F471929

General Info

Members Datasets Scaffolds Average Seq Length
643 303 626 405

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10069413|Ga0065714_100694135
Length 440
Sequence MLKCLKAIPVACIWYNLKVDSLPLLAHSVNHKLLVMPGFEFFGSEERKEVNDVLETGILMRYGFDGPRKGIWKSKELEQAITETFGCKYAQLVSSGTAALTTALSALGVGYGDEVIIPSFTFVASFEAVLSVGAIPVLVDVDDTLTLNPAAVRNAITSKTKCLMPVHMCGSMADMDELVAICKEHELILIEDACQSIGASYKGKMLGTIGDAGTFSFDFVKTITCAEGGVVMSNREDVYISSDGYSDHGHDHKGTDRGADLHPFIGYNYRISELHAAVGLAQIKKLDSFLTIQRKNNKILRDILSGVPEITFRRVPDEAGDSCTFLSWFLPTPEITKAVVTQMRSQGIMAGSFYWFDNNWHYISKWDHLKDALTLNKLHPDLKAAVIHQASKDFSASDAVMSRCVSTLISLLWTEEQIQEKGKQMVVVIKKVLNEHAVTY

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
4 2818991444 Filimonas endophytica 3197 Isolate Unclassified
5 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
6 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
7 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
8 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
9 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
10 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
11 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
12 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
13 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
14 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
15 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
16 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
17 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
18 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
19 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
20 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
21 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
22 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
29 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
38 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
128 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
196 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
197 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
205 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
206 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
209 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
210 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
214 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
215 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
223 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
231 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
240 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
241 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
258 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
259 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
260 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
261 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
262 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
263 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
264 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
265 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
266 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
267 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
268 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
269 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
270 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
271 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
275 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
279 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
280 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
281 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
282 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
286 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
287 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
288 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
289 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
290 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
291 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
292 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
293 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
294 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
295 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
296 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
297 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
298 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
299 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
300 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
301 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
302 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
303 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.2
Metatranscriptomes 0
Isolates 2.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.71
Nodule 0
Rhizoplane 0.62
Rhizosphere 83.67
Stem 0
Stem Tuber 0
Unclassified 7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_677025 2162886007 Bacteria 181955
2 JGI24740J21852_10000359 3300001979 Bacteria 19514
3 JGI24740J21852_10015040 3300001979 Bacteria 2836
4 JGI24739J22299_10000062 3300001989 Bacteria 29944
5 JGI25154J39366_1000023 3300002738 Bacteria 219569
6 JGI25157J39369_1008966 3300002741 Bacteria 1365
7 JGI25153J46596_10016298 3300003215 Bacteria 2985
8 rootH1_10078655 3300003316 Bacteria 2031
9 rootH1_10094712 3300003316 Bacteria 3075
10 rootH2_10005170 3300003320 Bacteria 79894
11 rootH2_10031448 3300003320 Bacteria 32925
12 rootH2_10048291 3300003320 Bacteria 12301
13 rootL2_10052422 3300003322 Bacteria 10016
14 rootL2_10066841 3300003322 Bacteria 3791
15 rootL2_10189599 3300003322 Unclassified 1953
16 rootH1_10005699 3300003316 Bacteria 17995
17 rootH1_10005699 3300003323 Bacteria 16393
18 JGI25160J50197_1003646 3300003354 Bacteria 6829
19 JGI25160J50197_1005193 3300003354 Bacteria 5461
20 JGI25160J50197_1010215 3300003354 Bacteria 3408
21 Ga0055535_1004409 3300003761 Bacteria 3430
22 Ga0055526_1018422 3300003771 Bacteria 2604
23 Ga0055526_1033615 3300003771 Bacteria 1419
24 Ga0055528_1003039 3300003790 Bacteria 8643
25 Ga0055530_10000118 3300003791 Bacteria 68596
26 Ga0055531_10000054 3300003794 Bacteria 123684
27 Ga0055531_10029799 3300003794 Bacteria 1850
28 Ga0065165_1000027 3300005262 Bacteria 228507
29 Ga0065714_10069413 3300005288 Bacteria 4239
30 Ga0065704_10070133 3300005289 Bacteria 1266035
31 Ga0065704_10129419 3300005289 Bacteria 1649
32 Ga0065712_10132147 3300005290 Bacteria 1534
33 Ga0065712_10142763 3300005290 Bacteria 1435
34 Ga0065715_10129339 3300005293 Bacteria 2047
35 Ga0070676_10000439 3300005328 Bacteria 19781
36 Ga0070676_10004674 3300005328 Bacteria 7237
37 Ga0070676_10048392 3300005328 Bacteria 2486
38 Ga0070683_100001393 3300005329 Bacteria 18553
39 Ga0070683_100002039 3300005329 Bacteria 15909
40 Ga0070683_100032986 3300005329 Bacteria 4719
41 Ga0070670_100011898 3300005331 Bacteria 7441
42 Ga0070670_100075152 3300005331 Bacteria 2903
43 Ga0070670_100111399 3300005331 Bacteria 2358
44 Ga0070677_10022935 3300005333 Bacteria 2305
45 Ga0068869_100001381 3300005334 Bacteria 14366
46 Ga0068869_100049947 3300005334 Bacteria 3030
47 Ga0070666_10000132 3300005335 Bacteria 52718
48 Ga0070666_10003676 3300005335 Bacteria 9296
49 Ga0070666_10030445 3300005335 Bacteria 3556
50 Ga0070666_10108354 3300005335 Bacteria 1919
51 Ga0070682_100000008 3300005337 Bacteria 322125
52 Ga0070682_100000812 3300005337 Bacteria 18337
53 Ga0068868_100000119 3300005338 Bacteria 49590
54 Ga0068868_100005565 3300005338 Bacteria 8860
55 Ga0068868_100007251 3300005338 Bacteria 7885
56 Ga0070689_100013486 3300005340 Bacteria 5915
57 Ga0070689_100032797 3300005340 Unclassified 3952
58 Ga0070691_10000209 3300005341 Bacteria 19696
59 Ga0070661_100000700 3300005344 Bacteria 24597
60 Ga0070661_100019009 3300005344 Unclassified 4891
61 Ga0070661_100063563 3300005344 Bacteria 2711
62 Ga0070668_100000645 3300005347 Bacteria 23563
63 Ga0070668_100014784 3300005347 Bacteria 5833
64 Ga0070668_100112299 3300005347 Bacteria 2170
65 Ga0070669_100253945 3300005353 Bacteria 1401
66 Ga0070675_100030083 3300005354 Bacteria 4382
67 Ga0070675_100094089 3300005354 Unclassified 2514
68 Ga0070671_100023690 3300005355 Bacteria 5026
69 Ga0070674_100098174 3300005356 Bacteria 2129
70 Ga0070673_100000331 3300005364 Bacteria 24760
71 Ga0070673_100131024 3300005364 Bacteria 2104
72 Ga0070673_100232178 3300005364 Bacteria 1601
73 Ga0070673_100267689 3300005364 Unclassified 1495
74 Ga0070688_100014398 3300005365 Bacteria 4480
75 Ga0070659_100014492 3300005366 Bacteria 5891
76 Ga0070659_100202637 3300005366 Bacteria 1634
77 Ga0070667_100001052 3300005367 Bacteria 25199
78 Ga0070667_100002402 3300005367 Bacteria 16395
79 Ga0070667_100013431 3300005367 Bacteria 6770
80 Ga0070667_100340252 3300005367 Bacteria 1357
81 Ga0070678_100003657 3300005456 Bacteria 8586
82 Ga0070678_100034897 3300005456 Bacteria 3507
83 Ga0070662_100001338 3300005457 Bacteria 15148
84 Ga0070662_100049365 3300005457 Bacteria 3034
85 Ga0070681_10015209 3300005458 Bacteria 7654
86 Ga0068867_100002653 3300005459 Bacteria 12624
87 Ga0068867_100075785 3300005459 Bacteria 2524
88 Ga0070685_10053861 3300005466 Bacteria 2332
89 Ga0070706_100128501 3300005467 Bacteria 2364
90 Ga0070707_100066480 3300005468 Bacteria 3465
91 Ga0070707_100071522 3300005468 Bacteria 3342
92 Ga0070679_100000099 3300005530 Bacteria 66873
93 Ga0070684_100002311 3300005535 Bacteria 14052
94 Ga0070684_100007507 3300005535 Bacteria 8485
95 Ga0068853_100000395 3300005539 Bacteria 29784
96 Ga0068853_100001004 3300005539 Bacteria 19895
97 Ga0068853_100001959 3300005539 Bacteria 15174
98 Ga0068853_100019744 3300005539 Bacteria 5595
99 Ga0068853_100019995 3300005539 Bacteria 5562
100 Ga0068853_100044637 3300005539 Bacteria 3794
101 Ga0068853_100084824 3300005539 Bacteria 2776
102 Ga0070672_100000183 3300005543 Bacteria 34362
103 Ga0070672_100075811 3300005543 Bacteria 2686
104 Ga0070686_100009707 3300005544 Bacteria 5410
105 Ga0070665_100000047 3300005548 Bacteria 269702
106 Ga0070665_100001045 3300005548 Bacteria 34668
107 Ga0070665_100275504 3300005548 Bacteria 1684
108 Ga0068855_100018034 3300005563 Bacteria 8482
109 Ga0068855_100028092 3300005563 Bacteria 6728
110 Ga0068855_100067120 3300005563 Bacteria 4180
111 Ga0068855_100077021 3300005563 Bacteria 3869
112 Ga0068855_100143636 3300005563 Bacteria 2718
113 Ga0070664_100015826 3300005564 Bacteria 6173
114 Ga0068857_100001502 3300005577 Bacteria 18597
115 Ga0068857_100002865 3300005577 Bacteria 14180
116 Ga0068857_100084803 3300005577 Bacteria 2831
117 Ga0068857_100224112 3300005577 Bacteria 1718
118 Ga0068854_100019088 3300005578 Bacteria 4615
119 Ga0068854_100021090 3300005578 Bacteria 4418
120 Ga0068854_100071353 3300005578 Bacteria 2540
121 Ga0068856_100014397 3300005614 Bacteria 7645
122 Ga0068856_100041025 3300005614 Bacteria 4547
123 Ga0068856_100475293 3300005614 Bacteria 1271
124 Ga0070702_100008510 3300005615 Bacteria 4974
125 Ga0068852_100006330 3300005616 Bacteria 8543
126 Ga0068852_100015185 3300005616 Bacteria 5960
127 Ga0068852_100064901 3300005616 Bacteria 3184
128 Ga0068852_100198184 3300005616 Bacteria 1899
129 Ga0068859_100000003 3300005617 Bacteria 479218
130 Ga0068859_100000933 3300005617 Bacteria 29963
131 Ga0068859_100005582 3300005617 Bacteria 12812
132 Ga0068859_100006236 3300005617 Bacteria 12106
133 Ga0068859_100061943 3300005617 Bacteria 3770
134 Ga0068859_100064203 3300005617 Bacteria 3704
135 Ga0068859_100146288 3300005617 Bacteria 2438
136 Ga0068864_100002400 3300005618 Bacteria 15470
137 Ga0068864_100005055 3300005618 Bacteria 10799
138 Ga0068864_100008752 3300005618 Bacteria 8345
139 Ga0068864_100012271 3300005618 Bacteria 7082
140 Ga0068864_100111223 3300005618 Bacteria 2440
141 Ga0068864_100167268 3300005618 Bacteria 2003
142 Ga0068851_10019916 3300005834 Bacteria 3244
143 Ga0068851_10027102 3300005834 Bacteria 2822
144 Ga0068851_10063006 3300005834 Bacteria 1904
145 Ga0068863_100000394 3300005841 Bacteria 44355
146 Ga0068863_100001935 3300005841 Bacteria 20565
147 Ga0068863_100049856 3300005841 Bacteria 3970
148 Ga0068863_100092206 3300005841 Bacteria 2874
149 Ga0068858_100023584 3300005842 Bacteria 5732
150 Ga0068858_100034237 3300005842 Unclassified 4711
151 Ga0068860_100000003 3300005843 Bacteria 575741
152 Ga0068860_100000829 3300005843 Bacteria 34616
153 Ga0068860_100002234 3300005843 Bacteria 20388
154 Ga0068860_100002493 3300005843 Bacteria 19315
155 Ga0068860_100006719 3300005843 Bacteria 11541
156 Ga0068860_100032165 3300005843 Bacteria 5042
157 Ga0068860_100087290 3300005843 Bacteria 2969
158 Ga0081540_1007577 3300005983 Bacteria 7712
159 Ga0081539_10000534 3300005985 Bacteria 78990
160 Ga0081539_10014443 3300005985 Bacteria 5840
161 Ga0075366_10006015 3300006195 Bacteria 6612
162 Ga0075366_10134520 3300006195 Bacteria 1493
163 Ga0097621_100000352 3300006237 Bacteria 31757
164 Ga0097621_100003204 3300006237 Bacteria 11241
165 Ga0097621_100084541 3300006237 Bacteria 2645
166 Ga0068871_100001720 3300006358 Bacteria 14724
167 Ga0068871_100011054 3300006358 Bacteria 6617
168 Ga0068871_100011985 3300006358 Bacteria 6380
169 Ga0068871_100023716 3300006358 Bacteria 4749
170 Ga0075428_100257605 3300006844 Unclassified 1879
171 Ga0075431_100001819 3300006847 Bacteria 20141
172 Ga0075434_100004332 3300006871 Bacteria 12765
173 Ga0075429_100127361 3300006880 Unclassified 2227
174 Ga0068865_100000660 3300006881 Bacteria 19448
175 Ga0068865_100021362 3300006881 Bacteria 4207
176 Ga0068865_100105288 3300006881 Bacteria 2072
177 Ga0097620_100000003 3300006931 Bacteria 479218
178 Ga0097620_100000933 3300006931 Bacteria 29963
179 Ga0097620_100005582 3300006931 Bacteria 12812
180 Ga0097620_100006236 3300006931 Bacteria 12106
181 Ga0097620_100061941 3300006931 Bacteria 3770
182 Ga0097620_100064203 3300006931 Bacteria 3704
183 Ga0097620_100146283 3300006931 Bacteria 2438
184 Ga0105240_10000098 3300009093 Bacteria 178435
185 Ga0105240_10000356 3300009093 Bacteria 85978
186 Ga0105240_10000383 3300009093 Bacteria 83057
187 Ga0105240_10000401 3300009093 Bacteria 80500
188 Ga0105240_10002820 3300009093 Bacteria 27478
189 Ga0105240_10003287 3300009093 Bacteria 25283
190 Ga0105240_10004458 3300009093 Bacteria 21346
191 Ga0105240_10006383 3300009093 Bacteria 17357
192 Ga0105240_10009536 3300009093 Bacteria 13745
193 Ga0105240_10056040 3300009093 Bacteria 4934
194 Ga0105240_10294082 3300009093 Bacteria 1860
195 Ga0111539_10035856 3300009094 Bacteria 6004
196 Ga0111539_10086011 3300009094 Bacteria 3695
197 Ga0111539_10260602 3300009094 Bacteria 2018
198 Ga0105245_10064448 3300009098 Bacteria 3311
199 Ga0105245_10120666 3300009098 Unclassified 2449
200 Ga0105247_10000408 3300009101 Bacteria 36396
201 Ga0105247_10015502 3300009101 Bacteria 4564
202 Ga0114129_10000267 3300009147 Bacteria 59005
203 Ga0114129_10085891 3300009147 Unclassified 4365
204 Ga0105243_10239158 3300009148 Unclassified 1615
205 Ga0105241_10000056 3300009174 Bacteria 84758
206 Ga0105241_10000507 3300009174 Bacteria 29349
207 Ga0105241_10073450 3300009174 Bacteria 2661
208 Ga0105241_10220049 3300009174 Bacteria 1595
209 Ga0105242_10113983 3300009176 Bacteria 2309
210 Ga0105248_10122259 3300009177 Bacteria 2936
211 Ga0105237_10000284 3300009545 Bacteria 69955
212 Ga0105237_10001393 3300009545 Bacteria 31945
213 Ga0105237_10002285 3300009545 Bacteria 23813
214 Ga0105237_10002753 3300009545 Bacteria 21392
215 Ga0105237_10019243 3300009545 Bacteria 7054
216 Ga0105237_10026005 3300009545 Bacteria 5983
217 Ga0105237_10034875 3300009545 Bacteria 5091
218 Ga0105237_10122366 3300009545 Bacteria 2596
219 Ga0105237_10146206 3300009545 Bacteria 2359
220 Ga0105237_10444421 3300009545 Unclassified 1302
221 Ga0105238_10006282 3300009551 Bacteria 11809
222 Ga0105238_10020905 3300009551 Bacteria 6668
223 Ga0105238_10364711 3300009551 Unclassified 1434
224 Ga0105249_10000561 3300009553 Bacteria 34246
225 Ga0105249_10024147 3300009553 Bacteria 5462
226 Ga0105249_10052388 3300009553 Bacteria 3726
227 Ga0105249_10130049 3300009553 Bacteria 2402
228 Ga0105249_10159469 3300009553 Bacteria 2179
229 Ga0105239_10000129 3300010375 Bacteria 106549
230 Ga0105239_10000664 3300010375 Bacteria 48926
231 Ga0105239_10002123 3300010375 Bacteria 25586
232 Ga0105239_10004942 3300010375 Bacteria 15731
233 Ga0105239_10010397 3300010375 Bacteria 10412
234 Ga0105239_10039359 3300010375 Bacteria 5181
235 Ga0105239_10148255 3300010375 Unclassified 2618
236 Ga0105246_10006084 3300011119 Bacteria 7364
237 Ga0105246_10031846 3300011119 Bacteria 3492
238 Ga0105246_10140933 3300011119 Bacteria 1813
239 Ga0157370_10005131 3300013104 Bacteria 14768
240 Ga0157370_10020254 3300013104 Bacteria 6644
241 Ga0157370_10064348 3300013104 Bacteria 3472
242 Ga0157370_10081369 3300013104 Bacteria 3047
243 Ga0157369_10047886 3300013105 Bacteria 4640
244 Ga0157369_10070633 3300013105 Bacteria 3751
245 Ga0157369_10118065 3300013105 Bacteria 2815
246 Ga0157374_10000027 3300013296 Bacteria 233444
247 Ga0157374_10000505 3300013296 Bacteria 35194
248 Ga0157374_10001463 3300013296 Bacteria 19961
249 Ga0157374_10020839 3300013296 Bacteria 5823
250 Ga0157374_10058271 3300013296 Bacteria 3609
251 Ga0157374_10095642 3300013296 Bacteria 2840
252 Ga0157378_10023940 3300013297 Bacteria 5370
253 Ga0157378_10027435 3300013297 Bacteria 5026
254 Ga0163162_10000096 3300013306 Bacteria 80090
255 Ga0163162_10000237 3300013306 Bacteria 50279
256 Ga0163162_10001869 3300013306 Bacteria 19804
257 Ga0163162_10002092 3300013306 Bacteria 18741
258 Ga0163162_10021066 3300013306 Bacteria 6413
259 Ga0163162_10266884 3300013306 Bacteria 1843
260 Ga0157372_10001911 3300013307 Bacteria 22615
261 Ga0157372_10004879 3300013307 Bacteria 14259
262 Ga0157372_10043707 3300013307 Bacteria 4962
263 Ga0157372_10084624 3300013307 Bacteria 3595
264 Ga0157372_10122817 3300013307 Bacteria 2984
265 Ga0157372_10123655 3300013307 Bacteria 2974
266 Ga0157372_10133008 3300013307 Bacteria 2863
267 Ga0157372_10182077 3300013307 Bacteria 2432
268 Ga0157375_10000512 3300013308 Bacteria 34894
269 Ga0157375_10000599 3300013308 Bacteria 31988
270 Ga0157375_10004990 3300013308 Bacteria 11536
271 Ga0157375_10045989 3300013308 Bacteria 4252
272 Ga0157375_10057399 3300013308 Bacteria 3848
273 Ga0157375_10058515 3300013308 Bacteria 3813
274 Ga0157375_10096253 3300013308 Bacteria 3033
275 Ga0157375_10191113 3300013308 Bacteria 2202
276 Ga0163163_10000251 3300014325 Bacteria 54526
277 Ga0163163_10000343 3300014325 Bacteria 44866
278 Ga0163163_10000703 3300014325 Bacteria 28430
279 Ga0163163_10065499 3300014325 Bacteria 3607
280 Ga0163163_10081529 3300014325 Bacteria 3237
281 Ga0163163_10290409 3300014325 Bacteria 1687
282 Ga0163163_10356475 3300014325 Unclassified 1519
283 Ga0157380_10028049 3300014326 Bacteria 4289
284 Ga0157380_10370000 3300014326 Bacteria 1348
285 Ga0157377_10013019 3300014745 Bacteria 4200
286 Ga0157377_10037406 3300014745 Bacteria 2674
287 Ga0157379_10000128 3300014968 Bacteria 53403
288 Ga0157379_10022805 3300014968 Bacteria 5548
289 Ga0157376_10000971 3300014969 Bacteria 18693
290 Ga0157376_10001725 3300014969 Bacteria 14540
291 Ga0157376_10002110 3300014969 Bacteria 13382
292 Ga0157376_10048324 3300014969 Bacteria 3518
293 Ga0157376_10120861 3300014969 Bacteria 2321
294 Ga0157376_10136876 3300014969 Bacteria 2193
295 Ga0157376_10257764 3300014969 Bacteria 1632
296 Ga0163161_10008813 3300017792 Bacteria 6974
297 Ga0163161_10017752 3300017792 Bacteria 4985
298 Ga0213876_10001503 3300021384 Bacteria 14453
299 Ga0209436_100675 3300025208 Bacteria 14517
300 Ga0209436_101411 3300025208 Bacteria 8449
301 Ga0209258_100302 3300025242 Bacteria 79794
302 Ga0209646_1000004 3300025246 Bacteria 786587
303 Ga0209646_1001797 3300025246 Bacteria 5351
304 Ga0209026_1000095 3300025250 Bacteria 164309
305 Ga0209148_1000131 3300025254 Bacteria 174079
306 Ga0209673_1000078 3300025273 Bacteria 227727
307 Ga0209130_1000611 3300025284 Bacteria 34241
308 Ga0209564_1003616 3300025295 Bacteria 10288
309 Ga0209564_1004884 3300025295 Bacteria 7950
310 Ga0209758_1005348 3300025297 Bacteria 9961
311 Ga0209758_1005622 3300025297 Bacteria 9519
312 Ga0209758_1009342 3300025297 Bacteria 6116
313 Ga0209050_1000097 3300025298 Bacteria 239919
314 Ga0207426_1000033 3300025302 Bacteria 455976
315 Ga0207426_1000040 3300025302 Bacteria 433920
316 Ga0207426_1000313 3300025302 Bacteria 94934
317 Ga0207426_1000541 3300025302 Bacteria 54110
318 Ga0209257_1000070 3300025304 Bacteria 336454
319 Ga0209257_1004414 3300025304 Bacteria 10921
320 Ga0207656_10001991 3300025321 Bacteria 6804
321 Ga0207710_10003686 3300025900 Bacteria 6791
322 Ga0207710_10008208 3300025900 Bacteria 4409
323 Ga0207688_10005557 3300025901 Bacteria 6855
324 Ga0207680_10000014 3300025903 Bacteria 179035
325 Ga0207680_10000223 3300025903 Bacteria 27399
326 Ga0207680_10008850 3300025903 Bacteria 4963
327 Ga0207647_10031525 3300025904 Bacteria 3410
328 Ga0207647_10077389 3300025904 Bacteria 1999
329 Ga0207645_10000193 3300025907 Bacteria 49552
330 Ga0207645_10002708 3300025907 Bacteria 13802
331 Ga0207645_10055658 3300025907 Unclassified 2525
332 Ga0207643_10001613 3300025908 Bacteria 12724
333 Ga0207705_10001296 3300025909 Bacteria 20071
334 Ga0207654_10000267 3300025911 Bacteria 31855
335 Ga0207654_10001931 3300025911 Bacteria 10741
336 Ga0207707_10000026 3300025912 Bacteria 175026
337 Ga0207707_10000067 3300025912 Bacteria 105764
338 Ga0207695_10000041 3300025913 Bacteria 450902
339 Ga0207695_10000209 3300025913 Bacteria 157802
340 Ga0207695_10000300 3300025913 Bacteria 122104
341 Ga0207695_10000365 3300025913 Bacteria 103398
342 Ga0207695_10000483 3300025913 Bacteria 85395
343 Ga0207695_10014824 3300025913 Bacteria 9207
344 Ga0207695_10036840 3300025913 Bacteria 5283
345 Ga0207695_10071261 3300025913 Bacteria 3550
346 Ga0207695_10252253 3300025913 Bacteria 1664
347 Ga0207671_10000650 3300025914 Bacteria 45400
348 Ga0207671_10000746 3300025914 Bacteria 41287
349 Ga0207671_10001292 3300025914 Bacteria 29407
350 Ga0207671_10004601 3300025914 Bacteria 13097
351 Ga0207671_10017675 3300025914 Bacteria 5493
352 Ga0207671_10030627 3300025914 Bacteria 4011
353 Ga0207671_10097972 3300025914 Bacteria 2217
354 Ga0207660_10000165 3300025917 Bacteria 41631
355 Ga0207662_10045061 3300025918 Bacteria 2606
356 Ga0207657_10106125 3300025919 Bacteria 2324
357 Ga0207649_10001123 3300025920 Bacteria 16235
358 Ga0207652_10000109 3300025921 Bacteria 89337
359 Ga0207646_10071629 3300025922 Bacteria 3096
360 Ga0207694_10012170 3300025924 Bacteria 6487
361 Ga0207694_10090634 3300025924 Bacteria 2412
362 Ga0207650_10176392 3300025925 Bacteria 1701
363 Ga0207659_10033525 3300025926 Bacteria 3535
364 Ga0207659_10049252 3300025926 Bacteria 2988
365 Ga0207687_10032775 3300025927 Bacteria 3520
366 Ga0207687_10074837 3300025927 Unclassified 2428
367 Ga0207644_10062203 3300025931 Bacteria 2706
368 Ga0207644_10269886 3300025931 Bacteria 1363
369 Ga0207690_10172279 3300025932 Bacteria 1623
370 Ga0207706_10003423 3300025933 Bacteria 15150
371 Ga0207706_10004991 3300025933 Bacteria 12392
372 Ga0207706_10045685 3300025933 Bacteria 3879
373 Ga0207670_10028798 3300025936 Bacteria 3531
374 Ga0207704_10001257 3300025938 Bacteria 11322
375 Ga0207691_10000057 3300025940 Bacteria 89823
376 Ga0207691_10002498 3300025940 Bacteria 17985
377 Ga0207691_10027457 3300025940 Bacteria 5336
378 Ga0207691_10176648 3300025940 Bacteria 1867
379 Ga0207689_10001011 3300025942 Bacteria 27034
380 Ga0207689_10001062 3300025942 Bacteria 26443
381 Ga0207689_10002471 3300025942 Bacteria 17199
382 Ga0207689_10009342 3300025942 Bacteria 8473
383 Ga0207661_10001596 3300025944 Bacteria 15402
384 Ga0207679_10000768 3300025945 Bacteria 21047
385 Ga0207679_10143315 3300025945 Bacteria 1934
386 Ga0207667_10000902 3300025949 Bacteria 37879
387 Ga0207667_10005516 3300025949 Bacteria 15432
388 Ga0207667_10023943 3300025949 Bacteria 6717
389 Ga0207667_10110908 3300025949 Bacteria 2830
390 Ga0207667_10119567 3300025949 Bacteria 2715
391 Ga0207651_10000330 3300025960 Bacteria 20100
392 Ga0207651_10053824 3300025960 Bacteria 2754
393 Ga0207712_10001226 3300025961 Bacteria 17716
394 Ga0207712_10004325 3300025961 Bacteria 8970
395 Ga0207712_10007476 3300025961 Bacteria 6898
396 Ga0207712_10036310 3300025961 Bacteria 3355
397 Ga0207712_10132861 3300025961 Bacteria 1899
398 Ga0207712_10196381 3300025961 Bacteria 1596
399 Ga0207668_10000170 3300025972 Bacteria 45140
400 Ga0207668_10048121 3300025972 Bacteria 2924
401 Ga0207668_10050564 3300025972 Bacteria 2865
402 Ga0207640_10017137 3300025981 Bacteria 4232
403 Ga0207640_10041378 3300025981 Bacteria 2930
404 Ga0207658_10003501 3300025986 Bacteria 11076
405 Ga0207658_10069821 3300025986 Bacteria 2656
406 Ga0207658_10098934 3300025986 Unclassified 2280
407 Ga0207677_10011555 3300026023 Bacteria 5041
408 Ga0207677_10011966 3300026023 Bacteria 4969
409 Ga0207677_10135180 3300026023 Bacteria 1879
410 Ga0207703_10001287 3300026035 Bacteria 23239
411 Ga0207703_10009204 3300026035 Bacteria 7767
412 Ga0207703_10097482 3300026035 Bacteria 2484
413 Ga0207639_10000365 3300026041 Bacteria 31332
414 Ga0207639_10001406 3300026041 Bacteria 16243
415 Ga0207639_10013395 3300026041 Bacteria 5740
416 Ga0207639_10016897 3300026041 Bacteria 5169
417 Ga0207639_10019658 3300026041 Bacteria 4821
418 Ga0207639_10020656 3300026041 Bacteria 4717
419 Ga0207639_10059847 3300026041 Bacteria 2936
420 Ga0207639_10066112 3300026041 Bacteria 2809
421 Ga0207678_10293046 3300026067 Bacteria 1398
422 Ga0207702_10024235 3300026078 Bacteria 5035
423 Ga0207702_10030893 3300026078 Bacteria 4464
424 Ga0207641_10000015 3300026088 Bacteria 321332
425 Ga0207641_10075219 3300026088 Bacteria 2916
426 Ga0207648_10000914 3300026089 Bacteria 33242
427 Ga0207648_10003815 3300026089 Bacteria 15758
428 Ga0207648_10018863 3300026089 Bacteria 6233
429 Ga0207648_10141101 3300026089 Bacteria 2123
430 Ga0207676_10002484 3300026095 Bacteria 13139
431 Ga0207676_10005366 3300026095 Bacteria 9077
432 Ga0207676_10009485 3300026095 Bacteria 6928
433 Ga0207676_10022662 3300026095 Bacteria 4620
434 Ga0207676_10224315 3300026095 Bacteria 1676
435 Ga0207674_10012617 3300026116 Bacteria 9444
436 Ga0207674_10062236 3300026116 Unclassified 3769
437 Ga0207674_10117376 3300026116 Bacteria 2631
438 Ga0207674_10248285 3300026116 Bacteria 1726
439 Ga0207674_10278091 3300026116 Bacteria 1622
440 Ga0207675_100121016 3300026118 Unclassified 2476
441 Ga0207675_100335664 3300026118 Bacteria 1478
442 Ga0207683_10005618 3300026121 Bacteria 10757
443 Ga0207683_10054292 3300026121 Bacteria 3514
444 Ga0207683_10198414 3300026121 Bacteria 1823
445 Ga0207698_10001356 3300026142 Bacteria 14268
446 Ga0207698_10013713 3300026142 Bacteria 5360
447 Ga0207698_10356267 3300026142 Bacteria 1384
448 Ga0268266_10000104 3300028379 Bacteria 178320
449 Ga0268266_10016754 3300028379 Bacteria 6265
450 Ga0268265_10041574 3300028380 Bacteria 3404
451 Ga0268264_10000028 3300028381 Bacteria 426662
452 Ga0268264_10003959 3300028381 Bacteria 12685
453 Ga0268264_10003990 3300028381 Bacteria 12636
454 Ga0268264_10005074 3300028381 Bacteria 11154
455 Ga0268264_10010286 3300028381 Bacteria 7744
456 Ga0268264_10031862 3300028381 Bacteria 4324
457 Ga0307517_10001269 3300028786 Bacteria 42402
458 Ga0307515_10000001 3300028794 Bacteria 4259510
459 Ga0307515_10000118 3300028794 Bacteria 190444
460 Ga0307511_10000002 3300030521 Bacteria 199923
461 Ga0265327_10000024 3300031251 Bacteria 382499
462 Ga0265327_10000030 3300031251 Bacteria 333531
463 Ga0265327_10000089 3300031251 Bacteria 197227
464 Ga0265327_10029361 3300031251 Bacteria 3129
465 Ga0265316_10146743 3300031344 Bacteria 1769
466 Ga0307513_10178640 3300031456 Bacteria 1989
467 Ga0307509_10027688 3300031507 Bacteria 6305
468 Ga0307509_10048189 3300031507 Bacteria 4578
469 Ga0307509_10094673 3300031507 Bacteria 3045
470 Ga0307508_10052570 3300031616 Bacteria 3617
471 Ga0316576_10186613 3300031727 Bacteria 1564
472 Ga0307516_10003475 3300031730 Bacteria 20196
473 Ga0307516_10097703 3300031730 Bacteria 2756
474 Ga0307413_10241963 3300031824 Bacteria 1333
475 Ga0307510_10000141 3300033180 Bacteria 59562
476 Ga0316574_0033167 3300035398 Unclassified 3143
477 Ga0373927_0012939 3300035695 Bacteria 5549
478 Ga0395905_0013037 3300037471 Bacteria 7985
479 Ga0395905_0058158 3300037471 Bacteria 3616
480 Ga0436365_0640323 3300039437 Bacteria 3205
481 Ga0436365_1881620 3300039437 Bacteria 14517
482 Ga0439436_0001889 3300041404 Bacteria 6185
483 Ga0439439_0011411 3300041406 Bacteria 2138
484 Ga0439449_0023477 3300042007 Bacteria 2306
485 Ga0451577_0070836 3300042876 Bacteria 3109
486 Ga0466969_0001216 3300044656 Bacteria 13901
487 Ga0466969_0106721 3300044656 Bacteria 1314
488 Ga0466972_0000009 3300044658 Bacteria 256374
489 Ga0466972_0000069 3300044658 Bacteria 100746
490 Ga0466972_0006015 3300044658 Bacteria 6096
491 Ga0466972_0042810 3300044658 Bacteria 2200
492 Ga0466965_0042212 3300044683 Bacteria 2249
493 Ga0466966_0000184 3300044684 Bacteria 41499
494 Ga0466966_0062828 3300044684 Bacteria 2341
495 Ga0466961_0018283 3300044693 Unclassified 4506
496 Ga0466971_0017484 3300044719 Unclassified 3173
497 Ga0466971_0058830 3300044719 Bacteria 1735
498 Ga0466968_0018554 3300044735 Bacteria 2791
499 Ga0466968_0036057 3300044735 Bacteria 2071
500 Ga0466970_0002738 3300044765 Bacteria 8521
501 Ga0466957_0000547 3300044842 Bacteria 18983
502 Ga0466957_0001692 3300044842 Bacteria 11593
503 Ga0466959_0000097 3300045049 Bacteria 55620
504 Ga0466959_0000330 3300045049 Bacteria 27908
505 Ga0466959_0011869 3300045049 Bacteria 6275
506 Ga0466958_0013461 3300045836 Unclassified 4658
507 Ga0495627_006679 3300046453 Bacteria 4493
508 Ga0495638_0015704 3300046460 Bacteria 5079
509 Ga0495638_0110135 3300046460 Bacteria 1636
510 Ga0495606_0004246 3300046507 Bacteria 14488
511 Ga0495648_0018192 3300046524 Bacteria 4991
512 Ga0495633_0000125 3300046558 Bacteria 104459
513 Ga0495668_0000068 3300046616 Bacteria 176297
514 Ga0495668_0001044 3300046616 Bacteria 29358
515 Ga0495611_0000030 3300046648 Bacteria 111786
516 Ga0495625_0045225 3300046660 Bacteria 3184
517 Ga0495658_0011489 3300046683 Bacteria 4455
518 Ga0495670_0016797 3300046691 Bacteria 3599
519 Ga0495649_0005129 3300046694 Bacteria 8404
520 Ga0495636_0000006 3300047318 Bacteria 107323
521 Ga0495672_0013217 3300047320 Bacteria 5705
522 Ga0495672_0105770 3300047320 Unclassified 1518
523 Ga0495687_000726 3300047443 Bacteria 36440
524 Ga0495686_0000005 3300047472 Bacteria 827143
525 Ga0495686_0002275 3300047472 Bacteria 18481
526 Ga0495686_0014570 3300047472 Bacteria 5408
527 Ga0496101_0075668 3300048904 Bacteria 2479
528 Ga0496109_0037417 3300048912 Bacteria 4384
529 Ga0496115_0024727 3300048918 Bacteria 4671
530 Ga0496115_0306375 3300048918 Bacteria 1301
531 Ga0496121_0000081 3300048924 Bacteria 229506
532 Ga0496126_0012204 3300048929 Bacteria 8815
533 Ga0501290_002934 3300049513 Bacteria 2170
534 Ga0501298_003101 3300049521 Bacteria 2562
535 Ga0501031_0017714 3300049568 Bacteria 4631
536 Ga0501031_0058919 3300049568 Bacteria 2503
537 Ga0501032_0002853 3300049569 Bacteria 13437
538 Ga0501032_0003088 3300049569 Bacteria 12847
539 Ga0501033_0027388 3300049570 Bacteria 4285
540 Ga0501034_0003412 3300049571 Bacteria 18136
541 Ga0501034_0005631 3300049571 Bacteria 13642
542 Ga0501034_0118034 3300049571 Bacteria 2640
543 Ga0501034_0149085 3300049571 Unclassified 2315
544 Ga0501034_0280332 3300049571 Bacteria 1606
545 Ga0501036_0055222 3300049572 Bacteria 3364
546 Ga0501037_0012585 3300049573 Bacteria 6235
547 Ga0501037_0012956 3300049573 Bacteria 6146
548 Ga0501038_0021860 3300049574 Bacteria 5737
549 Ga0501039_0029637 3300049575 Bacteria 4215
550 Ga0501039_0048947 3300049575 Bacteria 3267
551 Ga0501043_0007087 3300049579 Bacteria 8920
552 Ga0501043_0014684 3300049579 Bacteria 6131
553 Ga0501046_0047480 3300049580 Bacteria 3403
554 Ga0501047_0015592 3300049581 Bacteria 7241
555 Ga0501047_0034176 3300049581 Bacteria 4909
556 Ga0501047_0182245 3300049581 Bacteria 1966
557 Ga0501047_0200168 3300049581 Bacteria 1858
558 Ga0501069_0067223 3300049585 Unclassified 2004
559 Ga0501070_0044503 3300049586 Bacteria 3693
560 Ga0501072_0130464 3300049588 Bacteria 2003
561 Ga0501073_0014474 3300049589 Bacteria 5731
562 Ga0501074_0004892 3300049590 Bacteria 9607
563 Ga0501201_000464 3300049651 Bacteria 3750
564 Ga0501202_000794 3300049652 Bacteria 4737
565 Ga0501207_000187 3300049654 Bacteria 5981
566 Ga0501233_000637 3300049668 Bacteria 5732
567 Ga0501235_000793 3300049669 Bacteria 6445
568 Ga0501243_001403 3300049675 Bacteria 3443
569 Ga0501251_000790 3300049681 Bacteria 2885
570 Ga0501257_005343 3300049686 Bacteria 2827
571 Ga0501257_013353 3300049686 Bacteria 1883
572 Ga0501259_000269 3300049688 Bacteria 8184
573 Ga0501259_004965 3300049688 Bacteria 2110
574 Ga0501261_003861 3300049690 Bacteria 1838
575 Ga0501221_001602 3300049704 Bacteria 3759
576 Ga0501225_0000322 3300049705 Bacteria 15026
577 Ga0501225_0000930 3300049705 Bacteria 9128
578 Ga0501225_0034088 3300049705 Bacteria 1402
579 Ga0501234_001438 3300049707 Bacteria 3740
580 Ga0501245_000749 3300049708 Bacteria 4030
581 Ga0501079_0046745 3300049741 Bacteria 3340
582 Ga0501080_0090747 3300049742 Bacteria 2837
583 Ga0501080_0208765 3300049742 Bacteria 1790
584 Ga0501080_0217623 3300049742 Unclassified 1748
585 Ga0501080_0269541 3300049742 Bacteria 1550
586 Ga0501083_0012439 3300049744 Bacteria 5955
587 Ga0501241_002043 3300049758 Bacteria 3953
588 Ga0501279_006477 3300049775 Bacteria 1547
589 Ga0501035_0007031 3300049822 Bacteria 10516
590 Ga0501035_0071510 3300049822 Bacteria 3071
591 Ga0501035_0102324 3300049822 Bacteria 2513
592 Ga0501044_0001096 3300049823 Bacteria 32262
593 Ga0501044_0155196 3300049823 Bacteria 2269
594 Ga0501044_0182384 3300049823 Bacteria 2065
595 Ga0501044_0259217 3300049823 Unclassified 1677
596 Ga0501212_002597 3300049851 Bacteria 2195
597 Ga0501284_00002 3300050005 Bacteria 220402
598 nmdc:mga0k408_5491_c1 3300050493 Bacteria 6749
599 nmdc:mga05p37_1224_c1 3300050507 Bacteria 29706
600 nmdc:mga06r32_1494_c1 3300050510 Bacteria 21025
601 nmdc:mga08y16_23475_c1 3300050511 Bacteria 6515
602 nmdc:mga0n895_115623_c1 3300050512 Bacteria 2701
603 Ga0500578_0005247 3300053086 Bacteria 8855
604 Ga0500644_0000026 3300053088 Bacteria 93328
605 Ga0500583_0000078 3300053092 Bacteria 58451
606 Ga0500583_0004221 3300053092 Bacteria 4649
607 Ga0500583_0008611 3300053092 Bacteria 3673
608 Ga0500583_0034389 3300053092 Bacteria 2252
609 Ga0500562_000012 3300053108 Bacteria 168210
610 Ga0500607_042901 3300053121 Bacteria 2441
611 Ga0500652_014362 3300053131 Bacteria 2829
612 Ga0500658_0002669 3300053134 Bacteria 6853
613 Ga0500559_0010116 3300053136 Bacteria 4060
614 Ga0500568_0006319 3300053139 Bacteria 5962
615 Ga0500577_0002713 3300053142 Bacteria 4545
616 Ga0500588_0002193 3300053146 Bacteria 3916
617 Ga0500590_017376 3300053148 Bacteria 3719
618 Ga0500616_0002242 3300053153 Bacteria 16521
619 Ga0500616_0016419 3300053153 Unclassified 4215
620 Ga0500622_0000404 3300053156 Bacteria 41279
621 Ga0500622_0000692 3300053156 Bacteria 29667
622 Ga0500622_0002382 3300053156 Bacteria 13624
623 Ga0500636_0012621 3300053177 Bacteria 4953
624 Ga0500611_000038 3300053727 Bacteria 71407
625 Ga0500661_000803 3300055283 Bacteria 5843
626 Ga0466962_0006433 3300061719 Bacteria 5639

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049758 Ga0501241_002043 Ga0501241_002043_17_1135 360
2 3300028794 Ga0307515_10000118 Ga0307515_1000011845 374
3 3300006871 Ga0075434_100004332 Ga0075434_10000433215 375
4 3300050512 nmdc:mga0n895_115623_c1 nmdc:mga0n895_115623_c1_1189_2406 375
5 3300044656 Ga0466969_0106721 Ga0466969_0106721_96_1286 376
6 3300047472 Ga0495686_0002275 Ga0495686_0002275_17032_18225 376
7 3300048918 Ga0496115_0306375 Ga0496115_0306375_143_1285 378
8 3300048904 Ga0496101_0075668 Ga0496101_0075668_1302_2447 379
9 3300053139 Ga0500568_0006319 Ga0500568_0006319_4805_5950 379
10 3300048912 Ga0496109_0037417 Ga0496109_0037417_19_1191 380
11 3300049686 Ga0501257_013353 Ga0501257_013353_88_1236 380
12 3300049588 Ga0501072_0130464 Ga0501072_0130464_336_1553 381
13 3300049742 Ga0501080_0208765 Ga0501080_0208765_132_1349 381
14 3300025904 Ga0207647_10077389 Ga0207647_100773892 382
15 3300046616 Ga0495668_0000068 Ga0495668_0000068_70248_71438 382
16 3300035695 Ga0373927_0012939 Ga0373927_0012939_2297_3514 383
17 3300053153 Ga0500616_0002242 Ga0500616_0002242_483_1673 384
18 3300003794 Ga0055531_10000054 Ga0055531_1000005453 385
19 3300025304 Ga0209257_1000070 Ga0209257_100007055 385
20 3300044658 Ga0466972_0042810 Ga0466972_0042810_1026_2189 385
21 3300053156 Ga0500622_0000692 Ga0500622_0000692_4612_5802 385
22 3300003320 rootH2_10048291 rootH2_1004829112 386
23 3300001989 JGI24739J22299_10000062 JGI24739J22299_1000006235 387
24 3300003354 JGI25160J50197_1005193 JGI25160J50197_10051932 387
25 3300003771 Ga0055526_1018422 Ga0055526_10184223 387
26 3300003771 Ga0055526_1033615 Ga0055526_10336151 387
27 3300003790 Ga0055528_1003039 Ga0055528_10030395 387
28 3300003791 Ga0055530_10000118 Ga0055530_1000011854 387
29 3300003794 Ga0055531_10029799 Ga0055531_100297992 387
30 3300005262 Ga0065165_1000027 Ga0065165_100002796 387
31 3300025273 Ga0209673_1000078 Ga0209673_1000078196 387
32 3300025295 Ga0209564_1003616 Ga0209564_10036164 387
33 3300025295 Ga0209564_1004884 Ga0209564_100488412 387
34 3300025297 Ga0209758_1005348 Ga0209758_100534811 387
35 3300025297 Ga0209758_1005622 Ga0209758_10056227 387
36 3300025298 Ga0209050_1000097 Ga0209050_1000097210 387
37 3300025302 Ga0207426_1000541 Ga0207426_100054112 387
38 3300025304 Ga0209257_1004414 Ga0209257_100441414 387
39 3300001979 JGI24740J21852_10000359 JGI24740J21852_1000035910 389
40 3300002738 JGI25154J39366_1000023 JGI25154J39366_1000023120 389
41 3300002741 JGI25157J39369_1008966 JGI25157J39369_10089661 389
42 3300003215 JGI25153J46596_10016298 JGI25153J46596_100162982 389
43 3300003354 JGI25160J50197_1010215 JGI25160J50197_10102153 389
44 3300005577 Ga0068857_100084803 Ga0068857_1000848033 389
45 3300013104 Ga0157370_10081369 Ga0157370_100813692 389
46 3300025246 Ga0209646_1000004 Ga0209646_1000004478 389
47 3300025250 Ga0209026_1000095 Ga0209026_100009586 389
48 3300025297 Ga0209758_1009342 Ga0209758_10093422 389
49 3300025302 Ga0207426_1000313 Ga0207426_10003139 389
50 3300026116 Ga0207674_10278091 Ga0207674_102780912 389
51 3300049581 Ga0501047_0034176 Ga0501047_0034176_1444_2634 389
52 3300049822 Ga0501035_0102324 Ga0501035_0102324_867_2057 389
53 3300053088 Ga0500644_0000026 Ga0500644_0000026_38525_39715 389
54 3300053092 Ga0500583_0004221 Ga0500583_0004221_1536_2726 389
55 3300053131 Ga0500652_014362 Ga0500652_014362_737_1927 389
56 3300053136 Ga0500559_0010116 Ga0500559_0010116_313_1503 389
57 3300053142 Ga0500577_0002713 Ga0500577_0002713_2548_3738 389
58 3300053148 Ga0500590_017376 Ga0500590_017376_815_2005 389
59 3300053177 Ga0500636_0012621 Ga0500636_0012621_954_2144 389
60 3300010375 Ga0105239_10004942 Ga0105239_1000494216 390
61 3300031251 Ga0265327_10000089 Ga0265327_1000008958 390
62 3300031730 Ga0307516_10003475 Ga0307516_1000347519 390
63 iso_pu_bacteria 2818991442 2819574897 390
64 iso_pu_bacteria 2818991460 2819676841 390
65 iso_pu_bacteria 2821136567 2821140997 390
66 iso_pu_bacteria 2840677318 2840678768 390
67 iso_pu_bacteria 2883068021 2883069580 390
68 iso_pu_bacteria 2884791551 2884796696 390
69 iso_pu_bacteria 2896085136 2896086586 390
70 iso_pu_bacteria 2896109856 2896113114 390
71 iso_pu_bacteria 2904467357 2904471497 390
72 iso_pu_bacteria 2929177148 2929177787 390
73 iso_pu_bacteria 2929239360 2929240150 390
74 iso_pu_bacteria 2929921140 2929921845 390
75 iso_pu_bacteria 2945977869 2945980134 390
76 iso_pu_bacteria 2946013367 2946014004 390
77 iso_pu_bacteria 8003151029 8003154086 390
78 3300031727 Ga0316576_10186613 Ga0316576_101866132 391
79 3300044719 Ga0466971_0058830 Ga0466971_0058830_197_1414 391
80 3300044842 Ga0466957_0001692 Ga0466957_0001692_9510_10727 391
81 3300053092 Ga0500583_0008611 Ga0500583_0008611_414_1631 391
82 3300005467 Ga0070706_100128501 Ga0070706_1001285012 392
83 3300013104 Ga0157370_10005131 Ga0157370_100051312 392
84 3300028786 Ga0307517_10001269 Ga0307517_1000126916 392
85 3300005468 Ga0070707_100066480 Ga0070707_1000664803 393
86 3300005468 Ga0070707_100071522 Ga0070707_1000715221 393
87 3300005614 Ga0068856_100475293 Ga0068856_1004752931 393
88 3300009545 Ga0105237_10026005 Ga0105237_100260052 393
89 3300025914 Ga0207671_10017675 Ga0207671_100176754 393
90 3300025922 Ga0207646_10071629 Ga0207646_100716291 393
91 3300031824 Ga0307413_10241963 Ga0307413_102419631 393
92 3300044656 Ga0466969_0001216 Ga0466969_0001216_856_2073 393
93 3300044684 Ga0466966_0000184 Ga0466966_0000184_23766_24983 393
94 3300045049 Ga0466959_0000097 Ga0466959_0000097_34686_35903 393
95 3300003316 rootH1_10078655 rootH1_100786551 394
96 3300003322 rootL2_10052422 rootL2_100524224 394
97 3300003761 Ga0055535_1004409 Ga0055535_10044093 394
98 3300025208 Ga0209436_100675 Ga0209436_1006755 394
99 3300025208 Ga0209436_101411 Ga0209436_1014114 394
100 3300025242 Ga0209258_100302 Ga0209258_10030234 394
101 3300025254 Ga0209148_1000131 Ga0209148_100013147 394
102 3300025284 Ga0209130_1000611 Ga0209130_100061117 394
103 3300025302 Ga0207426_1000033 Ga0207426_100003320 394
104 3300039437 Ga0436365_0640323 Ga0436365_0640323_1488_2705 394
105 3300045049 Ga0466959_0011869 Ga0466959_0011869_4520_5710 394
106 3300046453 Ga0495627_006679 Ga0495627_006679_1035_2255 394
107 3300046558 Ga0495633_0000125 Ga0495633_0000125_86270_87490 394
108 3300048924 Ga0496121_0000081 Ga0496121_0000081_43989_45179 394
109 3300048929 Ga0496126_0012204 Ga0496126_0012204_4636_5826 394
110 3300049571 Ga0501034_0118034 Ga0501034_0118034_370_1563 394
111 3300053121 Ga0500607_042901 Ga0500607_042901_74_1264 394
112 3300053134 Ga0500658_0002669 Ga0500658_0002669_2191_3381 394
113 3300055283 Ga0500661_000803 Ga0500661_000803_1434_2624 394
114 3300049705 Ga0501225_0034088 Ga0501225_0034088_18_1241 395
115 3300050005 Ga0501284_00002 Ga0501284_00002_189451_190674 395
116 3300005617 Ga0068859_100000933 Ga0068859_10000093324 396
117 3300006847 Ga0075431_100001819 Ga0075431_10000181918 396
118 3300006931 Ga0097620_100000933 Ga0097620_1000009338 396
119 3300035398 Ga0316574_0033167 Ga0316574_0033167_658_1851 396
120 3300013306 Ga0163162_10021066 Ga0163162_100210665 398
121 3300013308 Ga0157375_10004990 Ga0157375_100049906 398
122 3300014325 Ga0163163_10356475 Ga0163163_103564752 398
123 3300014968 Ga0157379_10022805 Ga0157379_100228053 398
124 3300025919 Ga0207657_10106125 Ga0207657_101061252 398
125 3300049571 Ga0501034_0149085 Ga0501034_0149085_635_1840 399
126 3300049742 Ga0501080_0269541 Ga0501080_0269541_213_1418 399
127 3300049823 Ga0501044_0155196 Ga0501044_0155196_181_1386 399
128 3300049823 Ga0501044_0259217 Ga0501044_0259217_265_1470 399
129 iso_pu_bacteria 2738541278 2738725230 399
130 iso_pu_bacteria 2818991444 2819586181 399
131 iso_pu_bacteria 2929154850 2929158904 399
132 3300025944 Ga0207661_10001596 Ga0207661_100015963 400
133 3300048918 Ga0496115_0024727 Ga0496115_0024727_3189_4394 400
134 3300005289 Ga0065704_10129419 Ga0065704_101294192 401
135 3300005290 Ga0065712_10142763 Ga0065712_101427631 401
136 3300005334 Ga0068869_100001381 Ga0068869_10000138115 401
137 3300005340 Ga0070689_100013486 Ga0070689_1000134867 401
138 3300005344 Ga0070661_100019009 Ga0070661_1000190095 401
139 3300005354 Ga0070675_100094089 Ga0070675_1000940891 401
140 3300005364 Ga0070673_100232178 Ga0070673_1002321781 401
141 3300005365 Ga0070688_100014398 Ga0070688_1000143984 401
142 3300005618 Ga0068864_100008752 Ga0068864_1000087529 401
143 3300006844 Ga0075428_100257605 Ga0075428_1002576051 401
144 3300006880 Ga0075429_100127361 Ga0075429_1001273613 401
145 3300009094 Ga0111539_10035856 Ga0111539_100358564 401
146 3300009147 Ga0114129_10085891 Ga0114129_100858914 401
147 3300013296 Ga0157374_10001463 Ga0157374_1000146323 401
148 3300013308 Ga0157375_10058515 Ga0157375_100585153 401
149 3300014325 Ga0163163_10000343 Ga0163163_1000034314 401
150 3300014745 Ga0157377_10037406 Ga0157377_100374063 401
151 3300025926 Ga0207659_10033525 Ga0207659_100335252 401
152 3300025933 Ga0207706_10045685 Ga0207706_100456852 401
153 3300025936 Ga0207670_10028798 Ga0207670_100287984 401
154 3300025940 Ga0207691_10176648 Ga0207691_101766481 401
155 3300025942 Ga0207689_10001062 Ga0207689_100010622 401
156 3300025945 Ga0207679_10143315 Ga0207679_101433152 401
157 3300025960 Ga0207651_10053824 Ga0207651_100538243 401
158 3300026067 Ga0207678_10293046 Ga0207678_102930461 401
159 3300026095 Ga0207676_10022662 Ga0207676_100226621 401
160 3300026116 Ga0207674_10062236 Ga0207674_100622363 401
161 3300047472 Ga0495686_0000005 Ga0495686_0000005_787110_788321 401
162 3300049569 Ga0501032_0002853 Ga0501032_0002853_51_1304 401
163 3300049570 Ga0501033_0027388 Ga0501033_0027388_2303_3610 401
164 3300049571 Ga0501034_0003412 Ga0501034_0003412_8183_9490 401
165 3300049573 Ga0501037_0012956 Ga0501037_0012956_511_1764 401
166 3300049579 Ga0501043_0007087 Ga0501043_0007087_3833_5044 401
167 3300049823 Ga0501044_0001096 Ga0501044_0001096_12893_14146 401
168 3300050510 nmdc:mga06r32_1494_c1 nmdc:mga06r32_1494_c1_6060_7271 401
169 3300050511 nmdc:mga08y16_23475_c1 nmdc:mga08y16_23475_c1_3165_4376 401
170 3300005328 Ga0070676_10048392 Ga0070676_100483922 402
171 3300005329 Ga0070683_100001393 Ga0070683_1000013934 402
172 3300005335 Ga0070666_10108354 Ga0070666_101083542 402
173 3300005340 Ga0070689_100032797 Ga0070689_1000327974 402
174 3300005344 Ga0070661_100000700 Ga0070661_1000007004 402
175 3300005353 Ga0070669_100253945 Ga0070669_1002539451 402
176 3300005466 Ga0070685_10053861 Ga0070685_100538612 402
177 3300005535 Ga0070684_100002311 Ga0070684_10000231112 402
178 3300005539 Ga0068853_100000395 Ga0068853_1000003959 402
179 3300005577 Ga0068857_100001502 Ga0068857_1000015022 402
180 3300005842 Ga0068858_100034237 Ga0068858_1000342376 402
181 3300013296 Ga0157374_10095642 Ga0157374_100956424 402
182 3300013308 Ga0157375_10045989 Ga0157375_100459896 402
183 3300025920 Ga0207649_10001123 Ga0207649_100011233 402
184 3300025945 Ga0207679_10000768 Ga0207679_100007683 402
185 3300025986 Ga0207658_10098934 Ga0207658_100989341 402
186 3300026023 Ga0207677_10011966 Ga0207677_100119663 402
187 3300026041 Ga0207639_10000365 Ga0207639_1000036522 402
188 3300026116 Ga0207674_10117376 Ga0207674_101173763 402
189 3300026118 Ga0207675_100335664 Ga0207675_1003356641 402
190 3300030521 Ga0307511_10000002 Ga0307511_10000002125 402
191 3300031730 Ga0307516_10097703 Ga0307516_100977033 402
192 3300046460 Ga0495638_0110135 Ga0495638_0110135_193_1407 402
193 3300049688 Ga0501259_004965 Ga0501259_004965_771_1988 402
194 3300001979 JGI24740J21852_10015040 JGI24740J21852_100150402 403
195 3300003316 rootH1_10094712 rootH1_100947122 403
196 3300003320 rootH2_10031448 rootH2_1003144816 403
197 3300003322 rootL2_10066841 rootL2_100668412 403
198 3300003322 rootL2_10189599 rootL2_101895992 403
199 3300003323 rootH1_10005699 rootH1_100056993 403
200 3300003354 JGI25160J50197_1003646 JGI25160J50197_10036462 403
201 3300005288 Ga0065714_10069413 Ga0065714_100694135 403
202 3300005293 Ga0065715_10129339 Ga0065715_101293392 403
203 3300005328 Ga0070676_10004674 Ga0070676_100046746 403
204 3300005329 Ga0070683_100032986 Ga0070683_1000329864 403
205 3300005331 Ga0070670_100111399 Ga0070670_1001113992 403
206 3300005333 Ga0070677_10022935 Ga0070677_100229353 403
207 3300005334 Ga0068869_100049947 Ga0068869_1000499472 403
208 3300005335 Ga0070666_10000132 Ga0070666_1000013227 403
209 3300005335 Ga0070666_10003676 Ga0070666_100036765 403
210 3300005335 Ga0070666_10030445 Ga0070666_100304454 403
211 3300005337 Ga0070682_100000008 Ga0070682_100000008121 403
212 3300005338 Ga0068868_100005565 Ga0068868_1000055654 403
213 3300005338 Ga0068868_100007251 Ga0068868_1000072513 403
214 3300005344 Ga0070661_100063563 Ga0070661_1000635631 403
215 3300005347 Ga0070668_100014784 Ga0070668_1000147843 403
216 3300005347 Ga0070668_100112299 Ga0070668_1001122992 403
217 3300005355 Ga0070671_100023690 Ga0070671_1000236904 403
218 3300005364 Ga0070673_100131024 Ga0070673_1001310241 403
219 3300005364 Ga0070673_100267689 Ga0070673_1002676891 403
220 3300005366 Ga0070659_100014492 Ga0070659_1000144924 403
221 3300005366 Ga0070659_100202637 Ga0070659_1002026371 403
222 3300005367 Ga0070667_100002402 Ga0070667_1000024028 403
223 3300005367 Ga0070667_100013431 Ga0070667_1000134313 403
224 3300005367 Ga0070667_100340252 Ga0070667_1003402521 403
225 3300005456 Ga0070678_100003657 Ga0070678_1000036576 403
226 3300005456 Ga0070678_100034897 Ga0070678_1000348973 403
227 3300005457 Ga0070662_100049365 Ga0070662_1000493653 403
228 3300005459 Ga0068867_100075785 Ga0068867_1000757852 403
229 3300005539 Ga0068853_100001004 Ga0068853_10000100410 403
230 3300005539 Ga0068853_100019995 Ga0068853_1000199955 403
231 3300005539 Ga0068853_100044637 Ga0068853_1000446373 403
232 3300005539 Ga0068853_100084824 Ga0068853_1000848241 403
233 3300005543 Ga0070672_100075811 Ga0070672_1000758113 403
234 3300005548 Ga0070665_100000047 Ga0070665_100000047131 403
235 3300005548 Ga0070665_100275504 Ga0070665_1002755042 403
236 3300005563 Ga0068855_100067120 Ga0068855_1000671203 403
237 3300005563 Ga0068855_100143636 Ga0068855_1001436362 403
238 3300005577 Ga0068857_100002865 Ga0068857_1000028656 403
239 3300005577 Ga0068857_100224112 Ga0068857_1002241122 403
240 3300005578 Ga0068854_100021090 Ga0068854_1000210904 403
241 3300005578 Ga0068854_100071353 Ga0068854_1000713533 403
242 3300005614 Ga0068856_100014397 Ga0068856_1000143973 403
243 3300005614 Ga0068856_100041025 Ga0068856_1000410252 403
244 3300005616 Ga0068852_100006330 Ga0068852_1000063302 403
245 3300005616 Ga0068852_100015185 Ga0068852_1000151855 403
246 3300005616 Ga0068852_100064901 Ga0068852_1000649013 403
247 3300005617 Ga0068859_100000003 Ga0068859_100000003321 403
248 3300005617 Ga0068859_100005582 Ga0068859_1000055829 403
249 3300005617 Ga0068859_100006236 Ga0068859_1000062368 403
250 3300005617 Ga0068859_100061943 Ga0068859_1000619433 403
251 3300005617 Ga0068859_100146288 Ga0068859_1001462882 403
252 3300005618 Ga0068864_100005055 Ga0068864_1000050556 403
253 3300005618 Ga0068864_100012271 Ga0068864_1000122714 403
254 3300005618 Ga0068864_100167268 Ga0068864_1001672683 403
255 3300005834 Ga0068851_10019916 Ga0068851_100199163 403
256 3300005834 Ga0068851_10027102 Ga0068851_100271022 403
257 3300005834 Ga0068851_10063006 Ga0068851_100630062 403
258 3300005841 Ga0068863_100000394 Ga0068863_10000039419 403
259 3300005841 Ga0068863_100049856 Ga0068863_1000498563 403
260 3300005841 Ga0068863_100092206 Ga0068863_1000922064 403
261 3300005842 Ga0068858_100023584 Ga0068858_1000235841 403
262 3300005843 Ga0068860_100000003 Ga0068860_100000003481 403
263 3300005843 Ga0068860_100000829 Ga0068860_1000008296 403
264 3300005843 Ga0068860_100002493 Ga0068860_10000249316 403
265 3300005843 Ga0068860_100006719 Ga0068860_1000067193 403
266 3300005843 Ga0068860_100032165 Ga0068860_1000321653 403
267 3300005843 Ga0068860_100087290 Ga0068860_1000872901 403
268 3300005983 Ga0081540_1007577 Ga0081540_10075777 403
269 3300006195 Ga0075366_10006015 Ga0075366_100060151 403
270 3300006195 Ga0075366_10134520 Ga0075366_101345201 403
271 3300006237 Ga0097621_100000352 Ga0097621_10000035223 403
272 3300006237 Ga0097621_100084541 Ga0097621_1000845412 403
273 3300006358 Ga0068871_100001720 Ga0068871_1000017209 403
274 3300006358 Ga0068871_100011054 Ga0068871_1000110543 403
275 3300006358 Ga0068871_100011985 Ga0068871_1000119858 403
276 3300006881 Ga0068865_100021362 Ga0068865_1000213623 403
277 3300006881 Ga0068865_100105288 Ga0068865_1001052882 403
278 3300006931 Ga0097620_100000003 Ga0097620_100000003321 403
279 3300006931 Ga0097620_100005582 Ga0097620_1000055829 403
280 3300006931 Ga0097620_100006236 Ga0097620_1000062368 403
281 3300006931 Ga0097620_100061941 Ga0097620_1000619413 403
282 3300006931 Ga0097620_100146283 Ga0097620_1001462832 403
283 3300009093 Ga0105240_10000098 Ga0105240_10000098116 403
284 3300009093 Ga0105240_10000356 Ga0105240_1000035626 403
285 3300009093 Ga0105240_10000383 Ga0105240_1000038353 403
286 3300009093 Ga0105240_10000401 Ga0105240_1000040137 403
287 3300009093 Ga0105240_10004458 Ga0105240_1000445820 403
288 3300009093 Ga0105240_10006383 Ga0105240_1000638313 403
289 3300009093 Ga0105240_10009536 Ga0105240_100095362 403
290 3300009093 Ga0105240_10056040 Ga0105240_100560403 403
291 3300009093 Ga0105240_10294082 Ga0105240_102940821 403
292 3300009094 Ga0111539_10086011 Ga0111539_100860111 403
293 3300009098 Ga0105245_10064448 Ga0105245_100644482 403
294 3300009101 Ga0105247_10000408 Ga0105247_100004087 403
295 3300009101 Ga0105247_10015502 Ga0105247_100155023 403
296 3300009147 Ga0114129_10000267 Ga0114129_100002678 403
297 3300009148 Ga0105243_10239158 Ga0105243_102391582 403
298 3300009174 Ga0105241_10000507 Ga0105241_100005075 403
299 3300009174 Ga0105241_10220049 Ga0105241_102200492 403
300 3300009176 Ga0105242_10113983 Ga0105242_101139833 403
301 3300009545 Ga0105237_10001393 Ga0105237_1000139323 403
302 3300009545 Ga0105237_10002285 Ga0105237_1000228515 403
303 3300009545 Ga0105237_10002753 Ga0105237_100027534 403
304 3300009545 Ga0105237_10019243 Ga0105237_100192431 403
305 3300009545 Ga0105237_10034875 Ga0105237_100348752 403
306 3300009545 Ga0105237_10122366 Ga0105237_101223662 403
307 3300009545 Ga0105237_10146206 Ga0105237_101462062 403
308 3300009545 Ga0105237_10444421 Ga0105237_104444211 403
309 3300009551 Ga0105238_10006282 Ga0105238_1000628212 403
310 3300009551 Ga0105238_10020905 Ga0105238_100209054 403
311 3300009553 Ga0105249_10000561 Ga0105249_1000056128 403
312 3300009553 Ga0105249_10024147 Ga0105249_100241477 403
313 3300009553 Ga0105249_10130049 Ga0105249_101300491 403
314 3300009553 Ga0105249_10159469 Ga0105249_101594692 403
315 3300010375 Ga0105239_10000129 Ga0105239_1000012961 403
316 3300010375 Ga0105239_10000664 Ga0105239_1000066418 403
317 3300010375 Ga0105239_10002123 Ga0105239_1000212320 403
318 3300010375 Ga0105239_10010397 Ga0105239_100103976 403
319 3300010375 Ga0105239_10039359 Ga0105239_100393592 403
320 3300010375 Ga0105239_10148255 Ga0105239_101482552 403
321 3300011119 Ga0105246_10006084 Ga0105246_100060845 403
322 3300011119 Ga0105246_10031846 Ga0105246_100318463 403
323 3300011119 Ga0105246_10140933 Ga0105246_101409332 403
324 3300013104 Ga0157370_10020254 Ga0157370_100202544 403
325 3300013105 Ga0157369_10047886 Ga0157369_100478862 403
326 3300013105 Ga0157369_10118065 Ga0157369_101180651 403
327 3300013296 Ga0157374_10020839 Ga0157374_100208392 403
328 3300013296 Ga0157374_10058271 Ga0157374_100582713 403
329 3300013297 Ga0157378_10023940 Ga0157378_100239403 403
330 3300013306 Ga0163162_10000237 Ga0163162_1000023736 403
331 3300013306 Ga0163162_10001869 Ga0163162_100018691 403
332 3300013306 Ga0163162_10002092 Ga0163162_1000209214 403
333 3300013306 Ga0163162_10266884 Ga0163162_102668842 403
334 3300013307 Ga0157372_10001911 Ga0157372_100019115 403
335 3300013307 Ga0157372_10004879 Ga0157372_100048792 403
336 3300013307 Ga0157372_10122817 Ga0157372_101228172 403
337 3300013307 Ga0157372_10133008 Ga0157372_101330081 403
338 3300013307 Ga0157372_10182077 Ga0157372_101820772 403
339 3300013308 Ga0157375_10000599 Ga0157375_1000059924 403
340 3300013308 Ga0157375_10057399 Ga0157375_100573993 403
341 3300013308 Ga0157375_10096253 Ga0157375_100962533 403
342 3300013308 Ga0157375_10191113 Ga0157375_101911132 403
343 3300014325 Ga0163163_10000703 Ga0163163_1000070326 403
344 3300014325 Ga0163163_10065499 Ga0163163_100654992 403
345 3300014325 Ga0163163_10290409 Ga0163163_102904091 403
346 3300014969 Ga0157376_10000971 Ga0157376_100009718 403
347 3300014969 Ga0157376_10048324 Ga0157376_100483242 403
348 3300014969 Ga0157376_10120861 Ga0157376_101208612 403
349 3300014969 Ga0157376_10257764 Ga0157376_102577642 403
350 3300017792 Ga0163161_10008813 Ga0163161_100088136 403
351 3300017792 Ga0163161_10017752 Ga0163161_100177524 403
352 3300021384 Ga0213876_10001503 Ga0213876_100015031 403
353 3300025246 Ga0209646_1001797 Ga0209646_10017972 403
354 3300025302 Ga0207426_1000040 Ga0207426_1000040188 403
355 3300025900 Ga0207710_10003686 Ga0207710_100036864 403
356 3300025900 Ga0207710_10008208 Ga0207710_100082083 403
357 3300025901 Ga0207688_10005557 Ga0207688_100055574 403
358 3300025903 Ga0207680_10000014 Ga0207680_10000014122 403
359 3300025903 Ga0207680_10008850 Ga0207680_100088502 403
360 3300025907 Ga0207645_10000193 Ga0207645_1000019334 403
361 3300025908 Ga0207643_10001613 Ga0207643_1000161310 403
362 3300025911 Ga0207654_10001931 Ga0207654_1000193113 403
363 3300025913 Ga0207695_10000041 Ga0207695_10000041276 403
364 3300025913 Ga0207695_10000209 Ga0207695_1000020926 403
365 3300025913 Ga0207695_10000300 Ga0207695_1000030021 403
366 3300025913 Ga0207695_10000365 Ga0207695_1000036579 403
367 3300025913 Ga0207695_10014824 Ga0207695_100148247 403
368 3300025913 Ga0207695_10036840 Ga0207695_100368404 403
369 3300025913 Ga0207695_10252253 Ga0207695_102522532 403
370 3300025914 Ga0207671_10000746 Ga0207671_1000074617 403
371 3300025914 Ga0207671_10001292 Ga0207671_100012922 403
372 3300025914 Ga0207671_10004601 Ga0207671_100046018 403
373 3300025914 Ga0207671_10030627 Ga0207671_100306273 403
374 3300025914 Ga0207671_10097972 Ga0207671_100979722 403
375 3300025918 Ga0207662_10045061 Ga0207662_100450612 403
376 3300025924 Ga0207694_10012170 Ga0207694_100121705 403
377 3300025924 Ga0207694_10090634 Ga0207694_100906341 403
378 3300025925 Ga0207650_10176392 Ga0207650_101763922 403
379 3300025927 Ga0207687_10032775 Ga0207687_100327751 403
380 3300025931 Ga0207644_10062203 Ga0207644_100622032 403
381 3300025931 Ga0207644_10269886 Ga0207644_102698861 403
382 3300025932 Ga0207690_10172279 Ga0207690_101722791 403
383 3300025933 Ga0207706_10004991 Ga0207706_100049917 403
384 3300025940 Ga0207691_10002498 Ga0207691_1000249810 403
385 3300025940 Ga0207691_10027457 Ga0207691_100274575 403
386 3300025942 Ga0207689_10001011 Ga0207689_100010116 403
387 3300025942 Ga0207689_10002471 Ga0207689_1000247115 403
388 3300025942 Ga0207689_10009342 Ga0207689_100093427 403
389 3300025949 Ga0207667_10000902 Ga0207667_1000090225 403
390 3300025949 Ga0207667_10119567 Ga0207667_101195672 403
391 3300025961 Ga0207712_10001226 Ga0207712_1000122613 403
392 3300025961 Ga0207712_10004325 Ga0207712_100043257 403
393 3300025961 Ga0207712_10036310 Ga0207712_100363102 403
394 3300025961 Ga0207712_10132861 Ga0207712_101328611 403
395 3300025961 Ga0207712_10196381 Ga0207712_101963811 403
396 3300025972 Ga0207668_10048121 Ga0207668_100481212 403
397 3300025972 Ga0207668_10050564 Ga0207668_100505643 403
398 3300025981 Ga0207640_10017137 Ga0207640_100171373 403
399 3300025981 Ga0207640_10041378 Ga0207640_100413781 403
400 3300025986 Ga0207658_10069821 Ga0207658_100698212 403
401 3300026023 Ga0207677_10011555 Ga0207677_100115553 403
402 3300026023 Ga0207677_10135180 Ga0207677_101351801 403
403 3300026035 Ga0207703_10009204 Ga0207703_100092047 403
404 3300026035 Ga0207703_10097482 Ga0207703_100974821 403
405 3300026041 Ga0207639_10016897 Ga0207639_100168972 403
406 3300026041 Ga0207639_10019658 Ga0207639_100196585 403
407 3300026041 Ga0207639_10020656 Ga0207639_100206563 403
408 3300026041 Ga0207639_10059847 Ga0207639_100598472 403
409 3300026041 Ga0207639_10066112 Ga0207639_100661122 403
410 3300026078 Ga0207702_10030893 Ga0207702_100308934 403
411 3300026088 Ga0207641_10000015 Ga0207641_10000015213 403
412 3300026088 Ga0207641_10075219 Ga0207641_100752192 403
413 3300026089 Ga0207648_10000914 Ga0207648_1000091416 403
414 3300026095 Ga0207676_10005366 Ga0207676_100053666 403
415 3300026095 Ga0207676_10009485 Ga0207676_100094854 403
416 3300026095 Ga0207676_10224315 Ga0207676_102243151 403
417 3300026116 Ga0207674_10012617 Ga0207674_100126176 403
418 3300026116 Ga0207674_10248285 Ga0207674_102482852 403
419 3300026121 Ga0207683_10005618 Ga0207683_100056188 403
420 3300026121 Ga0207683_10054292 Ga0207683_100542923 403
421 3300026121 Ga0207683_10198414 Ga0207683_101984142 403
422 3300026142 Ga0207698_10001356 Ga0207698_1000135612 403
423 3300028379 Ga0268266_10000104 Ga0268266_10000104112 403
424 3300028380 Ga0268265_10041574 Ga0268265_100415742 403
425 3300028381 Ga0268264_10000028 Ga0268264_10000028124 403
426 3300028381 Ga0268264_10003959 Ga0268264_100039599 403
427 3300028381 Ga0268264_10003990 Ga0268264_100039907 403
428 3300028381 Ga0268264_10005074 Ga0268264_100050744 403
429 3300028381 Ga0268264_10031862 Ga0268264_100318623 403
430 3300028794 Ga0307515_10000001 Ga0307515_100000013135 403
431 3300031251 Ga0265327_10000024 Ga0265327_10000024327 403
432 3300031251 Ga0265327_10000030 Ga0265327_1000003041 403
433 3300031251 Ga0265327_10029361 Ga0265327_100293612 403
434 3300031344 Ga0265316_10146743 Ga0265316_101467432 403
435 3300031456 Ga0307513_10178640 Ga0307513_101786402 403
436 3300031507 Ga0307509_10027688 Ga0307509_100276886 403
437 3300031507 Ga0307509_10048189 Ga0307509_100481895 403
438 3300031507 Ga0307509_10094673 Ga0307509_100946733 403
439 3300031616 Ga0307508_10052570 Ga0307508_100525703 403
440 3300033180 Ga0307510_10000141 Ga0307510_1000014115 403
441 3300037471 Ga0395905_0013037 Ga0395905_0013037_3567_4784 403
442 3300037471 Ga0395905_0058158 Ga0395905_0058158_1654_2871 403
443 3300039437 Ga0436365_1881620 Ga0436365_1881620_171_1388 403
444 3300041404 Ga0439436_0001889 Ga0439436_0001889_4440_5657 403
445 3300041406 Ga0439439_0011411 Ga0439439_0011411_751_1968 403
446 3300042007 Ga0439449_0023477 Ga0439449_0023477_909_2126 403
447 3300042876 Ga0451577_0070836 Ga0451577_0070836_1046_2263 403
448 3300044658 Ga0466972_0000009 Ga0466972_0000009_59858_61075 403
449 3300044658 Ga0466972_0000069 Ga0466972_0000069_5853_7070 403
450 3300044658 Ga0466972_0006015 Ga0466972_0006015_4075_5292 403
451 3300044683 Ga0466965_0042212 Ga0466965_0042212_233_1450 403
452 3300044735 Ga0466968_0018554 Ga0466968_0018554_1224_2441 403
453 3300044735 Ga0466968_0036057 Ga0466968_0036057_664_1881 403
454 3300044765 Ga0466970_0002738 Ga0466970_0002738_6614_7831 403
455 3300044842 Ga0466957_0000547 Ga0466957_0000547_7694_8911 403
456 3300046460 Ga0495638_0015704 Ga0495638_0015704_951_2168 403
457 3300046507 Ga0495606_0004246 Ga0495606_0004246_1584_2801 403
458 3300046524 Ga0495648_0018192 Ga0495648_0018192_2012_3229 403
459 3300046616 Ga0495668_0001044 Ga0495668_0001044_22401_23618 403
460 3300046648 Ga0495611_0000030 Ga0495611_0000030_39526_40743 403
461 3300046660 Ga0495625_0045225 Ga0495625_0045225_1161_2378 403
462 3300046694 Ga0495649_0005129 Ga0495649_0005129_2891_4108 403
463 3300047318 Ga0495636_0000006 Ga0495636_0000006_76532_77746 403
464 3300047320 Ga0495672_0013217 Ga0495672_0013217_1635_2855 403
465 3300047320 Ga0495672_0105770 Ga0495672_0105770_269_1486 403
466 3300047443 Ga0495687_000726 Ga0495687_000726_3188_4405 403
467 3300047472 Ga0495686_0014570 Ga0495686_0014570_846_2063 403
468 3300049568 Ga0501031_0058919 Ga0501031_0058919_1048_2265 403
469 3300049569 Ga0501032_0003088 Ga0501032_0003088_7814_9031 403
470 3300049571 Ga0501034_0005631 Ga0501034_0005631_8512_9729 403
471 3300049572 Ga0501036_0055222 Ga0501036_0055222_71_1288 403
472 3300049575 Ga0501039_0029637 Ga0501039_0029637_670_1887 403
473 3300049580 Ga0501046_0047480 Ga0501046_0047480_226_1443 403
474 3300049581 Ga0501047_0015592 Ga0501047_0015592_3032_4249 403
475 3300049581 Ga0501047_0182245 Ga0501047_0182245_697_1914 403
476 3300049581 Ga0501047_0200168 Ga0501047_0200168_410_1627 403
477 3300049589 Ga0501073_0014474 Ga0501073_0014474_1395_2612 403
478 3300049590 Ga0501074_0004892 Ga0501074_0004892_3733_4950 403
479 3300049686 Ga0501257_005343 Ga0501257_005343_1535_2752 403
480 3300049705 Ga0501225_0000322 Ga0501225_0000322_559_1776 403
481 3300049742 Ga0501080_0090747 Ga0501080_0090747_354_1571 403
482 3300049744 Ga0501083_0012439 Ga0501083_0012439_3208_4425 403
483 3300049822 Ga0501035_0007031 Ga0501035_0007031_7590_8807 403
484 3300049823 Ga0501044_0182384 Ga0501044_0182384_339_1556 403
485 3300050493 nmdc:mga0k408_5491_c1 nmdc:mga0k408_5491_c1_5226_6443 403
486 3300050507 nmdc:mga05p37_1224_c1 nmdc:mga05p37_1224_c1_8721_9938 403
487 3300053086 Ga0500578_0005247 Ga0500578_0005247_6029_7246 403
488 3300053092 Ga0500583_0000078 Ga0500583_0000078_24429_25646 403
489 3300053092 Ga0500583_0034389 Ga0500583_0034389_480_1697 403
490 3300053108 Ga0500562_000012 Ga0500562_000012_40946_42166 403
491 3300053146 Ga0500588_0002193 Ga0500588_0002193_773_1990 403
492 3300053153 Ga0500616_0016419 Ga0500616_0016419_1390_2610 403
493 3300053156 Ga0500622_0000404 Ga0500622_0000404_5806_7026 403
494 3300053156 Ga0500622_0002382 Ga0500622_0002382_11435_12652 403
495 3300053727 Ga0500611_000038 Ga0500611_000038_31420_32712 403
496 2162886007 SwRhRL2b_contig_677025 SwRhRL2b_0927.00001220 404
497 3300003320 rootH2_10005170 rootH2_1000517027 404
498 3300005289 Ga0065704_10070133 Ga0065704_10070133369 404
499 3300005290 Ga0065712_10132147 Ga0065712_101321471 404
500 3300005328 Ga0070676_10000439 Ga0070676_1000043913 404
501 3300005329 Ga0070683_100002039 Ga0070683_10000203912 404
502 3300005331 Ga0070670_100011898 Ga0070670_1000118983 404
503 3300005331 Ga0070670_100075152 Ga0070670_1000751522 404
504 3300005337 Ga0070682_100000812 Ga0070682_1000008124 404
505 3300005338 Ga0068868_100000119 Ga0068868_10000011918 404
506 3300005341 Ga0070691_10000209 Ga0070691_100002094 404
507 3300005347 Ga0070668_100000645 Ga0070668_1000006457 404
508 3300005354 Ga0070675_100030083 Ga0070675_1000300833 404
509 3300005356 Ga0070674_100098174 Ga0070674_1000981742 404
510 3300005364 Ga0070673_100000331 Ga0070673_10000033117 404
511 3300005367 Ga0070667_100001052 Ga0070667_10000105210 404
512 3300005457 Ga0070662_100001338 Ga0070662_10000133812 404
513 3300005458 Ga0070681_10015209 Ga0070681_100152095 404
514 3300005459 Ga0068867_100002653 Ga0068867_1000026533 404
515 3300005530 Ga0070679_100000099 Ga0070679_10000009930 404
516 3300005535 Ga0070684_100007507 Ga0070684_1000075078 404
517 3300005539 Ga0068853_100001959 Ga0068853_10000195915 404
518 3300005539 Ga0068853_100019744 Ga0068853_1000197445 404
519 3300005543 Ga0070672_100000183 Ga0070672_10000018321 404
520 3300005544 Ga0070686_100009707 Ga0070686_1000097075 404
521 3300005548 Ga0070665_100001045 Ga0070665_10000104520 404
522 3300005563 Ga0068855_100018034 Ga0068855_10001803410 404
523 3300005563 Ga0068855_100028092 Ga0068855_1000280924 404
524 3300005563 Ga0068855_100077021 Ga0068855_1000770213 404
525 3300005564 Ga0070664_100015826 Ga0070664_1000158263 404
526 3300005578 Ga0068854_100019088 Ga0068854_1000190883 404
527 3300005615 Ga0070702_100008510 Ga0070702_1000085101 404
528 3300005616 Ga0068852_100198184 Ga0068852_1001981842 404
529 3300005617 Ga0068859_100064203 Ga0068859_1000642033 404
530 3300005618 Ga0068864_100002400 Ga0068864_10000240016 404
531 3300005618 Ga0068864_100111223 Ga0068864_1001112232 404
532 3300005841 Ga0068863_100001935 Ga0068863_10000193519 404
533 3300005843 Ga0068860_100002234 Ga0068860_10000223421 404
534 3300005985 Ga0081539_10000534 Ga0081539_1000053435 404
535 3300005985 Ga0081539_10014443 Ga0081539_100144434 404
536 3300006237 Ga0097621_100003204 Ga0097621_1000032043 404
537 3300006358 Ga0068871_100023716 Ga0068871_1000237164 404
538 3300006881 Ga0068865_100000660 Ga0068865_1000006603 404
539 3300006931 Ga0097620_100064203 Ga0097620_1000642033 404
540 3300009093 Ga0105240_10002820 Ga0105240_1000282023 404
541 3300009093 Ga0105240_10003287 Ga0105240_1000328712 404
542 3300009094 Ga0111539_10260602 Ga0111539_102606021 404
543 3300009098 Ga0105245_10120666 Ga0105245_101206662 404
544 3300009174 Ga0105241_10000056 Ga0105241_1000005631 404
545 3300009174 Ga0105241_10073450 Ga0105241_100734502 404
546 3300009177 Ga0105248_10122259 Ga0105248_101222593 404
547 3300009545 Ga0105237_10000284 Ga0105237_1000028423 404
548 3300009551 Ga0105238_10364711 Ga0105238_103647111 404
549 3300009553 Ga0105249_10052388 Ga0105249_100523883 404
550 3300013104 Ga0157370_10064348 Ga0157370_100643483 404
551 3300013105 Ga0157369_10070633 Ga0157369_100706334 404
552 3300013296 Ga0157374_10000027 Ga0157374_10000027139 404
553 3300013296 Ga0157374_10000505 Ga0157374_1000050512 404
554 3300013297 Ga0157378_10027435 Ga0157378_100274353 404
555 3300013306 Ga0163162_10000096 Ga0163162_1000009639 404
556 3300013307 Ga0157372_10043707 Ga0157372_100437071 404
557 3300013307 Ga0157372_10084624 Ga0157372_100846242 404
558 3300013307 Ga0157372_10123655 Ga0157372_101236551 404
559 3300013308 Ga0157375_10000512 Ga0157375_1000051225 404
560 3300014325 Ga0163163_10000251 Ga0163163_100002515 404
561 3300014325 Ga0163163_10081529 Ga0163163_100815293 404
562 3300014326 Ga0157380_10028049 Ga0157380_100280494 404
563 3300014326 Ga0157380_10370000 Ga0157380_103700002 404
564 3300014745 Ga0157377_10013019 Ga0157377_100130192 404
565 3300014968 Ga0157379_10000128 Ga0157379_100001285 404
566 3300014969 Ga0157376_10001725 Ga0157376_100017258 404
567 3300014969 Ga0157376_10002110 Ga0157376_100021107 404
568 3300014969 Ga0157376_10136876 Ga0157376_101368762 404
569 3300025321 Ga0207656_10001991 Ga0207656_100019915 404
570 3300025903 Ga0207680_10000223 Ga0207680_1000022319 404
571 3300025904 Ga0207647_10031525 Ga0207647_100315253 404
572 3300025907 Ga0207645_10002708 Ga0207645_100027085 404
573 3300025907 Ga0207645_10055658 Ga0207645_100556582 404
574 3300025909 Ga0207705_10001296 Ga0207705_100012963 404
575 3300025911 Ga0207654_10000267 Ga0207654_1000026711 404
576 3300025912 Ga0207707_10000026 Ga0207707_1000002694 404
577 3300025912 Ga0207707_10000067 Ga0207707_1000006741 404
578 3300025913 Ga0207695_10000483 Ga0207695_1000048339 404
579 3300025913 Ga0207695_10071261 Ga0207695_100712613 404
580 3300025914 Ga0207671_10000650 Ga0207671_1000065018 404
581 3300025917 Ga0207660_10000165 Ga0207660_1000016530 404
582 3300025921 Ga0207652_10000109 Ga0207652_1000010939 404
583 3300025926 Ga0207659_10049252 Ga0207659_100492523 404
584 3300025927 Ga0207687_10074837 Ga0207687_100748373 404
585 3300025933 Ga0207706_10003423 Ga0207706_1000342312 404
586 3300025938 Ga0207704_10001257 Ga0207704_100012573 404
587 3300025940 Ga0207691_10000057 Ga0207691_1000005727 404
588 3300025949 Ga0207667_10005516 Ga0207667_1000551612 404
589 3300025949 Ga0207667_10023943 Ga0207667_100239433 404
590 3300025949 Ga0207667_10110908 Ga0207667_101109082 404
591 3300025960 Ga0207651_10000330 Ga0207651_1000033010 404
592 3300025961 Ga0207712_10007476 Ga0207712_100074763 404
593 3300025972 Ga0207668_10000170 Ga0207668_1000017039 404
594 3300025986 Ga0207658_10003501 Ga0207658_100035017 404
595 3300026035 Ga0207703_10001287 Ga0207703_1000128721 404
596 3300026041 Ga0207639_10001406 Ga0207639_100014065 404
597 3300026041 Ga0207639_10013395 Ga0207639_100133953 404
598 3300026078 Ga0207702_10024235 Ga0207702_100242354 404
599 3300026089 Ga0207648_10003815 Ga0207648_100038155 404
600 3300026089 Ga0207648_10018863 Ga0207648_100188635 404
601 3300026089 Ga0207648_10141101 Ga0207648_101411012 404
602 3300026095 Ga0207676_10002484 Ga0207676_1000248413 404
603 3300026118 Ga0207675_100121016 Ga0207675_1001210164 404
604 3300026142 Ga0207698_10013713 Ga0207698_100137133 404
605 3300026142 Ga0207698_10356267 Ga0207698_103562671 404
606 3300028379 Ga0268266_10016754 Ga0268266_100167543 404
607 3300028381 Ga0268264_10010286 Ga0268264_100102867 404
608 3300044684 Ga0466966_0062828 Ga0466966_0062828_1068_2288 404
609 3300044693 Ga0466961_0018283 Ga0466961_0018283_1816_3036 404
610 3300044719 Ga0466971_0017484 Ga0466971_0017484_1850_3070 404
611 3300045049 Ga0466959_0000330 Ga0466959_0000330_20180_21400 404
612 3300045836 Ga0466958_0013461 Ga0466958_0013461_2187_3407 404
613 3300046683 Ga0495658_0011489 Ga0495658_0011489_187_1431 404
614 3300046691 Ga0495670_0016797 Ga0495670_0016797_676_1920 404
615 3300049513 Ga0501290_002934 Ga0501290_002934_749_1969 404
616 3300049521 Ga0501298_003101 Ga0501298_003101_1099_2319 404
617 3300049568 Ga0501031_0017714 Ga0501031_0017714_577_1797 404
618 3300049571 Ga0501034_0280332 Ga0501034_0280332_103_1347 404
619 3300049573 Ga0501037_0012585 Ga0501037_0012585_1631_2851 404
620 3300049574 Ga0501038_0021860 Ga0501038_0021860_3336_4556 404
621 3300049575 Ga0501039_0048947 Ga0501039_0048947_747_1967 404
622 3300049579 Ga0501043_0014684 Ga0501043_0014684_1431_2651 404
623 3300049585 Ga0501069_0067223 Ga0501069_0067223_155_1399 404
624 3300049586 Ga0501070_0044503 Ga0501070_0044503_475_1719 404
625 3300049651 Ga0501201_000464 Ga0501201_000464_1792_3108 404
626 3300049652 Ga0501202_000794 Ga0501202_000794_521_1837 404
627 3300049654 Ga0501207_000187 Ga0501207_000187_381_1697 404
628 3300049668 Ga0501233_000637 Ga0501233_000637_3313_4533 404
629 3300049669 Ga0501235_000793 Ga0501235_000793_3508_4824 404
630 3300049675 Ga0501243_001403 Ga0501243_001403_1594_2814 404
631 3300049681 Ga0501251_000790 Ga0501251_000790_677_1897 404
632 3300049688 Ga0501259_000269 Ga0501259_000269_713_1933 404
633 3300049690 Ga0501261_003861 Ga0501261_003861_501_1721 404
634 3300049704 Ga0501221_001602 Ga0501221_001602_1284_2600 404
635 3300049705 Ga0501225_0000930 Ga0501225_0000930_1452_2672 404
636 3300049707 Ga0501234_001438 Ga0501234_001438_514_1830 404
637 3300049708 Ga0501245_000749 Ga0501245_000749_2295_3611 404
638 3300049741 Ga0501079_0046745 Ga0501079_0046745_761_2005 404
639 3300049742 Ga0501080_0217623 Ga0501080_0217623_33_1277 404
640 3300049775 Ga0501279_006477 Ga0501279_006477_202_1422 404
641 3300049822 Ga0501035_0071510 Ga0501035_0071510_1684_2904 404
642 3300049851 Ga0501212_002597 Ga0501212_002597_799_2019 404
643 3300061719 Ga0466962_0006433 Ga0466962_0006433_1888_3108 404

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

65

203

0.91

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

42

377

0.89

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

49

209

0.86

PF01212

Beta_elim_lyase

Beta-eliminating lyase

69

391

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5k8b-assembly2.cif.gz_D x-ray structure of kdna, 8-amino-3,8-dideoxy-alpha-d-manno-octulosonate transaminase, from shewanella oneidensis in the presence of the external aldimine with plp and glutamate 0.9511 2 391
5k8b-assembly2.cif.gz_D x-ray structure of kdna, 8-amino-3,8-dideoxy-alpha-d-manno-octulosonate transaminase, from shewanella oneidensis in the presence of the external aldimine with plp and glutamate 0.9392 2 391
3nys-assembly1.cif.gz_A x-ray structure of the k185a mutant of wbpe (wlbe) from pseudomonas aeruginosa in complex with plp at 1.45 angstrom resolution 0.9164 10 394
7b0m-assembly1.cif.gz_AAA-2 sugar transaminase from a metagenome collected from troll oil field production water 0.9155 3 392
3frk-assembly1.cif.gz_B x-ray structure of qdtb from t. thermosaccharolyticum in complex with a plp:tdp-3-aminoquinovose aldimine 0.9102 10 390
ID Description Score Start End Superfamily
5k8bC01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9666 2 249 3.40.640.10
5k8bC01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.959 2 249 3.40.640.10
3bn1B01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9546 1 250 3.40.640.10
1b9iA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.936 10 247 3.40.640.10
3bn1B01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9349 1 250 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A3D4E1S7-F1-model_v4 deleted 0.9864 74 182
AF-A0A2N5JM67-F1-model_v4 Erythromycin biosynthesis sensory transduction protein eryC1 0.9817 39 209 GO:0000271
GO:0008483
GO:0030170
AF-A0A354TK86-F1-model_v4 Erythromycin biosynthesis sensory transduction protein eryC1 0.9703 36 206 GO:0000271
GO:0008483
GO:0030170
AF-A0A444J729-F1-model_v4 DegT/DnrJ/EryC1/StrS aminotransferase family protein (EC 2.6.1.109) 0.9702 1 169 GO:0000271
GO:0008483
GO:0030170
AF-A0A352WTK3-F1-model_v4 Glutamine--scyllo-inositol aminotransferase 0.9695 46 200 GO:0000271
GO:0008483
GO:0030170

Feature Viewer

pLDDT pTM Quality
93.12 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map