688 | Ga0501259_004965 | Ga0501259_004965_771_1988 | 402 |
| 194 | 3300001979 | JGI24740J21852_10015040 | JGI24740J21852_100150402 | 403 |
| 195 | 3300003316 | rootH1_10094712 | rootH1_100947122 | 403 |
| 196 | 3300003320 | rootH2_10031448 | rootH2_1003144816 | 403 |
| 197 | 3300003322 | rootL2_10066841 | rootL2_100668412 | 403 |
| 198 | 3300003322 | rootL2_10189599 | rootL2_101895992 | 403 |
| 199 | 3300003323 | rootH1_10005699 | rootH1_100056993 | 403 |
| 200 | 3300003354 | JGI25160J50197_1003646 | JGI25160J50197_10036462 | 403 |
| 201 | 3300005288 | Ga0065714_10069413 | Ga0065714_100694135 | 403 |
| 202 | 3300005293 | Ga0065715_10129339 | Ga0065715_101293392 | 403 |
| 203 | 3300005328 | Ga0070676_10004674 | Ga0070676_100046746 | 403 |
| 204 | 3300005329 | Ga0070683_100032986 | Ga0070683_1000329864 | 403 |
| 205 | 3300005331 | Ga0070670_100111399 | Ga0070670_1001113992 | 403 |
| 206 | 3300005333 | Ga0070677_10022935 | Ga0070677_100229353 | 403 |
| 207 | 3300005334 | Ga0068869_100049947 | Ga0068869_1000499472 | 403 |
| 208 | 3300005335 | Ga0070666_10000132 | Ga0070666_1000013227 | 403 |
| 209 | 3300005335 | Ga0070666_10003676 | Ga0070666_100036765 | 403 |
| 210 | 3300005335 | Ga0070666_10030445 | Ga0070666_100304454 | 403 |
| 211 | 3300005337 | Ga0070682_100000008 | Ga0070682_100000008121 | 403 |
| 212 | 3300005338 | Ga0068868_100005565 | Ga0068868_1000055654 | 403 |
| 213 | 3300005338 | Ga0068868_100007251 | Ga0068868_1000072513 | 403 |
| 214 | 3300005344 | Ga0070661_100063563 | Ga0070661_1000635631 | 403 |
| 215 | 3300005347 | Ga0070668_100014784 | Ga0070668_1000147843 | 403 |
| 216 | 3300005347 | Ga0070668_100112299 | Ga0070668_1001122992 | 403 |
| 217 | 3300005355 | Ga0070671_100023690 | Ga0070671_1000236904 | 403 |
| 218 | 3300005364 | Ga0070673_100131024 | Ga0070673_1001310241 | 403 |
| 219 | 3300005364 | Ga0070673_100267689 | Ga0070673_1002676891 | 403 |
| 220 | 3300005366 | Ga0070659_100014492 | Ga0070659_1000144924 | 403 |
| 221 | 3300005366 | Ga0070659_100202637 | Ga0070659_1002026371 | 403 |
| 222 | 3300005367 | Ga0070667_100002402 | Ga0070667_1000024028 | 403 |
| 223 | 3300005367 | Ga0070667_100013431 | Ga0070667_1000134313 | 403 |
| 224 | 3300005367 | Ga0070667_100340252 | Ga0070667_1003402521 | 403 |
| 225 | 3300005456 | Ga0070678_100003657 | Ga0070678_1000036576 | 403 |
| 226 | 3300005456 | Ga0070678_100034897 | Ga0070678_1000348973 | 403 |
| 227 | 3300005457 | Ga0070662_100049365 | Ga0070662_1000493653 | 403 |
| 228 | 3300005459 | Ga0068867_100075785 | Ga0068867_1000757852 | 403 |
| 229 | 3300005539 | Ga0068853_100001004 | Ga0068853_10000100410 | 403 |
| 230 | 3300005539 | Ga0068853_100019995 | Ga0068853_1000199955 | 403 |
| 231 | 3300005539 | Ga0068853_100044637 | Ga0068853_1000446373 | 403 |
| 232 | 3300005539 | Ga0068853_100084824 | Ga0068853_1000848241 | 403 |
| 233 | 3300005543 | Ga0070672_100075811 | Ga0070672_1000758113 | 403 |
| 234 | 3300005548 | Ga0070665_100000047 | Ga0070665_100000047131 | 403 |
| 235 | 3300005548 | Ga0070665_100275504 | Ga0070665_1002755042 | 403 |
| 236 | 3300005563 | Ga0068855_100067120 | Ga0068855_1000671203 | 403 |
| 237 | 3300005563 | Ga0068855_100143636 | Ga0068855_1001436362 | 403 |
| 238 | 3300005577 | Ga0068857_100002865 | Ga0068857_1000028656 | 403 |
| 239 | 3300005577 | Ga0068857_100224112 | Ga0068857_1002241122 | 403 |
| 240 | 3300005578 | Ga0068854_100021090 | Ga0068854_1000210904 | 403 |
| 241 | 3300005578 | Ga0068854_100071353 | Ga0068854_1000713533 | 403 |
| 242 | 3300005614 | Ga0068856_100014397 | Ga0068856_1000143973 | 403 |
| 243 | 3300005614 | Ga0068856_100041025 | Ga0068856_1000410252 | 403 |
| 244 | 3300005616 | Ga0068852_100006330 | Ga0068852_1000063302 | 403 |
| 245 | 3300005616 | Ga0068852_100015185 | Ga0068852_1000151855 | 403 |
| 246 | 3300005616 | Ga0068852_100064901 | Ga0068852_1000649013 | 403 |
| 247 | 3300005617 | Ga0068859_100000003 | Ga0068859_100000003321 | 403 |
| 248 | 3300005617 | Ga0068859_100005582 | Ga0068859_1000055829 | 403 |
| 249 | 3300005617 | Ga0068859_100006236 | Ga0068859_1000062368 | 403 |
| 250 | 3300005617 | Ga0068859_100061943 | Ga0068859_1000619433 | 403 |
| 251 | 3300005617 | Ga0068859_100146288 | Ga0068859_1001462882 | 403 |
| 252 | 3300005618 | Ga0068864_100005055 | Ga0068864_1000050556 | 403 |
| 253 | 3300005618 | Ga0068864_100012271 | Ga0068864_1000122714 | 403 |
| 254 | 3300005618 | Ga0068864_100167268 | Ga0068864_1001672683 | 403 |
| 255 | 3300005834 | Ga0068851_10019916 | Ga0068851_100199163 | 403 |
| 256 | 3300005834 | Ga0068851_10027102 | Ga0068851_100271022 | 403 |
| 257 | 3300005834 | Ga0068851_10063006 | Ga0068851_100630062 | 403 |
| 258 | 3300005841 | Ga0068863_100000394 | Ga0068863_10000039419 | 403 |
| 259 | 3300005841 | Ga0068863_100049856 | Ga0068863_1000498563 | 403 |
| 260 | 3300005841 | Ga0068863_100092206 | Ga0068863_1000922064 | 403 |
| 261 | 3300005842 | Ga0068858_100023584 | Ga0068858_1000235841 | 403 |
| 262 | 3300005843 | Ga0068860_100000003 | Ga0068860_100000003481 | 403 |
| 263 | 3300005843 | Ga0068860_100000829 | Ga0068860_1000008296 | 403 |
| 264 | 3300005843 | Ga0068860_100002493 | Ga0068860_10000249316 | 403 |
| 265 | 3300005843 | Ga0068860_100006719 | Ga0068860_1000067193 | 403 |
| 266 | 3300005843 | Ga0068860_100032165 | Ga0068860_1000321653 | 403 |
| 267 | 3300005843 | Ga0068860_100087290 | Ga0068860_1000872901 | 403 |
| 268 | 3300005983 | Ga0081540_1007577 | Ga0081540_10075777 | 403 |
| 269 | 3300006195 | Ga0075366_10006015 | Ga0075366_100060151 | 403 |
| 270 | 3300006195 | Ga0075366_10134520 | Ga0075366_101345201 | 403 |
| 271 | 3300006237 | Ga0097621_100000352 | Ga0097621_10000035223 | 403 |
| 272 | 3300006237 | Ga0097621_100084541 | Ga0097621_1000845412 | 403 |
| 273 | 3300006358 | Ga0068871_100001720 | Ga0068871_1000017209 | 403 |
| 274 | 3300006358 | Ga0068871_100011054 | Ga0068871_1000110543 | 403 |
| 275 | 3300006358 | Ga0068871_100011985 | Ga0068871_1000119858 | 403 |
| 276 | 3300006881 | Ga0068865_100021362 | Ga0068865_1000213623 | 403 |
| 277 | 3300006881 | Ga0068865_100105288 | Ga0068865_1001052882 | 403 |
| 278 | 3300006931 | Ga0097620_100000003 | Ga0097620_100000003321 | 403 |
| 279 | 3300006931 | Ga0097620_100005582 | Ga0097620_1000055829 | 403 |
| 280 | 3300006931 | Ga0097620_100006236 | Ga0097620_1000062368 | 403 |
| 281 | 3300006931 | Ga0097620_100061941 | Ga0097620_1000619413 | 403 |
| 282 | 3300006931 | Ga0097620_100146283 | Ga0097620_1001462832 | 403 |
| 283 | 3300009093 | Ga0105240_10000098 | Ga0105240_10000098116 | 403 |
| 284 | 3300009093 | Ga0105240_10000356 | Ga0105240_1000035626 | 403 |
| 285 | 3300009093 | Ga0105240_10000383 | Ga0105240_1000038353 | 403 |
| 286 | 3300009093 | Ga0105240_10000401 | Ga0105240_1000040137 | 403 |
| 287 | 3300009093 | Ga0105240_10004458 | Ga0105240_1000445820 | 403 |
| 288 | 3300009093 | Ga0105240_10006383 | Ga0105240_1000638313 | 403 |
| 289 | 3300009093 | Ga0105240_10009536 | Ga0105240_100095362 | 403 |
| 290 | 3300009093 | Ga0105240_10056040 | Ga0105240_100560403 | 403 |
| 291 | 3300009093 | Ga0105240_10294082 | Ga0105240_102940821 | 403 |
| 292 | 3300009094 | Ga0111539_10086011 | Ga0111539_100860111 | 403 |
| 293 | 3300009098 | Ga0105245_10064448 | Ga0105245_100644482 | 403 |
| 294 | 3300009101 | Ga0105247_10000408 | Ga0105247_100004087 | 403 |
| 295 | 3300009101 | Ga0105247_10015502 | Ga0105247_100155023 | 403 |
| 296 | 3300009147 | Ga0114129_10000267 | Ga0114129_100002678 | 403 |
| 297 | 3300009148 | Ga0105243_10239158 | Ga0105243_102391582 | 403 |
| 298 | 3300009174 | Ga0105241_10000507 | Ga0105241_100005075 | 403 |
| 299 | 3300009174 | Ga0105241_10220049 | Ga0105241_102200492 | 403 |
| 300 | 3300009176 | Ga0105242_10113983 | Ga0105242_101139833 | 403 |
| 301 | 3300009545 | Ga0105237_10001393 | Ga0105237_1000139323 | 403 |
| 302 | 3300009545 | Ga0105237_10002285 | Ga0105237_1000228515 | 403 |
| 303 | 3300009545 | Ga0105237_10002753 | Ga0105237_100027534 | 403 |
| 304 | 3300009545 | Ga0105237_10019243 | Ga0105237_100192431 | 403 |
| 305 | 3300009545 | Ga0105237_10034875 | Ga0105237_100348752 | 403 |
| 306 | 3300009545 | Ga0105237_10122366 | Ga0105237_101223662 | 403 |
| 307 | 3300009545 | Ga0105237_10146206 | Ga0105237_101462062 | 403 |
| 308 | 3300009545 | Ga0105237_10444421 | Ga0105237_104444211 | 403 |
| 309 | 3300009551 | Ga0105238_10006282 | Ga0105238_1000628212 | 403 |
| 310 | 3300009551 | Ga0105238_10020905 | Ga0105238_100209054 | 403 |
| 311 | 3300009553 | Ga0105249_10000561 | Ga0105249_1000056128 | 403 |
| 312 | 3300009553 | Ga0105249_10024147 | Ga0105249_100241477 | 403 |
| 313 | 3300009553 | Ga0105249_10130049 | Ga0105249_101300491 | 403 |
| 314 | 3300009553 | Ga0105249_10159469 | Ga0105249_101594692 | 403 |
| 315 | 3300010375 | Ga0105239_10000129 | Ga0105239_1000012961 | 403 |
| 316 | 3300010375 | Ga0105239_10000664 | Ga0105239_1000066418 | 403 |
| 317 | 3300010375 | Ga0105239_10002123 | Ga0105239_1000212320 | 403 |
| 318 | 3300010375 | Ga0105239_10010397 | Ga0105239_100103976 | 403 |
| 319 | 3300010375 | Ga0105239_10039359 | Ga0105239_100393592 | 403 |
| 320 | 3300010375 | Ga0105239_10148255 | Ga0105239_101482552 | 403 |
| 321 | 3300011119 | Ga0105246_10006084 | Ga0105246_100060845 | 403 |
| 322 | 3300011119 | Ga0105246_10031846 | Ga0105246_100318463 | 403 |
| 323 | 3300011119 | Ga0105246_10140933 | Ga0105246_101409332 | 403 |
| 324 | 3300013104 | Ga0157370_10020254 | Ga0157370_100202544 | 403 |
| 325 | 3300013105 | Ga0157369_10047886 | Ga0157369_100478862 | 403 |
| 326 | 3300013105 | Ga0157369_10118065 | Ga0157369_101180651 | 403 |
| 327 | 3300013296 | Ga0157374_10020839 | Ga0157374_100208392 | 403 |
| 328 | 3300013296 | Ga0157374_10058271 | Ga0157374_100582713 | 403 |
| 329 | 3300013297 | Ga0157378_10023940 | Ga0157378_100239403 | 403 |
| 330 | 3300013306 | Ga0163162_10000237 | Ga0163162_1000023736 | 403 |
| 331 | 3300013306 | Ga0163162_10001869 | Ga0163162_100018691 | 403 |
| 332 | 3300013306 | Ga0163162_10002092 | Ga0163162_1000209214 | 403 |
| 333 | 3300013306 | Ga0163162_10266884 | Ga0163162_102668842 | 403 |
| 334 | 3300013307 | Ga0157372_10001911 | Ga0157372_100019115 | 403 |
| 335 | 3300013307 | Ga0157372_10004879 | Ga0157372_100048792 | 403 |
| 336 | 3300013307 | Ga0157372_10122817 | Ga0157372_101228172 | 403 |
| 337 | 3300013307 | Ga0157372_10133008 | Ga0157372_101330081 | 403 |
| 338 | 3300013307 | Ga0157372_10182077 | Ga0157372_101820772 | 403 |
| 339 | 3300013308 | Ga0157375_10000599 | Ga0157375_1000059924 | 403 |
| 340 | 3300013308 | Ga0157375_10057399 | Ga0157375_100573993 | 403 |
| 341 | 3300013308 | Ga0157375_10096253 | Ga0157375_100962533 | 403 |
| 342 | 3300013308 | Ga0157375_10191113 | Ga0157375_101911132 | 403 |
| 343 | 3300014325 | Ga0163163_10000703 | Ga0163163_1000070326 | 403 |
| 344 | 3300014325 | Ga0163163_10065499 | Ga0163163_100654992 | 403 |
| 345 | 3300014325 | Ga0163163_10290409 | Ga0163163_102904091 | 403 |
| 346 | 3300014969 | Ga0157376_10000971 | Ga0157376_100009718 | 403 |
| 347 | 3300014969 | Ga0157376_10048324 | Ga0157376_100483242 | 403 |
| 348 | 3300014969 | Ga0157376_10120861 | Ga0157376_101208612 | 403 |
| 349 | 3300014969 | Ga0157376_10257764 | Ga0157376_102577642 | 403 |
| 350 | 3300017792 | Ga0163161_10008813 | Ga0163161_100088136 | 403 |
| 351 | 3300017792 | Ga0163161_10017752 | Ga0163161_100177524 | 403 |
| 352 | 3300021384 | Ga0213876_10001503 | Ga0213876_100015031 | 403 |
| 353 | 3300025246 | Ga0209646_1001797 | Ga0209646_10017972 | 403 |
| 354 | 3300025302 | Ga0207426_1000040 | Ga0207426_1000040188 | 403 |
| 355 | 3300025900 | Ga0207710_10003686 | Ga0207710_100036864 | 403 |
| 356 | 3300025900 | Ga0207710_10008208 | Ga0207710_100082083 | 403 |
| 357 | 3300025901 | Ga0207688_10005557 | Ga0207688_100055574 | 403 |
| 358 | 3300025903 | Ga0207680_10000014 | Ga0207680_10000014122 | 403 |
| 359 | 3300025903 | Ga0207680_10008850 | Ga0207680_100088502 | 403 |
| 360 | 3300025907 | Ga0207645_10000193 | Ga0207645_1000019334 | 403 |
| 361 | 3300025908 | Ga0207643_10001613 | Ga0207643_1000161310 | 403 |
| 362 | 3300025911 | Ga0207654_10001931 | Ga0207654_1000193113 | 403 |
| 363 | 3300025913 | Ga0207695_10000041 | Ga0207695_10000041276 | 403 |
| 364 | 3300025913 | Ga0207695_10000209 | Ga0207695_1000020926 | 403 |
| 365 | 3300025913 | Ga0207695_10000300 | Ga0207695_1000030021 | 403 |
| 366 | 3300025913 | Ga0207695_10000365 | Ga0207695_1000036579 | 403 |
| 367 | 3300025913 | Ga0207695_10014824 | Ga0207695_100148247 | 403 |
| 368 | 3300025913 | Ga0207695_10036840 | Ga0207695_100368404 | 403 |
| 369 | 3300025913 | Ga0207695_10252253 | Ga0207695_102522532 | 403 |
| 370 | 3300025914 | Ga0207671_10000746 | Ga0207671_1000074617 | 403 |
| 371 | 3300025914 | Ga0207671_10001292 | Ga0207671_100012922 | 403 |
| 372 | 3300025914 | Ga0207671_10004601 | Ga0207671_100046018 | 403 |
| 373 | 3300025914 | Ga0207671_10030627 | Ga0207671_100306273 | 403 |
| 374 | 3300025914 | Ga0207671_10097972 | Ga0207671_100979722 | 403 |
| 375 | 3300025918 | Ga0207662_10045061 | Ga0207662_100450612 | 403 |
| 376 | 3300025924 | Ga0207694_10012170 | Ga0207694_100121705 | 403 |
| 377 | 3300025924 | Ga0207694_10090634 | Ga0207694_100906341 | 403 |
| 378 | 3300025925 | Ga0207650_10176392 | Ga0207650_101763922 | 403 |
| 379 | 3300025927 | Ga0207687_10032775 | Ga0207687_100327751 | 403 |
| 380 | 3300025931 | Ga0207644_10062203 | Ga0207644_100622032 | 403 |
| 381 | 3300025931 | Ga0207644_10269886 | Ga0207644_102698861 | 403 |
| 382 | 3300025932 | Ga0207690_10172279 | Ga0207690_101722791 | 403 |
| 383 | 3300025933 | Ga0207706_10004991 | Ga0207706_100049917 | 403 |
| 384 | 3300025940 | Ga0207691_10002498 | Ga0207691_1000249810 | 403 |
| 385 | 3300025940 | Ga0207691_10027457 | Ga0207691_100274575 | 403 |
| 386 | 3300025942 | Ga0207689_10001011 | Ga0207689_100010116 | 403 |
| 387 | 3300025942 | Ga0207689_10002471 | Ga0207689_1000247115 | 403 |
| 388 | 3300025942 | Ga0207689_10009342 | Ga0207689_100093427 | 403 |
| 389 | 3300025949 | Ga0207667_10000902 | Ga0207667_1000090225 | 403 |
| 390 | 3300025949 | Ga0207667_10119567 | Ga0207667_101195672 | 403 |
| 391 | 3300025961 | Ga0207712_10001226 | Ga0207712_1000122613 | 403 |
| 392 | 3300025961 | Ga0207712_10004325 | Ga0207712_100043257 | 403 |
| 393 | 3300025961 | Ga0207712_10036310 | Ga0207712_100363102 | 403 |
| 394 | 3300025961 | Ga0207712_10132861 | Ga0207712_101328611 | 403 |
| 395 | 3300025961 | Ga0207712_10196381 | Ga0207712_101963811 | 403 |
| 396 | 3300025972 | Ga0207668_10048121 | Ga0207668_100481212 | 403 |
| 397 | 3300025972 | Ga0207668_10050564 | Ga0207668_100505643 | 403 |
| 398 | 3300025981 | Ga0207640_10017137 | Ga0207640_100171373 | 403 |
| 399 | 3300025981 | Ga0207640_10041378 | Ga0207640_100413781 | 403 |
| 400 | 3300025986 | Ga0207658_10069821 | Ga0207658_100698212 | 403 |
| 401 | 3300026023 | Ga0207677_10011555 | Ga0207677_100115553 | 403 |
| 402 | 3300026023 | Ga0207677_10135180 | Ga0207677_101351801 | 403 |
| 403 | 3300026035 | Ga0207703_10009204 | Ga0207703_100092047 | 403 |
| 404 | 3300026035 | Ga0207703_10097482 | Ga0207703_100974821 | 403 |
| 405 | 3300026041 | Ga0207639_10016897 | Ga0207639_100168972 | 403 |
| 406 | 3300026041 | Ga0207639_10019658 | Ga0207639_100196585 | 403 |
| 407 | 3300026041 | Ga0207639_10020656 | Ga0207639_100206563 | 403 |
| 408 | 3300026041 | Ga0207639_10059847 | Ga0207639_100598472 | 403 |
| 409 | 3300026041 | Ga0207639_10066112 | Ga0207639_100661122 | 403 |
| 410 | 3300026078 | Ga0207702_10030893 | Ga0207702_100308934 | 403 |
| 411 | 3300026088 | Ga0207641_10000015 | Ga0207641_10000015213 | 403 |
| 412 | 3300026088 | Ga0207641_10075219 | Ga0207641_100752192 | 403 |
| 413 | 3300026089 | Ga0207648_10000914 | Ga0207648_1000091416 | 403 |
| 414 | 3300026095 | Ga0207676_10005366 | Ga0207676_100053666 | 403 |
| 415 | 3300026095 | Ga0207676_10009485 | Ga0207676_100094854 | 403 |
| 416 | 3300026095 | Ga0207676_10224315 | Ga0207676_102243151 | 403 |
| 417 | 3300026116 | Ga0207674_10012617 | Ga0207674_100126176 | 403 |
| 418 | 3300026116 | Ga0207674_10248285 | Ga0207674_102482852 | 403 |
| 419 | 3300026121 | Ga0207683_10005618 | Ga0207683_100056188 | 403 |
| 420 | 3300026121 | Ga0207683_10054292 | Ga0207683_100542923 | 403 |
| 421 | 3300026121 | Ga0207683_10198414 | Ga0207683_101984142 | 403 |
| 422 | 3300026142 | Ga0207698_10001356 | Ga0207698_1000135612 | 403 |
| 423 | 3300028379 | Ga0268266_10000104 | Ga0268266_10000104112 | 403 |
| 424 | 3300028380 | Ga0268265_10041574 | Ga0268265_100415742 | 403 |
| 425 | 3300028381 | Ga0268264_10000028 | Ga0268264_10000028124 | 403 |
| 426 | 3300028381 | Ga0268264_10003959 | Ga0268264_100039599 | 403 |
| 427 | 3300028381 | Ga0268264_10003990 | Ga0268264_100039907 | 403 |
| 428 | 3300028381 | Ga0268264_10005074 | Ga0268264_100050744 | 403 |
| 429 | 3300028381 | Ga0268264_10031862 | Ga0268264_100318623 | 403 |
| 430 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000013135 | 403 |
| 431 | 3300031251 | Ga0265327_10000024 | Ga0265327_10000024327 | 403 |
| 432 | 3300031251 | Ga0265327_10000030 | Ga0265327_1000003041 | 403 |
| 433 | 3300031251 | Ga0265327_10029361 | Ga0265327_100293612 | 403 |
| 434 | 3300031344 | Ga0265316_10146743 | Ga0265316_101467432 | 403 |
| 435 | 3300031456 | Ga0307513_10178640 | Ga0307513_101786402 | 403 |
| 436 | 3300031507 | Ga0307509_10027688 | Ga0307509_100276886 | 403 |
| 437 | 3300031507 | Ga0307509_10048189 | Ga0307509_100481895 | 403 |
| 438 | 3300031507 | Ga0307509_10094673 | Ga0307509_100946733 | 403 |
| 439 | 3300031616 | Ga0307508_10052570 | Ga0307508_100525703 | 403 |
| 440 | 3300033180 | Ga0307510_10000141 | Ga0307510_1000014115 | 403 |
| 441 | 3300037471 | Ga0395905_0013037 | Ga0395905_0013037_3567_4784 | 403 |
| 442 | 3300037471 | Ga0395905_0058158 | Ga0395905_0058158_1654_2871 | 403 |
| 443 | 3300039437 | Ga0436365_1881620 | Ga0436365_1881620_171_1388 | 403 |
| 444 | 3300041404 | Ga0439436_0001889 | Ga0439436_0001889_4440_5657 | 403 |
| 445 | 3300041406 | Ga0439439_0011411 | Ga0439439_0011411_751_1968 | 403 |
| 446 | 3300042007 | Ga0439449_0023477 | Ga0439449_0023477_909_2126 | 403 |
| 447 | 3300042876 | Ga0451577_0070836 | Ga0451577_0070836_1046_2263 | 403 |
| 448 | 3300044658 | Ga0466972_0000009 | Ga0466972_0000009_59858_61075 | 403 |
| 449 | 3300044658 | Ga0466972_0000069 | Ga0466972_0000069_5853_7070 | 403 |
| 450 | 3300044658 | Ga0466972_0006015 | Ga0466972_0006015_4075_5292 | 403 |
| 451 | 3300044683 | Ga0466965_0042212 | Ga0466965_0042212_233_1450 | 403 |
| 452 | 3300044735 | Ga0466968_0018554 | Ga0466968_0018554_1224_2441 | 403 |
| 453 | 3300044735 | Ga0466968_0036057 | Ga0466968_0036057_664_1881 | 403 |
| 454 | 3300044765 | Ga0466970_0002738 | Ga0466970_0002738_6614_7831 | 403 |
| 455 | 3300044842 | Ga0466957_0000547 | Ga0466957_0000547_7694_8911 | 403 |
| 456 | 3300046460 | Ga0495638_0015704 | Ga0495638_0015704_951_2168 | 403 |
| 457 | 3300046507 | Ga0495606_0004246 | Ga0495606_0004246_1584_2801 | 403 |
| 458 | 3300046524 | Ga0495648_0018192 | Ga0495648_0018192_2012_3229 | 403 |
| 459 | 3300046616 | Ga0495668_0001044 | Ga0495668_0001044_22401_23618 | 403 |
| 460 | 3300046648 | Ga0495611_0000030 | Ga0495611_0000030_39526_40743 | 403 |
| 461 | 3300046660 | Ga0495625_0045225 | Ga0495625_0045225_1161_2378 | 403 |
| 462 | 3300046694 | Ga0495649_0005129 | Ga0495649_0005129_2891_4108 | 403 |
| 463 | 3300047318 | Ga0495636_0000006 | Ga0495636_0000006_76532_77746 | 403 |
| 464 | 3300047320 | Ga0495672_0013217 | Ga0495672_0013217_1635_2855 | 403 |
| 465 | 3300047320 | Ga0495672_0105770 | Ga0495672_0105770_269_1486 | 403 |
| 466 | 3300047443 | Ga0495687_000726 | Ga0495687_000726_3188_4405 | 403 |
| 467 | 3300047472 | Ga0495686_0014570 | Ga0495686_0014570_846_2063 | 403 |
| 468 | 3300049568 | Ga0501031_0058919 | Ga0501031_0058919_1048_2265 | 403 |
| 469 | 3300049569 | Ga0501032_0003088 | Ga0501032_0003088_7814_9031 | 403 |
| 470 | 3300049571 | Ga0501034_0005631 | Ga0501034_0005631_8512_9729 | 403 |
| 471 | 3300049572 | Ga0501036_0055222 | Ga0501036_0055222_71_1288 | 403 |
| 472 | 3300049575 | Ga0501039_0029637 | Ga0501039_0029637_670_1887 | 403 |
| 473 | 3300049580 | Ga0501046_0047480 | Ga0501046_0047480_226_1443 | 403 |
| 474 | 3300049581 | Ga0501047_0015592 | Ga0501047_0015592_3032_4249 | 403 |
| 475 | 3300049581 | Ga0501047_0182245 | Ga0501047_0182245_697_1914 | 403 |
| 476 | 3300049581 | Ga0501047_0200168 | Ga0501047_0200168_410_1627 | 403 |
| 477 | 3300049589 | Ga0501073_0014474 | Ga0501073_0014474_1395_2612 | 403 |
| 478 | 3300049590 | Ga0501074_0004892 | Ga0501074_0004892_3733_4950 | 403 |
| 479 | 3300049686 | Ga0501257_005343 | Ga0501257_005343_1535_2752 | 403 |
| 480 | 3300049705 | Ga0501225_0000322 | Ga0501225_0000322_559_1776 | 403 |
| 481 | 3300049742 | Ga0501080_0090747 | Ga0501080_0090747_354_1571 | 403 |
| 482 | 3300049744 | Ga0501083_0012439 | Ga0501083_0012439_3208_4425 | 403 |
| 483 | 3300049822 | Ga0501035_0007031 | Ga0501035_0007031_7590_8807 | 403 |
| 484 | 3300049823 | Ga0501044_0182384 | Ga0501044_0182384_339_1556 | 403 |
| 485 | 3300050493 | nmdc:mga0k408_5491_c1 | nmdc:mga0k408_5491_c1_5226_6443 | 403 |
| 486 | 3300050507 | nmdc:mga05p37_1224_c1 | nmdc:mga05p37_1224_c1_8721_9938 | 403 |
| 487 | 3300053086 | Ga0500578_0005247 | Ga0500578_0005247_6029_7246 | 403 |
| 488 | 3300053092 | Ga0500583_0000078 | Ga0500583_0000078_24429_25646 | 403 |
| 489 | 3300053092 | Ga0500583_0034389 | Ga0500583_0034389_480_1697 | 403 |
| 490 | 3300053108 | Ga0500562_000012 | Ga0500562_000012_40946_42166 | 403 |
| 491 | 3300053146 | Ga0500588_0002193 | Ga0500588_0002193_773_1990 | 403 |
| 492 | 3300053153 | Ga0500616_0016419 | Ga0500616_0016419_1390_2610 | 403 |
| 493 | 3300053156 | Ga0500622_0000404 | Ga0500622_0000404_5806_7026 | 403 |
| 494 | 3300053156 | Ga0500622_0002382 | Ga0500622_0002382_11435_12652 | 403 |
| 495 | 3300053727 | Ga0500611_000038 | Ga0500611_000038_31420_32712 | 403 |
| 496 | 2162886007 | SwRhRL2b_contig_677025 | SwRhRL2b_0927.00001220 | 404 |
| 497 | 3300003320 | rootH2_10005170 | rootH2_1000517027 | 404 |
| 498 | 3300005289 | Ga0065704_10070133 | Ga0065704_10070133369 | 404 |
| 499 | 3300005290 | Ga0065712_10132147 | Ga0065712_101321471 | 404 |
| 500 | 3300005328 | Ga0070676_10000439 | Ga0070676_1000043913 | 404 |
| 501 | 3300005329 | Ga0070683_100002039 | Ga0070683_10000203912 | 404 |
| 502 | 3300005331 | Ga0070670_100011898 | Ga0070670_1000118983 | 404 |
| 503 | 3300005331 | Ga0070670_100075152 | Ga0070670_1000751522 | 404 |
| 504 | 3300005337 | Ga0070682_100000812 | Ga0070682_1000008124 | 404 |
| 505 | 3300005338 | Ga0068868_100000119 | Ga0068868_10000011918 | 404 |
| 506 | 3300005341 | Ga0070691_10000209 | Ga0070691_100002094 | 404 |
| 507 | 3300005347 | Ga0070668_100000645 | Ga0070668_1000006457 | 404 |
| 508 | 3300005354 | Ga0070675_100030083 | Ga0070675_1000300833 | 404 |
| 509 | 3300005356 | Ga0070674_100098174 | Ga0070674_1000981742 | 404 |
| 510 | 3300005364 | Ga0070673_100000331 | Ga0070673_10000033117 | 404 |
| 511 | 3300005367 | Ga0070667_100001052 | Ga0070667_10000105210 | 404 |
| 512 | 3300005457 | Ga0070662_100001338 | Ga0070662_10000133812 | 404 |
| 513 | 3300005458 | Ga0070681_10015209 | Ga0070681_100152095 | 404 |
| 514 | 3300005459 | Ga0068867_100002653 | Ga0068867_1000026533 | 404 |
| 515 | 3300005530 | Ga0070679_100000099 | Ga0070679_10000009930 | 404 |
| 516 | 3300005535 | Ga0070684_100007507 | Ga0070684_1000075078 | 404 |
| 517 | 3300005539 | Ga0068853_100001959 | Ga0068853_10000195915 | 404 |
| 518 | 3300005539 | Ga0068853_100019744 | Ga0068853_1000197445 | 404 |
| 519 | 3300005543 | Ga0070672_100000183 | Ga0070672_10000018321 | 404 |
| 520 | 3300005544 | Ga0070686_100009707 | Ga0070686_1000097075 | 404 |
| 521 | 3300005548 | Ga0070665_100001045 | Ga0070665_10000104520 | 404 |
| 522 | 3300005563 | Ga0068855_100018034 | Ga0068855_10001803410 | 404 |
| 523 | 3300005563 | Ga0068855_100028092 | Ga0068855_1000280924 | 404 |
| 524 | 3300005563 | Ga0068855_100077021 | Ga0068855_1000770213 | 404 |
| 525 | 3300005564 | Ga0070664_100015826 | Ga0070664_1000158263 | 404 |
| 526 | 3300005578 | Ga0068854_100019088 | Ga0068854_1000190883 | 404 |
| 527 | 3300005615 | Ga0070702_100008510 | Ga0070702_1000085101 | 404 |
| 528 | 3300005616 | Ga0068852_100198184 | Ga0068852_1001981842 | 404 |
| 529 | 3300005617 | Ga0068859_100064203 | Ga0068859_1000642033 | 404 |
| 530 | 3300005618 | Ga0068864_100002400 | Ga0068864_10000240016 | 404 |
| 531 | 3300005618 | Ga0068864_100111223 | Ga0068864_1001112232 | 404 |
| 532 | 3300005841 | Ga0068863_100001935 | Ga0068863_10000193519 | 404 |
| 533 | 3300005843 | Ga0068860_100002234 | Ga0068860_10000223421 | 404 |
| 534 | 3300005985 | Ga0081539_10000534 | Ga0081539_1000053435 | 404 |
| 535 | 3300005985 | Ga0081539_10014443 | Ga0081539_100144434 | 404 |
| 536 | 3300006237 | Ga0097621_100003204 | Ga0097621_1000032043 | 404 |
| 537 | 3300006358 | Ga0068871_100023716 | Ga0068871_1000237164 | 404 |
| 538 | 3300006881 | Ga0068865_100000660 | Ga0068865_1000006603 | 404 |
| 539 | 3300006931 | Ga0097620_100064203 | Ga0097620_1000642033 | 404 |
| 540 | 3300009093 | Ga0105240_10002820 | Ga0105240_1000282023 | 404 |
| 541 | 3300009093 | Ga0105240_10003287 | Ga0105240_1000328712 | 404 |
| 542 | 3300009094 | Ga0111539_10260602 | Ga0111539_102606021 | 404 |
| 543 | 3300009098 | Ga0105245_10120666 | Ga0105245_101206662 | 404 |
| 544 | 3300009174 | Ga0105241_10000056 | Ga0105241_1000005631 | 404 |
| 545 | 3300009174 | Ga0105241_10073450 | Ga0105241_100734502 | 404 |
| 546 | 3300009177 | Ga0105248_10122259 | Ga0105248_101222593 | 404 |
| 547 | 3300009545 | Ga0105237_10000284 | Ga0105237_1000028423 | 404 |
| 548 | 3300009551 | Ga0105238_10364711 | Ga0105238_103647111 | 404 |
| 549 | 3300009553 | Ga0105249_10052388 | Ga0105249_100523883 | 404 |
| 550 | 3300013104 | Ga0157370_10064348 | Ga0157370_100643483 | 404 |
| 551 | 3300013105 | Ga0157369_10070633 | Ga0157369_100706334 | 404 |
| 552 | 3300013296 | Ga0157374_10000027 | Ga0157374_10000027139 | 404 |
| 553 | 3300013296 | Ga0157374_10000505 | Ga0157374_1000050512 | 404 |
| 554 | 3300013297 | Ga0157378_10027435 | Ga0157378_100274353 | 404 |
| 555 | 3300013306 | Ga0163162_10000096 | Ga0163162_1000009639 | 404 |
| 556 | 3300013307 | Ga0157372_10043707 | Ga0157372_100437071 | 404 |
| 557 | 3300013307 | Ga0157372_10084624 | Ga0157372_100846242 | 404 |
| 558 | 3300013307 | Ga0157372_10123655 | Ga0157372_101236551 | 404 |
| 559 | 3300013308 | Ga0157375_10000512 | Ga0157375_1000051225 | 404 |
| 560 | 3300014325 | Ga0163163_10000251 | Ga0163163_100002515 | 404 |
| 561 | 3300014325 | Ga0163163_10081529 | Ga0163163_100815293 | 404 |
| 562 | 3300014326 | Ga0157380_10028049 | Ga0157380_100280494 | 404 |
| 563 | 3300014326 | Ga0157380_10370000 | Ga0157380_103700002 | 404 |
| 564 | 3300014745 | Ga0157377_10013019 | Ga0157377_100130192 | 404 |
| 565 | 3300014968 | Ga0157379_10000128 | Ga0157379_100001285 | 404 |
| 566 | 3300014969 | Ga0157376_10001725 | Ga0157376_100017258 | 404 |
| 567 | 3300014969 | Ga0157376_10002110 | Ga0157376_100021107 | 404 |
| 568 | 3300014969 | Ga0157376_10136876 | Ga0157376_101368762 | 404 |
| 569 | 3300025321 | Ga0207656_10001991 | Ga0207656_100019915 | 404 |
| 570 | 3300025903 | Ga0207680_10000223 | Ga0207680_1000022319 | 404 |
| 571 | 3300025904 | Ga0207647_10031525 | Ga0207647_100315253 | 404 |
| 572 | 3300025907 | Ga0207645_10002708 | Ga0207645_100027085 | 404 |
| 573 | 3300025907 | Ga0207645_10055658 | Ga0207645_100556582 | 404 |
| 574 | 3300025909 | Ga0207705_10001296 | Ga0207705_100012963 | 404 |
| 575 | 3300025911 | Ga0207654_10000267 | Ga0207654_1000026711 | 404 |
| 576 | 3300025912 | Ga0207707_10000026 | Ga0207707_1000002694 | 404 |
| 577 | 3300025912 | Ga0207707_10000067 | Ga0207707_1000006741 | 404 |
| 578 | 3300025913 | Ga0207695_10000483 | Ga0207695_1000048339 | 404 |
| 579 | 3300025913 | Ga0207695_10071261 | Ga0207695_100712613 | 404 |
| 580 | 3300025914 | Ga0207671_10000650 | Ga0207671_1000065018 | 404 |
| 581 | 3300025917 | Ga0207660_10000165 | Ga0207660_1000016530 | 404 |
| 582 | 3300025921 | Ga0207652_10000109 | Ga0207652_1000010939 | 404 |
| 583 | 3300025926 | Ga0207659_10049252 | Ga0207659_100492523 | 404 |
| 584 | 3300025927 | Ga0207687_10074837 | Ga0207687_100748373 | 404 |
| 585 | 3300025933 | Ga0207706_10003423 | Ga0207706_1000342312 | 404 |
| 586 | 3300025938 | Ga0207704_10001257 | Ga0207704_100012573 | 404 |
| 587 | 3300025940 | Ga0207691_10000057 | Ga0207691_1000005727 | 404 |
| 588 | 3300025949 | Ga0207667_10005516 | Ga0207667_1000551612 | 404 |
| 589 | 3300025949 | Ga0207667_10023943 | Ga0207667_100239433 | 404 |
| 590 | 3300025949 | Ga0207667_10110908 | Ga0207667_101109082 | 404 |
| 591 | 3300025960 | Ga0207651_10000330 | Ga0207651_1000033010 | 404 |
| 592 | 3300025961 | Ga0207712_10007476 | Ga0207712_100074763 | 404 |
| 593 | 3300025972 | Ga0207668_10000170 | Ga0207668_1000017039 | 404 |
| 594 | 3300025986 | Ga0207658_10003501 | Ga0207658_100035017 | 404 |
| 595 | 3300026035 | Ga0207703_10001287 | Ga0207703_1000128721 | 404 |
| 596 | 3300026041 | Ga0207639_10001406 | Ga0207639_100014065 | 404 |
| 597 | 3300026041 | Ga0207639_10013395 | Ga0207639_100133953 | 404 |
| 598 | 3300026078 | Ga0207702_10024235 | Ga0207702_100242354 | 404 |
| 599 | 3300026089 | Ga0207648_10003815 | Ga0207648_100038155 | 404 |
| 600 | 3300026089 | Ga0207648_10018863 | Ga0207648_100188635 | 404 |
| 601 | 3300026089 | Ga0207648_10141101 | Ga0207648_101411012 | 404 |
| 602 | 3300026095 | Ga0207676_10002484 | Ga0207676_1000248413 | 404 |
| 603 | 3300026118 | Ga0207675_100121016 | Ga0207675_1001210164 | 404 |
| 604 | 3300026142 | Ga0207698_10013713 | Ga0207698_100137133 | 404 |
| 605 | 3300026142 | Ga0207698_10356267 | Ga0207698_103562671 | 404 |
| 606 | 3300028379 | Ga0268266_10016754 | Ga0268266_100167543 | 404 |
| 607 | 3300028381 | Ga0268264_10010286 | Ga0268264_100102867 | 404 |
| 608 | 3300044684 | Ga0466966_0062828 | Ga0466966_0062828_1068_2288 | 404 |
| 609 | 3300044693 | Ga0466961_0018283 | Ga0466961_0018283_1816_3036 | 404 |
| 610 | 3300044719 | Ga0466971_0017484 | Ga0466971_0017484_1850_3070 | 404 |
| 611 | 3300045049 | Ga0466959_0000330 | Ga0466959_0000330_20180_21400 | 404 |
| 612 | 3300045836 | Ga0466958_0013461 | Ga0466958_0013461_2187_3407 | 404 |
| 613 | 3300046683 | Ga0495658_0011489 | Ga0495658_0011489_187_1431 | 404 |
| 614 | 3300046691 | Ga0495670_0016797 | Ga0495670_0016797_676_1920 | 404 |
| 615 | 3300049513 | Ga0501290_002934 | Ga0501290_002934_749_1969 | 404 |
| 616 | 3300049521 | Ga0501298_003101 | Ga0501298_003101_1099_2319 | 404 |
| 617 | 3300049568 | Ga0501031_0017714 | Ga0501031_0017714_577_1797 | 404 |
| 618 | 3300049571 | Ga0501034_0280332 | Ga0501034_0280332_103_1347 | 404 |
| 619 | 3300049573 | Ga0501037_0012585 | Ga0501037_0012585_1631_2851 | 404 |
| 620 | 3300049574 | Ga0501038_0021860 | Ga0501038_0021860_3336_4556 | 404 |
| 621 | 3300049575 | Ga0501039_0048947 | Ga0501039_0048947_747_1967 | 404 |
| 622 | 3300049579 | Ga0501043_0014684 | Ga0501043_0014684_1431_2651 | 404 |
| 623 | 3300049585 | Ga0501069_0067223 | Ga0501069_0067223_155_1399 | 404 |
| 624 | 3300049586 | Ga0501070_0044503 | Ga0501070_0044503_475_1719 | 404 |
| 625 | 3300049651 | Ga0501201_000464 | Ga0501201_000464_1792_3108 | 404 |
| 626 | 3300049652 | Ga0501202_000794 | Ga0501202_000794_521_1837 | 404 |
| 627 | 3300049654 | Ga0501207_000187 | Ga0501207_000187_381_1697 | 404 |
| 628 | 3300049668 | Ga0501233_000637 | Ga0501233_000637_3313_4533 | 404 |
| 629 | 3300049669 | Ga0501235_000793 | Ga0501235_000793_3508_4824 | 404 |
| 630 | 3300049675 | Ga0501243_001403 | Ga0501243_001403_1594_2814 | 404 |
| 631 | 3300049681 | Ga0501251_000790 | Ga0501251_000790_677_1897 | 404 |
| 632 | 3300049688 | Ga0501259_000269 | Ga0501259_000269_713_1933 | 404 |
| 633 | 3300049690 | Ga0501261_003861 | Ga0501261_003861_501_1721 | 404 |
| 634 | 3300049704 | Ga0501221_001602 | Ga0501221_001602_1284_2600 | 404 |
| 635 | 3300049705 | Ga0501225_0000930 | Ga0501225_0000930_1452_2672 | 404 |
| 636 | 3300049707 | Ga0501234_001438 | Ga0501234_001438_514_1830 | 404 |
| 637 | 3300049708 | Ga0501245_000749 | Ga0501245_000749_2295_3611 | 404 |
| 638 | 3300049741 | Ga0501079_0046745 | Ga0501079_0046745_761_2005 | 404 |
| 639 | 3300049742 | Ga0501080_0217623 | Ga0501080_0217623_33_1277 | 404 |
| 640 | 3300049775 | Ga0501279_006477 | Ga0501279_006477_202_1422 | 404 |
| 641 | 3300049822 | Ga0501035_0071510 | Ga0501035_0071510_1684_2904 | 404 |
| 642 | 3300049851 | Ga0501212_002597 | Ga0501212_002597_799_2019 | 404 |
| 643 | 3300061719 | Ga0466962_0006433 | Ga0466962_0006433_1888_3108 | 404 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5k8b-assembly2.cif.gz_D | x-ray structure of kdna, 8-amino-3,8-dideoxy-alpha-d-manno-octulosonate transaminase, from shewanella oneidensis in the presence of the external aldimine with plp and glutamate | 0.9511 | 2 | 391 |
| 5k8b-assembly2.cif.gz_D | x-ray structure of kdna, 8-amino-3,8-dideoxy-alpha-d-manno-octulosonate transaminase, from shewanella oneidensis in the presence of the external aldimine with plp and glutamate | 0.9392 | 2 | 391 |
| 3nys-assembly1.cif.gz_A | x-ray structure of the k185a mutant of wbpe (wlbe) from pseudomonas aeruginosa in complex with plp at 1.45 angstrom resolution | 0.9164 | 10 | 394 |
| 7b0m-assembly1.cif.gz_AAA-2 | sugar transaminase from a metagenome collected from troll oil field production water | 0.9155 | 3 | 392 |
| 3frk-assembly1.cif.gz_B | x-ray structure of qdtb from t. thermosaccharolyticum in complex with a plp:tdp-3-aminoquinovose aldimine | 0.9102 | 10 | 390 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5k8bC01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9666 | 2 | 249 | 3.40.640.10 |
| 5k8bC01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.959 | 2 | 249 | 3.40.640.10 |
| 3bn1B01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9546 | 1 | 250 | 3.40.640.10 |
| 1b9iA01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.936 | 10 | 247 | 3.40.640.10 |
| 3bn1B01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9349 | 1 | 250 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D4E1S7-F1-model_v4 | deleted | 0.9864 | 74 | 182 |
|
| AF-A0A2N5JM67-F1-model_v4 | Erythromycin biosynthesis sensory transduction protein eryC1 | 0.9817 | 39 | 209 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A354TK86-F1-model_v4 | Erythromycin biosynthesis sensory transduction protein eryC1 | 0.9703 | 36 | 206 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A444J729-F1-model_v4 | DegT/DnrJ/EryC1/StrS aminotransferase family protein (EC 2.6.1.109) | 0.9702 | 1 | 169 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A352WTK3-F1-model_v4 | Glutamine--scyllo-inositol aminotransferase | 0.9695 | 46 | 200 |
GO:0000271
GO:0008483 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar