F471790
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 641 | 280 | 641 | 167 |
Family's Representative Sequence
| Representative Sequence | 3300025923|Ga0207681_10418203|Ga0207681_104182032 |
| Length | 199 |
| Sequence | MRRTVLAGVLAVLSVAVMAQTQGAKPIDYETYCKLPDAEALCEQLAAELRPRIGPKSAMVGLYTGGAWLAERLHSTLGLSTPLALMDIAFYRDDYAARGLKHDPKRTKIPFDVNGAELLLVDDVLYSGRTVRAAMNELFDYGRPASIALVVLADRGGRQLPICAQHVGARVQVPAGMRLTLQRADSGKLALALESERAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 145 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 146 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 147 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 148 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 149 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 150 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 151 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 153 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 154 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 155 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 156 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 157 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 158 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 159 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 160 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 170 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 174 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 175 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 176 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 183 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 184 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 185 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 186 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 187 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 188 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 189 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 190 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 191 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 192 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 193 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 194 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 195 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 196 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 197 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 198 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 235 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 258 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 265 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 277 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 279 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.31 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 99.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1021905 | 3300002074 | Bacteria | 773 |
| 2 | Ga0070690_100000197 | 3300005330 | Bacteria | 31360 |
| 3 | Ga0070690_100117645 | 3300005330 | Bacteria | 1781 |
| 4 | Ga0070690_100254176 | 3300005330 | Bacteria | 1244 |
| 5 | Ga0070677_10111340 | 3300005333 | Bacteria | 1223 |
| 6 | Ga0068869_100000214 | 3300005334 | Bacteria | 30165 |
| 7 | Ga0068869_101008834 | 3300005334 | Bacteria | 725 |
| 8 | Ga0070666_10090292 | 3300005335 | Bacteria | 2104 |
| 9 | Ga0070680_100001218 | 3300005336 | Bacteria | 18539 |
| 10 | Ga0070680_100107816 | 3300005336 | Bacteria | 2317 |
| 11 | Ga0070680_100516319 | 3300005336 | Bacteria | 1023 |
| 12 | Ga0070682_100003738 | 3300005337 | Bacteria | 8463 |
| 13 | Ga0068868_100000458 | 3300005338 | Bacteria | 27113 |
| 14 | Ga0070689_100000107 | 3300005340 | Bacteria | 48084 |
| 15 | Ga0070689_100829217 | 3300005340 | Bacteria | 815 |
| 16 | Ga0070691_10000220 | 3300005341 | Bacteria | 19309 |
| 17 | Ga0070687_100000034 | 3300005343 | Bacteria | 43229 |
| 18 | Ga0070687_100193904 | 3300005343 | Bacteria | 1226 |
| 19 | Ga0070687_100861811 | 3300005343 | Bacteria | 646 |
| 20 | Ga0070692_10010201 | 3300005345 | Bacteria | 4266 |
| 21 | Ga0070692_10320122 | 3300005345 | Bacteria | 953 |
| 22 | Ga0070668_100003178 | 3300005347 | Bacteria | 12109 |
| 23 | Ga0070669_100003861 | 3300005353 | Bacteria | 10828 |
| 24 | Ga0070669_100519539 | 3300005353 | Bacteria | 990 |
| 25 | Ga0070669_100854172 | 3300005353 | Bacteria | 776 |
| 26 | Ga0070674_100078762 | 3300005356 | Bacteria | 2349 |
| 27 | Ga0070674_100349867 | 3300005356 | Bacteria | 1193 |
| 28 | Ga0070688_100391486 | 3300005365 | Bacteria | 1027 |
| 29 | Ga0070688_100650146 | 3300005365 | Bacteria | 812 |
| 30 | Ga0070667_100237976 | 3300005367 | Bacteria | 1625 |
| 31 | Ga0070703_10003454 | 3300005406 | Bacteria | 4505 |
| 32 | Ga0070703_10222099 | 3300005406 | Bacteria | 753 |
| 33 | Ga0070709_10797513 | 3300005434 | Bacteria | 741 |
| 34 | Ga0070714_100691684 | 3300005435 | Bacteria | 983 |
| 35 | Ga0070713_100205276 | 3300005436 | Bacteria | 1781 |
| 36 | Ga0070710_10160420 | 3300005437 | Bacteria | 1394 |
| 37 | Ga0070701_10000396 | 3300005438 | Bacteria | 14677 |
| 38 | Ga0070701_10477794 | 3300005438 | Bacteria | 805 |
| 39 | Ga0070701_10492074 | 3300005438 | Bacteria | 795 |
| 40 | Ga0070711_100295613 | 3300005439 | Bacteria | 1286 |
| 41 | Ga0070705_100000582 | 3300005440 | Bacteria | 21229 |
| 42 | Ga0070705_100009501 | 3300005440 | Bacteria | 4836 |
| 43 | Ga0070705_100132366 | 3300005440 | Bacteria | 1629 |
| 44 | Ga0070705_100188517 | 3300005440 | Bacteria | 1403 |
| 45 | Ga0070705_100226806 | 3300005440 | Bacteria | 1297 |
| 46 | Ga0070700_100000344 | 3300005441 | Bacteria | 23968 |
| 47 | Ga0070700_100000633 | 3300005441 | Bacteria | 17458 |
| 48 | Ga0070700_100614442 | 3300005441 | Bacteria | 853 |
| 49 | Ga0070694_100000126 | 3300005444 | Bacteria | 37932 |
| 50 | Ga0070694_100017597 | 3300005444 | Bacteria | 4519 |
| 51 | Ga0070694_100023240 | 3300005444 | Bacteria | 3984 |
| 52 | Ga0070694_100259542 | 3300005444 | Bacteria | 1317 |
| 53 | Ga0070694_100488916 | 3300005444 | Bacteria | 978 |
| 54 | Ga0070694_100680795 | 3300005444 | Bacteria | 835 |
| 55 | Ga0070708_100173223 | 3300005445 | Bacteria | 2016 |
| 56 | Ga0070708_100557224 | 3300005445 | Bacteria | 1081 |
| 57 | Ga0070681_10000399 | 3300005458 | Bacteria | 35221 |
| 58 | Ga0070681_10047332 | 3300005458 | Bacteria | 4299 |
| 59 | Ga0068867_100000032 | 3300005459 | Bacteria | 84727 |
| 60 | Ga0068867_100001769 | 3300005459 | Bacteria | 15035 |
| 61 | Ga0068867_100674356 | 3300005459 | Bacteria | 909 |
| 62 | Ga0070707_100357333 | 3300005468 | Bacteria | 1419 |
| 63 | Ga0070707_100495725 | 3300005468 | Bacteria | 1183 |
| 64 | Ga0070698_100012901 | 3300005471 | Bacteria | 8849 |
| 65 | Ga0070698_100378584 | 3300005471 | Bacteria | 1348 |
| 66 | Ga0070698_100549999 | 3300005471 | Bacteria | 1094 |
| 67 | Ga0070699_100272627 | 3300005518 | Bacteria | 1515 |
| 68 | Ga0070699_101223804 | 3300005518 | Bacteria | 689 |
| 69 | Ga0070679_100017314 | 3300005530 | Bacteria | 6975 |
| 70 | Ga0070679_100030836 | 3300005530 | Bacteria | 5298 |
| 71 | Ga0070684_100013383 | 3300005535 | Bacteria | 6613 |
| 72 | Ga0070697_100000731 | 3300005536 | Bacteria | 24504 |
| 73 | Ga0070672_101009374 | 3300005543 | Bacteria | 737 |
| 74 | Ga0070686_100000253 | 3300005544 | Bacteria | 36736 |
| 75 | Ga0070686_100178402 | 3300005544 | Bacteria | 1507 |
| 76 | Ga0070686_100185800 | 3300005544 | Bacteria | 1480 |
| 77 | Ga0070686_100203895 | 3300005544 | Bacteria | 1419 |
| 78 | Ga0070686_100426217 | 3300005544 | Bacteria | 1015 |
| 79 | Ga0070686_100499257 | 3300005544 | Bacteria | 944 |
| 80 | Ga0070695_100000197 | 3300005545 | Bacteria | 29394 |
| 81 | Ga0070695_100094784 | 3300005545 | Bacteria | 1999 |
| 82 | Ga0070695_100183594 | 3300005545 | Bacteria | 1484 |
| 83 | Ga0070695_100774624 | 3300005545 | Bacteria | 767 |
| 84 | Ga0070695_100839412 | 3300005545 | Bacteria | 739 |
| 85 | Ga0070696_100000089 | 3300005546 | Bacteria | 44686 |
| 86 | Ga0070696_100000482 | 3300005546 | Bacteria | 25020 |
| 87 | Ga0070696_100090748 | 3300005546 | Bacteria | 2174 |
| 88 | Ga0070696_100277419 | 3300005546 | Bacteria | 1277 |
| 89 | Ga0070696_100572358 | 3300005546 | Bacteria | 908 |
| 90 | Ga0070696_101412965 | 3300005546 | Bacteria | 594 |
| 91 | Ga0070693_100000400 | 3300005547 | Bacteria | 19703 |
| 92 | Ga0070693_100116800 | 3300005547 | Bacteria | 1650 |
| 93 | Ga0070693_100157932 | 3300005547 | Bacteria | 1442 |
| 94 | Ga0070693_100287804 | 3300005547 | Bacteria | 1103 |
| 95 | Ga0070693_100613918 | 3300005547 | Bacteria | 787 |
| 96 | Ga0070693_101172963 | 3300005547 | Bacteria | 589 |
| 97 | Ga0070704_100000017 | 3300005549 | Bacteria | 57626 |
| 98 | Ga0070704_100001327 | 3300005549 | Bacteria | 13101 |
| 99 | Ga0070704_100012457 | 3300005549 | Bacteria | 5255 |
| 100 | Ga0070704_100041897 | 3300005549 | Bacteria | 3163 |
| 101 | Ga0070704_100468739 | 3300005549 | Bacteria | 1088 |
| 102 | Ga0070704_100618204 | 3300005549 | Bacteria | 954 |
| 103 | Ga0070704_100643329 | 3300005549 | Bacteria | 935 |
| 104 | Ga0070704_101014919 | 3300005549 | Bacteria | 751 |
| 105 | Ga0070704_101052032 | 3300005549 | Bacteria | 738 |
| 106 | Ga0068855_100002377 | 3300005563 | Bacteria | 23195 |
| 107 | Ga0068857_100480110 | 3300005577 | Bacteria | 1165 |
| 108 | Ga0068854_100004305 | 3300005578 | Bacteria | 8966 |
| 109 | Ga0068856_100020620 | 3300005614 | Bacteria | 6404 |
| 110 | Ga0068856_100574738 | 3300005614 | Bacteria | 1148 |
| 111 | Ga0068856_100699952 | 3300005614 | Bacteria | 1034 |
| 112 | Ga0070702_100000001 | 3300005615 | Bacteria | 87224 |
| 113 | Ga0070702_100298111 | 3300005615 | Bacteria | 1114 |
| 114 | Ga0068859_100000149 | 3300005617 | Bacteria | 66296 |
| 115 | Ga0068859_100089998 | 3300005617 | Bacteria | 3119 |
| 116 | Ga0068859_100185203 | 3300005617 | Bacteria | 2166 |
| 117 | Ga0068859_102348448 | 3300005617 | Bacteria | 588 |
| 118 | Ga0068864_100009007 | 3300005618 | Bacteria | 8230 |
| 119 | Ga0068866_10000326 | 3300005718 | Bacteria | 22539 |
| 120 | Ga0068866_10593364 | 3300005718 | Bacteria | 747 |
| 121 | Ga0068861_100002365 | 3300005719 | Bacteria | 12274 |
| 122 | Ga0068861_100016010 | 3300005719 | Bacteria | 5295 |
| 123 | Ga0068870_10009444 | 3300005840 | Bacteria | 4437 |
| 124 | Ga0068870_10102497 | 3300005840 | Bacteria | 1620 |
| 125 | Ga0068870_10135645 | 3300005840 | Bacteria | 1435 |
| 126 | Ga0068863_100252789 | 3300005841 | Bacteria | 1703 |
| 127 | Ga0068863_101417311 | 3300005841 | Bacteria | 703 |
| 128 | Ga0068858_100002902 | 3300005842 | Bacteria | 17243 |
| 129 | Ga0068858_100195287 | 3300005842 | Bacteria | 1912 |
| 130 | Ga0068858_100340710 | 3300005842 | Bacteria | 1435 |
| 131 | Ga0068860_100001090 | 3300005843 | Bacteria | 29921 |
| 132 | Ga0068862_100000409 | 3300005844 | Bacteria | 46422 |
| 133 | Ga0068862_100001785 | 3300005844 | Bacteria | 19458 |
| 134 | Ga0068862_100493025 | 3300005844 | Bacteria | 1161 |
| 135 | Ga0068862_100574832 | 3300005844 | Bacteria | 1079 |
| 136 | Ga0081538_10081944 | 3300005981 | Bacteria | 1714 |
| 137 | Ga0081539_10000686 | 3300005985 | Bacteria | 67858 |
| 138 | Ga0070716_100092106 | 3300006173 | Bacteria | 1837 |
| 139 | Ga0097621_100000928 | 3300006237 | Bacteria | 20529 |
| 140 | Ga0097621_100002033 | 3300006237 | Bacteria | 13846 |
| 141 | Ga0068871_100003069 | 3300006358 | Bacteria | 11453 |
| 142 | Ga0068871_100029846 | 3300006358 | Bacteria | 4287 |
| 143 | Ga0075428_100000083 | 3300006844 | Bacteria | 78689 |
| 144 | Ga0075428_100037796 | 3300006844 | Bacteria | 5312 |
| 145 | Ga0075428_100108390 | 3300006844 | Bacteria | 3027 |
| 146 | Ga0075428_100359340 | 3300006844 | Bacteria | 1562 |
| 147 | Ga0075428_100842720 | 3300006844 | Bacteria | 974 |
| 148 | Ga0075430_100000550 | 3300006846 | Bacteria | 28484 |
| 149 | Ga0075430_100008422 | 3300006846 | Bacteria | 8711 |
| 150 | Ga0075430_100057331 | 3300006846 | Bacteria | 3277 |
| 151 | Ga0075430_100058656 | 3300006846 | Bacteria | 3236 |
| 152 | Ga0075430_100159593 | 3300006846 | Bacteria | 1877 |
| 153 | Ga0075431_100005396 | 3300006847 | Bacteria | 12626 |
| 154 | Ga0075431_100043616 | 3300006847 | Bacteria | 4626 |
| 155 | Ga0075431_100066496 | 3300006847 | Bacteria | 3722 |
| 156 | Ga0075431_100153977 | 3300006847 | Bacteria | 2366 |
| 157 | Ga0075431_100841843 | 3300006847 | Bacteria | 889 |
| 158 | Ga0075433_10007789 | 3300006852 | Bacteria | 8513 |
| 159 | Ga0075433_10921675 | 3300006852 | Bacteria | 762 |
| 160 | Ga0075433_10947210 | 3300006852 | Bacteria | 751 |
| 161 | Ga0075434_100007734 | 3300006871 | Bacteria | 9953 |
| 162 | Ga0075434_100115383 | 3300006871 | Bacteria | 2698 |
| 163 | Ga0075434_101348149 | 3300006871 | Bacteria | 724 |
| 164 | Ga0075434_101696308 | 3300006871 | Bacteria | 640 |
| 165 | Ga0075429_100000480 | 3300006880 | Bacteria | 29845 |
| 166 | Ga0075429_100000511 | 3300006880 | Bacteria | 29379 |
| 167 | Ga0075429_100097034 | 3300006880 | Bacteria | 2571 |
| 168 | Ga0075429_100142665 | 3300006880 | Bacteria | 2097 |
| 169 | Ga0075429_100547037 | 3300006880 | Bacteria | 1015 |
| 170 | Ga0068865_100000059 | 3300006881 | Bacteria | 58856 |
| 171 | Ga0068865_100243839 | 3300006881 | Bacteria | 1415 |
| 172 | Ga0075436_100003220 | 3300006914 | Bacteria | 11194 |
| 173 | Ga0075436_100015702 | 3300006914 | Bacteria | 5184 |
| 174 | Ga0075436_100064795 | 3300006914 | Bacteria | 2526 |
| 175 | Ga0075436_100072353 | 3300006914 | Bacteria | 2385 |
| 176 | Ga0097620_100000149 | 3300006931 | Bacteria | 66296 |
| 177 | Ga0097620_100089997 | 3300006931 | Bacteria | 3119 |
| 178 | Ga0097620_100185211 | 3300006931 | Bacteria | 2166 |
| 179 | Ga0097620_102347883 | 3300006931 | Bacteria | 588 |
| 180 | Ga0075435_100000388 | 3300007076 | Bacteria | 26867 |
| 181 | Ga0075435_100002470 | 3300007076 | Bacteria | 12289 |
| 182 | Ga0075435_100003004 | 3300007076 | Bacteria | 11355 |
| 183 | Ga0075435_100088050 | 3300007076 | Bacteria | 2559 |
| 184 | Ga0075435_100095285 | 3300007076 | Bacteria | 2461 |
| 185 | Ga0075435_100371528 | 3300007076 | Bacteria | 1228 |
| 186 | Ga0099794_10003748 | 3300007265 | Bacteria | 5854 |
| 187 | Ga0099794_10292604 | 3300007265 | Bacteria | 843 |
| 188 | Ga0111539_10013382 | 3300009094 | Bacteria | 10256 |
| 189 | Ga0111539_10022182 | 3300009094 | Bacteria | 7805 |
| 190 | Ga0111539_10053780 | 3300009094 | Bacteria | 4793 |
| 191 | Ga0111539_10082706 | 3300009094 | Bacteria | 3776 |
| 192 | Ga0111539_10369811 | 3300009094 | Bacteria | 1669 |
| 193 | Ga0111539_10480652 | 3300009094 | Bacteria | 1447 |
| 194 | Ga0111539_10535706 | 3300009094 | Bacteria | 1364 |
| 195 | Ga0111539_12309540 | 3300009094 | Bacteria | 624 |
| 196 | Ga0105245_10000075 | 3300009098 | Bacteria | 103550 |
| 197 | Ga0105245_10174584 | 3300009098 | Bacteria | 2049 |
| 198 | Ga0114129_10000210 | 3300009147 | Bacteria | 65476 |
| 199 | Ga0114129_10002670 | 3300009147 | Bacteria | 24825 |
| 200 | Ga0114129_10754917 | 3300009147 | Bacteria | 1245 |
| 201 | Ga0114129_10990843 | 3300009147 | Bacteria | 1059 |
| 202 | Ga0105243_10000622 | 3300009148 | Bacteria | 35310 |
| 203 | Ga0105243_10719528 | 3300009148 | Bacteria | 975 |
| 204 | Ga0105241_10012163 | 3300009174 | Bacteria | 6318 |
| 205 | Ga0105242_10000407 | 3300009176 | Bacteria | 34281 |
| 206 | Ga0105242_10001782 | 3300009176 | Bacteria | 16996 |
| 207 | Ga0105248_10165967 | 3300009177 | Bacteria | 2489 |
| 208 | Ga0105248_10255442 | 3300009177 | Bacteria | 1973 |
| 209 | Ga0105248_10546246 | 3300009177 | Bacteria | 1307 |
| 210 | Ga0105238_10842562 | 3300009551 | Bacteria | 934 |
| 211 | Ga0105249_10007167 | 3300009553 | Bacteria | 9737 |
| 212 | Ga0105249_10039524 | 3300009553 | Bacteria | 4284 |
| 213 | Ga0105249_11767283 | 3300009553 | Bacteria | 691 |
| 214 | Ga0105239_10157884 | 3300010375 | Bacteria | 2534 |
| 215 | Ga0157378_10000074 | 3300013297 | Bacteria | 90608 |
| 216 | Ga0163162_10129351 | 3300013306 | Bacteria | 2633 |
| 217 | Ga0163162_10285360 | 3300013306 | Bacteria | 1783 |
| 218 | Ga0157372_10260338 | 3300013307 | Bacteria | 2014 |
| 219 | Ga0157375_10509511 | 3300013308 | Bacteria | 1367 |
| 220 | Ga0157375_11811274 | 3300013308 | Bacteria | 724 |
| 221 | Ga0157377_10854859 | 3300014745 | Bacteria | 676 |
| 222 | Ga0157376_10059407 | 3300014969 | Bacteria | 3206 |
| 223 | Ga0157376_10143622 | 3300014969 | Bacteria | 2144 |
| 224 | Ga0157376_11303303 | 3300014969 | Bacteria | 756 |
| 225 | Ga0207653_10022249 | 3300025885 | Bacteria | 2014 |
| 226 | Ga0207653_10193672 | 3300025885 | Bacteria | 764 |
| 227 | Ga0207682_10031631 | 3300025893 | Bacteria | 2125 |
| 228 | Ga0207692_10036509 | 3300025898 | Bacteria | 2397 |
| 229 | Ga0207642_10001898 | 3300025899 | Bacteria | 6445 |
| 230 | Ga0207680_10218904 | 3300025903 | Bacteria | 1304 |
| 231 | Ga0207685_10267975 | 3300025905 | Bacteria | 833 |
| 232 | Ga0207645_10078625 | 3300025907 | Bacteria | 2114 |
| 233 | Ga0207643_10407301 | 3300025908 | Bacteria | 860 |
| 234 | Ga0207643_10551299 | 3300025908 | Bacteria | 740 |
| 235 | Ga0207654_10010687 | 3300025911 | Bacteria | 4675 |
| 236 | Ga0207707_10003163 | 3300025912 | Bacteria | 14617 |
| 237 | Ga0207707_10229933 | 3300025912 | Bacteria | 1614 |
| 238 | Ga0207663_10105889 | 3300025916 | Bacteria | 1899 |
| 239 | Ga0207663_10700876 | 3300025916 | Bacteria | 802 |
| 240 | Ga0207660_10003510 | 3300025917 | Bacteria | 10214 |
| 241 | Ga0207660_10051463 | 3300025917 | Bacteria | 2928 |
| 242 | Ga0207660_10141579 | 3300025917 | Bacteria | 1839 |
| 243 | Ga0207660_10229094 | 3300025917 | Bacteria | 1460 |
| 244 | Ga0207660_10249364 | 3300025917 | Bacteria | 1401 |
| 245 | Ga0207662_10000166 | 3300025918 | Bacteria | 31376 |
| 246 | Ga0207662_10018412 | 3300025918 | Bacteria | 3963 |
| 247 | Ga0207662_10039563 | 3300025918 | Bacteria | 2767 |
| 248 | Ga0207662_10247552 | 3300025918 | Bacteria | 1169 |
| 249 | Ga0207662_10282464 | 3300025918 | Bacteria | 1099 |
| 250 | Ga0207662_10468186 | 3300025918 | Bacteria | 864 |
| 251 | Ga0207662_10604257 | 3300025918 | Bacteria | 763 |
| 252 | Ga0207652_10010844 | 3300025921 | Bacteria | 7344 |
| 253 | Ga0207652_10195092 | 3300025921 | Bacteria | 1821 |
| 254 | Ga0207652_10676459 | 3300025921 | Bacteria | 922 |
| 255 | Ga0207646_10228935 | 3300025922 | Bacteria | 1679 |
| 256 | Ga0207646_10433105 | 3300025922 | Bacteria | 1187 |
| 257 | Ga0207646_10804596 | 3300025922 | Bacteria | 837 |
| 258 | Ga0207681_10000542 | 3300025923 | Bacteria | 25991 |
| 259 | Ga0207681_10418203 | 3300025923 | Bacteria | 1086 |
| 260 | Ga0207650_10959241 | 3300025925 | Bacteria | 727 |
| 261 | Ga0207687_10118425 | 3300025927 | Bacteria | 1977 |
| 262 | Ga0207686_10000243 | 3300025934 | Bacteria | 41698 |
| 263 | Ga0207686_10029433 | 3300025934 | Bacteria | 3239 |
| 264 | Ga0207709_10001387 | 3300025935 | Bacteria | 16961 |
| 265 | Ga0207709_10004987 | 3300025935 | Bacteria | 7592 |
| 266 | Ga0207670_10006628 | 3300025936 | Bacteria | 6436 |
| 267 | Ga0207670_10008142 | 3300025936 | Bacteria | 5900 |
| 268 | Ga0207669_10041596 | 3300025937 | Bacteria | 2676 |
| 269 | Ga0207669_10616964 | 3300025937 | Bacteria | 883 |
| 270 | Ga0207704_10000178 | 3300025938 | Bacteria | 33463 |
| 271 | Ga0207704_10001089 | 3300025938 | Bacteria | 12062 |
| 272 | Ga0207704_10087833 | 3300025938 | Bacteria | 2032 |
| 273 | Ga0207704_10744078 | 3300025938 | Bacteria | 815 |
| 274 | Ga0207691_10479201 | 3300025940 | Bacteria | 1057 |
| 275 | Ga0207711_10151250 | 3300025941 | Bacteria | 2094 |
| 276 | Ga0207711_10277589 | 3300025941 | Bacteria | 1543 |
| 277 | Ga0207689_10000007 | 3300025942 | Bacteria | 132362 |
| 278 | Ga0207689_10205501 | 3300025942 | Bacteria | 1626 |
| 279 | Ga0207661_10242755 | 3300025944 | Bacteria | 1599 |
| 280 | Ga0207667_10019325 | 3300025949 | Bacteria | 7609 |
| 281 | Ga0207651_10229189 | 3300025960 | Bacteria | 1507 |
| 282 | Ga0207712_10002821 | 3300025961 | Bacteria | 11132 |
| 283 | Ga0207712_10020951 | 3300025961 | Bacteria | 4288 |
| 284 | Ga0207712_10117131 | 3300025961 | Bacteria | 2009 |
| 285 | Ga0207668_10031833 | 3300025972 | Bacteria | 3479 |
| 286 | Ga0207640_10014310 | 3300025981 | Bacteria | 4564 |
| 287 | Ga0207658_10226027 | 3300025986 | Bacteria | 1577 |
| 288 | Ga0207677_10000823 | 3300026023 | Bacteria | 17732 |
| 289 | Ga0207677_10911426 | 3300026023 | Bacteria | 793 |
| 290 | Ga0207703_10005057 | 3300026035 | Bacteria | 10678 |
| 291 | Ga0207703_10015309 | 3300026035 | Bacteria | 5983 |
| 292 | Ga0207708_10000086 | 3300026075 | Bacteria | 73314 |
| 293 | Ga0207708_10003576 | 3300026075 | Bacteria | 11462 |
| 294 | Ga0207708_10177507 | 3300026075 | Bacteria | 1690 |
| 295 | Ga0207708_10940309 | 3300026075 | Bacteria | 749 |
| 296 | Ga0207702_10017742 | 3300026078 | Bacteria | 5891 |
| 297 | Ga0207702_10073736 | 3300026078 | Bacteria | 2944 |
| 298 | Ga0207702_10554990 | 3300026078 | Bacteria | 1124 |
| 299 | Ga0207641_10173891 | 3300026088 | Bacteria | 1968 |
| 300 | Ga0207641_10202721 | 3300026088 | Bacteria | 1830 |
| 301 | Ga0207641_10260338 | 3300026088 | Bacteria | 1624 |
| 302 | Ga0207648_10000079 | 3300026089 | Bacteria | 92044 |
| 303 | Ga0207648_10000352 | 3300026089 | Bacteria | 50550 |
| 304 | Ga0207648_10789803 | 3300026089 | Bacteria | 883 |
| 305 | Ga0207648_11297609 | 3300026089 | Bacteria | 684 |
| 306 | Ga0207676_10036447 | 3300026095 | Bacteria | 3742 |
| 307 | Ga0207674_10040257 | 3300026116 | Bacteria | 4842 |
| 308 | Ga0207675_100000093 | 3300026118 | Bacteria | 70343 |
| 309 | Ga0207675_100000802 | 3300026118 | Bacteria | 31217 |
| 310 | Ga0207675_101152338 | 3300026118 | Bacteria | 795 |
| 311 | Ga0207698_10010533 | 3300026142 | Bacteria | 5951 |
| 312 | Ga0209969_1014562 | 3300027360 | Bacteria | 1146 |
| 313 | Ga0209981_1005263 | 3300027378 | Bacteria | 1715 |
| 314 | Ga0209981_1006180 | 3300027378 | Bacteria | 1599 |
| 315 | Ga0210000_1006568 | 3300027462 | Bacteria | 1694 |
| 316 | Ga0210000_1021175 | 3300027462 | Bacteria | 994 |
| 317 | Ga0209968_1004440 | 3300027526 | Bacteria | 2107 |
| 318 | Ga0209999_1048087 | 3300027543 | Bacteria | 804 |
| 319 | Ga0209983_1004666 | 3300027665 | Bacteria | 2870 |
| 320 | Ga0209588_1038360 | 3300027671 | Bacteria | 1543 |
| 321 | Ga0209588_1059161 | 3300027671 | Bacteria | 1239 |
| 322 | Ga0209971_1005009 | 3300027682 | Bacteria | 3147 |
| 323 | Ga0209966_1004025 | 3300027695 | Bacteria | 2480 |
| 324 | Ga0207428_10000321 | 3300027907 | Bacteria | 62664 |
| 325 | Ga0207428_10143837 | 3300027907 | Bacteria | 1818 |
| 326 | Ga0207428_10186995 | 3300027907 | Bacteria | 1562 |
| 327 | Ga0207428_10227654 | 3300027907 | Bacteria | 1396 |
| 328 | Ga0207428_10288770 | 3300027907 | Bacteria | 1216 |
| 329 | Ga0207428_10306886 | 3300027907 | Bacteria | 1174 |
| 330 | Ga0268265_10000606 | 3300028380 | Bacteria | 35982 |
| 331 | Ga0268265_10003346 | 3300028380 | Bacteria | 11597 |
| 332 | Ga0268265_10922099 | 3300028380 | Bacteria | 859 |
| 333 | Ga0268264_10001077 | 3300028381 | Bacteria | 27026 |
| 334 | Ga0265319_1070689 | 3300028563 | Bacteria | 1119 |
| 335 | Ga0307408_101052881 | 3300031548 | Bacteria | 752 |
| 336 | Ga0316575_10009032 | 3300031665 | Bacteria | 3643 |
| 337 | Ga0316578_10036076 | 3300031728 | Bacteria | 2845 |
| 338 | Ga0307405_10099321 | 3300031731 | Bacteria | 1948 |
| 339 | Ga0307410_10376878 | 3300031852 | Bacteria | 1141 |
| 340 | Ga0307407_10084363 | 3300031903 | Bacteria | 1930 |
| 341 | Ga0307412_10684850 | 3300031911 | Bacteria | 878 |
| 342 | Ga0307409_100132774 | 3300031995 | Bacteria | 2131 |
| 343 | Ga0307409_100568179 | 3300031995 | Bacteria | 1116 |
| 344 | Ga0307409_101146005 | 3300031995 | Bacteria | 800 |
| 345 | Ga0307416_100071393 | 3300032002 | Bacteria | 2884 |
| 346 | Ga0307416_100280683 | 3300032002 | Bacteria | 1642 |
| 347 | Ga0307416_100383105 | 3300032002 | Bacteria | 1437 |
| 348 | Ga0307416_100503155 | 3300032002 | Bacteria | 1276 |
| 349 | Ga0307416_101045929 | 3300032002 | Bacteria | 920 |
| 350 | Ga0307411_10101431 | 3300032005 | Bacteria | 2037 |
| 351 | Ga0307411_10613501 | 3300032005 | Bacteria | 937 |
| 352 | Ga0316583_10028863 | 3300032133 | Bacteria | 1978 |
| 353 | Ga0373930_0051690 | 3300034816 | Bacteria | 899 |
| 354 | Ga0373928_0148833 | 3300035084 | Bacteria | 647 |
| 355 | Ga0373929_0014999 | 3300035085 | Bacteria | 1503 |
| 356 | Ga0373940_0002873 | 3300035088 | Bacteria | 3428 |
| 357 | Ga0373949_0003576 | 3300035090 | Bacteria | 3672 |
| 358 | Ga0373949_0102184 | 3300035090 | Bacteria | 787 |
| 359 | Ga0373951_0016244 | 3300035091 | Bacteria | 1679 |
| 360 | Ga0373923_0028281 | 3300035111 | Bacteria | 2242 |
| 361 | Ga0373923_0075639 | 3300035111 | Bacteria | 1453 |
| 362 | Ga0373923_0239757 | 3300035111 | Bacteria | 847 |
| 363 | Ga0373932_0005138 | 3300035112 | Bacteria | 3075 |
| 364 | Ga0373932_0067033 | 3300035112 | Bacteria | 1104 |
| 365 | Ga0373932_0097928 | 3300035112 | Bacteria | 950 |
| 366 | Ga0373932_0127600 | 3300035112 | Bacteria | 854 |
| 367 | Ga0373941_0067176 | 3300035115 | Bacteria | 1182 |
| 368 | Ga0373945_0279006 | 3300035116 | Bacteria | 712 |
| 369 | Ga0373953_0029306 | 3300035117 | Bacteria | 2128 |
| 370 | Ga0373954_0000002 | 3300035118 | Bacteria | 147478 |
| 371 | Ga0373954_0151457 | 3300035118 | Bacteria | 1133 |
| 372 | Ga0373956_0039558 | 3300035119 | Bacteria | 2090 |
| 373 | Ga0373957_0010845 | 3300035120 | Bacteria | 3025 |
| 374 | Ga0373960_0012638 | 3300035121 | Bacteria | 2102 |
| 375 | Ga0373955_0006900 | 3300035172 | Bacteria | 5192 |
| 376 | Ga0373942_0001165 | 3300035207 | Bacteria | 6975 |
| 377 | Ga0373942_0061243 | 3300035207 | Bacteria | 1079 |
| 378 | Ga0373962_0010615 | 3300035242 | Bacteria | 2299 |
| 379 | Ga0373962_0254173 | 3300035242 | Bacteria | 611 |
| 380 | Ga0316574_0024779 | 3300035398 | Bacteria | 3594 |
| 381 | Ga0373924_0086321 | 3300035410 | Bacteria | 1339 |
| 382 | Ga0373931_0000265 | 3300035691 | Bacteria | 22203 |
| 383 | Ga0373931_0001111 | 3300035691 | Bacteria | 11416 |
| 384 | Ga0373931_0094753 | 3300035691 | Bacteria | 1669 |
| 385 | Ga0373931_0134293 | 3300035691 | Bacteria | 1427 |
| 386 | Ga0373931_0146662 | 3300035691 | Bacteria | 1372 |
| 387 | Ga0373931_0210255 | 3300035691 | Bacteria | 1166 |
| 388 | Ga0373931_0292207 | 3300035691 | Bacteria | 1004 |
| 389 | Ga0373935_0380151 | 3300035692 | Bacteria | 1011 |
| 390 | Ga0373935_0661985 | 3300035692 | Bacteria | 766 |
| 391 | Ga0373927_0016434 | 3300035695 | Bacteria | 4881 |
| 392 | Ga0373927_0122995 | 3300035695 | Bacteria | 1694 |
| 393 | Ga0373927_0174223 | 3300035695 | Bacteria | 1411 |
| 394 | Ga0373933_0014193 | 3300035724 | Bacteria | 4425 |
| 395 | Ga0373933_0023470 | 3300035724 | Bacteria | 3524 |
| 396 | Ga0373937_0000358 | 3300036401 | Bacteria | 42468 |
| 397 | Ga0373937_0004969 | 3300036401 | Bacteria | 11307 |
| 398 | Ga0373937_0024246 | 3300036401 | Bacteria | 5469 |
| 399 | Ga0373937_0138192 | 3300036401 | Bacteria | 2279 |
| 400 | Ga0373937_0390596 | 3300036401 | Bacteria | 1320 |
| 401 | Ga0373925_0117169 | 3300037068 | Bacteria | 2064 |
| 402 | Ga0316581_0001558 | 3300037588 | Bacteria | 5207 |
| 403 | Ga0439439_0145438 | 3300041406 | Bacteria | 671 |
| 404 | Ga0439453_0153332 | 3300041408 | Bacteria | 548 |
| 405 | Ga0439441_004715 | 3300042001 | Bacteria | 2081 |
| 406 | Ga0439441_056928 | 3300042001 | Bacteria | 816 |
| 407 | Ga0439443_000966 | 3300042003 | Bacteria | 2946 |
| 408 | Ga0439443_002476 | 3300042003 | Bacteria | 2214 |
| 409 | Ga0439451_013492 | 3300042009 | Bacteria | 1652 |
| 410 | Ga0439456_017801 | 3300042013 | Bacteria | 1490 |
| 411 | Ga0439446_0000176 | 3300042156 | Bacteria | 11244 |
| 412 | Ga0439434_0007165 | 3300042435 | Bacteria | 3264 |
| 413 | Ga0439434_0117730 | 3300042435 | Bacteria | 864 |
| 414 | Ga0439435_0000026 | 3300042436 | Bacteria | 16073 |
| 415 | Ga0439435_0016067 | 3300042436 | Bacteria | 1871 |
| 416 | Ga0439435_0059349 | 3300042436 | Bacteria | 1112 |
| 417 | Ga0439444_0002697 | 3300042437 | Bacteria | 2450 |
| 418 | Ga0439460_0034783 | 3300042461 | Bacteria | 1454 |
| 419 | Ga0466963_0316332 | 3300044694 | Bacteria | 1098 |
| 420 | Ga0466964_0138518 | 3300044706 | Bacteria | 1116 |
| 421 | Ga0451576_0001306 | 3300045051 | Bacteria | 43171 |
| 422 | Ga0451576_0008334 | 3300045051 | Bacteria | 12184 |
| 423 | Ga0451576_0050564 | 3300045051 | Bacteria | 4358 |
| 424 | Ga0451576_0083471 | 3300045051 | Bacteria | 3323 |
| 425 | Ga0451576_0154227 | 3300045051 | Bacteria | 2396 |
| 426 | Ga0451576_0374264 | 3300045051 | Bacteria | 1492 |
| 427 | Ga0451576_0499109 | 3300045051 | Bacteria | 1278 |
| 428 | Ga0451576_0518803 | 3300045051 | Bacteria | 1252 |
| 429 | Ga0451576_1244875 | 3300045051 | Bacteria | 777 |
| 430 | Ga0451576_1248460 | 3300045051 | Bacteria | 775 |
| 431 | Ga0466967_0006007 | 3300045976 | Bacteria | 8531 |
| 432 | Ga0466967_0942412 | 3300045976 | Bacteria | 859 |
| 433 | Ga0495592_0052225 | 3300046454 | Bacteria | 3035 |
| 434 | Ga0495629_0044253 | 3300046459 | Bacteria | 3125 |
| 435 | Ga0495641_0056653 | 3300046461 | Bacteria | 1776 |
| 436 | Ga0495641_0138487 | 3300046461 | Bacteria | 1087 |
| 437 | Ga0495639_0214158 | 3300046475 | Bacteria | 946 |
| 438 | Ga0495662_0014869 | 3300046476 | Bacteria | 3782 |
| 439 | Ga0495594_0248849 | 3300046499 | Bacteria | 1013 |
| 440 | Ga0495608_0002044 | 3300046511 | Bacteria | 14501 |
| 441 | Ga0495618_0015263 | 3300046514 | Bacteria | 4687 |
| 442 | Ga0495628_0016487 | 3300046516 | Bacteria | 6161 |
| 443 | Ga0495628_0641179 | 3300046516 | Bacteria | 755 |
| 444 | Ga0495630_0001185 | 3300046517 | Bacteria | 17975 |
| 445 | Ga0495630_0514081 | 3300046517 | Bacteria | 918 |
| 446 | Ga0495644_0110707 | 3300046523 | Bacteria | 1042 |
| 447 | Ga0495652_0048101 | 3300046529 | Bacteria | 3657 |
| 448 | Ga0495640_0000808 | 3300046533 | Bacteria | 23777 |
| 449 | Ga0495640_0004665 | 3300046533 | Bacteria | 10928 |
| 450 | Ga0495586_0000440 | 3300046535 | Bacteria | 24985 |
| 451 | Ga0495587_0009122 | 3300046536 | Bacteria | 6366 |
| 452 | Ga0495621_0009090 | 3300046539 | Bacteria | 3005 |
| 453 | Ga0495621_0065391 | 3300046539 | Bacteria | 1329 |
| 454 | Ga0495621_0142048 | 3300046539 | Bacteria | 940 |
| 455 | Ga0495621_0206979 | 3300046539 | Bacteria | 791 |
| 456 | Ga0495645_0069462 | 3300046543 | Bacteria | 2543 |
| 457 | Ga0495667_0012758 | 3300046559 | Bacteria | 5693 |
| 458 | Ga0495656_0015676 | 3300046615 | Bacteria | 2866 |
| 459 | Ga0495656_0670449 | 3300046615 | Bacteria | 557 |
| 460 | Ga0495634_0002587 | 3300046642 | Bacteria | 14917 |
| 461 | Ga0495635_0032744 | 3300046663 | Bacteria | 3605 |
| 462 | Ga0495635_0095009 | 3300046663 | Bacteria | 2038 |
| 463 | Ga0495659_0134567 | 3300046664 | Bacteria | 982 |
| 464 | Ga0495657_0421692 | 3300046675 | Bacteria | 783 |
| 465 | Ga0495599_0037696 | 3300046678 | Bacteria | 3037 |
| 466 | Ga0495647_0100975 | 3300046681 | Bacteria | 1195 |
| 467 | Ga0495658_0042024 | 3300046683 | Bacteria | 2550 |
| 468 | Ga0495669_0010255 | 3300046684 | Bacteria | 3958 |
| 469 | Ga0495669_0118686 | 3300046684 | Bacteria | 1239 |
| 470 | Ga0495669_0511337 | 3300046684 | Bacteria | 584 |
| 471 | Ga0495613_0008010 | 3300046689 | Bacteria | 7861 |
| 472 | Ga0495624_0041706 | 3300046690 | Bacteria | 2935 |
| 473 | Ga0495624_0150373 | 3300046690 | Bacteria | 1424 |
| 474 | Ga0495600_0180472 | 3300046809 | Bacteria | 1360 |
| 475 | Ga0495581_0032165 | 3300047315 | Bacteria | 3038 |
| 476 | Ga0495604_0020749 | 3300047317 | Bacteria | 5246 |
| 477 | Ga0495680_0001572 | 3300047322 | Bacteria | 24459 |
| 478 | Ga0495675_0160223 | 3300047444 | Bacteria | 1386 |
| 479 | Ga0495684_0325172 | 3300047471 | Bacteria | 1098 |
| 480 | Ga0495593_0035630 | 3300047673 | Bacteria | 2701 |
| 481 | Ga0495593_0291004 | 3300047673 | Bacteria | 817 |
| 482 | Ga0501299_026353 | 3300049522 | Bacteria | 1097 |
| 483 | Ga0501031_0281142 | 3300049568 | Bacteria | 1079 |
| 484 | Ga0501034_1313174 | 3300049571 | Bacteria | 600 |
| 485 | Ga0501036_0178308 | 3300049572 | Bacteria | 1789 |
| 486 | Ga0501036_0240028 | 3300049572 | Bacteria | 1520 |
| 487 | Ga0501036_0319593 | 3300049572 | Bacteria | 1297 |
| 488 | Ga0501036_0377957 | 3300049572 | Bacteria | 1182 |
| 489 | Ga0501037_0336610 | 3300049573 | Bacteria | 1043 |
| 490 | Ga0501037_0434195 | 3300049573 | Bacteria | 898 |
| 491 | Ga0501037_0568278 | 3300049573 | Bacteria | 764 |
| 492 | Ga0501038_0026052 | 3300049574 | Bacteria | 5208 |
| 493 | Ga0501038_0083926 | 3300049574 | Bacteria | 2681 |
| 494 | Ga0501038_0163832 | 3300049574 | Bacteria | 1805 |
| 495 | Ga0501038_0209304 | 3300049574 | Bacteria | 1561 |
| 496 | Ga0501039_0012877 | 3300049575 | Bacteria | 6396 |
| 497 | Ga0501039_0033647 | 3300049575 | Bacteria | 3953 |
| 498 | Ga0501039_0070258 | 3300049575 | Bacteria | 2720 |
| 499 | Ga0501039_0107755 | 3300049575 | Bacteria | 2177 |
| 500 | Ga0501039_0129642 | 3300049575 | Bacteria | 1979 |
| 501 | Ga0501039_0338143 | 3300049575 | Bacteria | 1183 |
| 502 | Ga0501040_0054020 | 3300049576 | Bacteria | 2753 |
| 503 | Ga0501040_0057334 | 3300049576 | Bacteria | 2674 |
| 504 | Ga0501040_0169556 | 3300049576 | Bacteria | 1545 |
| 505 | Ga0501040_0179156 | 3300049576 | Bacteria | 1502 |
| 506 | Ga0501040_0207824 | 3300049576 | Bacteria | 1391 |
| 507 | Ga0501040_0358871 | 3300049576 | Bacteria | 1044 |
| 508 | Ga0501041_0013041 | 3300049577 | Bacteria | 4925 |
| 509 | Ga0501041_0089018 | 3300049577 | Bacteria | 1905 |
| 510 | Ga0501041_0102698 | 3300049577 | Bacteria | 1770 |
| 511 | Ga0501042_0058453 | 3300049578 | Bacteria | 2752 |
| 512 | Ga0501042_0071336 | 3300049578 | Bacteria | 2485 |
| 513 | Ga0501042_0333659 | 3300049578 | Bacteria | 1096 |
| 514 | Ga0501042_1138440 | 3300049578 | Bacteria | 569 |
| 515 | Ga0501043_0188449 | 3300049579 | Bacteria | 1605 |
| 516 | Ga0501046_0144016 | 3300049580 | Bacteria | 1801 |
| 517 | Ga0501046_0196918 | 3300049580 | Bacteria | 1500 |
| 518 | Ga0501048_0033104 | 3300049582 | Bacteria | 3736 |
| 519 | Ga0501048_0164154 | 3300049582 | Bacteria | 1572 |
| 520 | Ga0501048_0258413 | 3300049582 | Bacteria | 1237 |
| 521 | Ga0501067_0060081 | 3300049583 | Bacteria | 2104 |
| 522 | Ga0501067_0609724 | 3300049583 | Bacteria | 612 |
| 523 | Ga0501068_0079115 | 3300049584 | Bacteria | 2016 |
| 524 | Ga0501069_0295799 | 3300049585 | Bacteria | 949 |
| 525 | Ga0501069_0323174 | 3300049585 | Bacteria | 907 |
| 526 | Ga0501071_0002191 | 3300049587 | Bacteria | 11757 |
| 527 | Ga0501071_0002663 | 3300049587 | Bacteria | 10935 |
| 528 | Ga0501071_0027848 | 3300049587 | Bacteria | 3979 |
| 529 | Ga0501072_0000916 | 3300049588 | Bacteria | 21646 |
| 530 | Ga0501072_0322035 | 3300049588 | Bacteria | 1228 |
| 531 | Ga0501072_0441118 | 3300049588 | Bacteria | 1031 |
| 532 | Ga0501073_0390208 | 3300049589 | Bacteria | 962 |
| 533 | Ga0501074_0571481 | 3300049590 | Bacteria | 800 |
| 534 | Ga0501074_0574959 | 3300049590 | Bacteria | 797 |
| 535 | Ga0501075_0005803 | 3300049591 | Bacteria | 8446 |
| 536 | Ga0501075_0005912 | 3300049591 | Bacteria | 8371 |
| 537 | Ga0501075_0032941 | 3300049591 | Bacteria | 3854 |
| 538 | Ga0501075_0043280 | 3300049591 | Bacteria | 3377 |
| 539 | Ga0501075_0052302 | 3300049591 | Bacteria | 3071 |
| 540 | Ga0501075_0174935 | 3300049591 | Bacteria | 1638 |
| 541 | Ga0501075_0589920 | 3300049591 | Bacteria | 848 |
| 542 | Ga0501076_0000501 | 3300049592 | Bacteria | 24802 |
| 543 | Ga0501076_0002030 | 3300049592 | Bacteria | 13854 |
| 544 | Ga0501076_0009698 | 3300049592 | Bacteria | 7113 |
| 545 | Ga0501076_0020296 | 3300049592 | Bacteria | 5086 |
| 546 | Ga0501076_0047154 | 3300049592 | Bacteria | 3406 |
| 547 | Ga0501076_0572794 | 3300049592 | Bacteria | 931 |
| 548 | Ga0501077_0034711 | 3300049593 | Bacteria | 3210 |
| 549 | Ga0501077_0034929 | 3300049593 | Bacteria | 3200 |
| 550 | Ga0501249_172826 | 3300049679 | Bacteria | 555 |
| 551 | Ga0501079_0003830 | 3300049741 | Bacteria | 11116 |
| 552 | Ga0501079_0011071 | 3300049741 | Bacteria | 6879 |
| 553 | Ga0501079_0644690 | 3300049741 | Bacteria | 834 |
| 554 | Ga0501079_1132980 | 3300049741 | Bacteria | 616 |
| 555 | Ga0501080_0001459 | 3300049742 | Bacteria | 19904 |
| 556 | Ga0501080_0004292 | 3300049742 | Bacteria | 12654 |
| 557 | Ga0501080_0022120 | 3300049742 | Bacteria | 5891 |
| 558 | Ga0501080_0467953 | 3300049742 | Bacteria | 1129 |
| 559 | Ga0501080_0602480 | 3300049742 | Bacteria | 975 |
| 560 | Ga0501081_0012653 | 3300049743 | Bacteria | 5547 |
| 561 | Ga0501081_0075868 | 3300049743 | Bacteria | 2347 |
| 562 | Ga0501081_0359301 | 3300049743 | Bacteria | 1074 |
| 563 | Ga0501083_0059221 | 3300049744 | Bacteria | 2562 |
| 564 | Ga0501035_0204171 | 3300049822 | Bacteria | 1693 |
| 565 | Ga0501035_0352180 | 3300049822 | Bacteria | 1232 |
| 566 | Ga0501045_0002196 | 3300049824 | Bacteria | 13237 |
| 567 | Ga0501045_0009426 | 3300049824 | Bacteria | 6830 |
| 568 | Ga0501045_0012092 | 3300049824 | Bacteria | 6073 |
| 569 | Ga0501045_0537769 | 3300049824 | Bacteria | 867 |
| 570 | nmdc:mga00v17_814808_c1 | 3300050491 | Bacteria | 594 |
| 571 | nmdc:mga05p37_132_c1 | 3300050507 | Bacteria | 68371 |
| 572 | nmdc:mga05p37_209_c1 | 3300050507 | Bacteria | 59030 |
| 573 | nmdc:mga05p37_434447_c1 | 3300050507 | Bacteria | 1524 |
| 574 | nmdc:mga05p37_99251_c1 | 3300050507 | Bacteria | 3586 |
| 575 | nmdc:mga09592_129332_c1 | 3300050508 | Bacteria | 2172 |
| 576 | nmdc:mga09592_150_c1 | 3300050508 | Bacteria | 47613 |
| 577 | nmdc:mga09592_22875_c1 | 3300050508 | Bacteria | 5157 |
| 578 | nmdc:mga09592_418_c1 | 3300050508 | Bacteria | 31192 |
| 579 | nmdc:mga09592_48397_c1 | 3300050508 | Bacteria | 3584 |
| 580 | nmdc:mga09592_489508_c1 | 3300050508 | Bacteria | 1059 |
| 581 | nmdc:mga0qj67_130662_c1 | 3300050509 | Bacteria | 2034 |
| 582 | nmdc:mga0qj67_143086_c1 | 3300050509 | Bacteria | 1939 |
| 583 | nmdc:mga0qj67_54911_c1 | 3300050509 | Bacteria | 3155 |
| 584 | nmdc:mga0qj67_623_c1 | 3300050509 | Bacteria | 24285 |
| 585 | nmdc:mga0qj67_68746_c1 | 3300050509 | Bacteria | 2824 |
| 586 | nmdc:mga0qj67_97647_c1 | 3300050509 | Bacteria | 2366 |
| 587 | nmdc:mga06r32_106616_c1 | 3300050510 | Bacteria | 2753 |
| 588 | nmdc:mga06r32_146111_c1 | 3300050510 | Bacteria | 2342 |
| 589 | nmdc:mga06r32_146596_c1 | 3300050510 | Bacteria | 2338 |
| 590 | nmdc:mga06r32_242023_c1 | 3300050510 | Bacteria | 1792 |
| 591 | nmdc:mga06r32_260547_c1 | 3300050510 | Bacteria | 1721 |
| 592 | nmdc:mga06r32_5131_c1 | 3300050510 | Bacteria | 11778 |
| 593 | nmdc:mga06r32_59226_c1 | 3300050510 | Bacteria | 3682 |
| 594 | nmdc:mga08y16_109514_c1 | 3300050511 | Bacteria | 2876 |
| 595 | nmdc:mga08y16_158582_c1 | 3300050511 | Bacteria | 2351 |
| 596 | nmdc:mga08y16_232983_c1 | 3300050511 | Bacteria | 1904 |
| 597 | nmdc:mga08y16_2590_c1 | 3300050511 | Bacteria | 18584 |
| 598 | nmdc:mga08y16_281371_c1 | 3300050511 | Bacteria | 1716 |
| 599 | nmdc:mga08y16_300477_c1 | 3300050511 | Bacteria | 1654 |
| 600 | nmdc:mga08y16_353000_c1 | 3300050511 | Bacteria | 1510 |
| 601 | nmdc:mga08y16_37817_c1 | 3300050511 | Bacteria | 5067 |
| 602 | nmdc:mga08y16_382460_c1 | 3300050511 | Bacteria | 1443 |
| 603 | nmdc:mga08y16_773622_c1 | 3300050511 | Bacteria | 955 |
| 604 | nmdc:mga0n895_1401573_c1 | 3300050512 | Bacteria | 667 |
| 605 | nmdc:mga0n895_260541_c1 | 3300050512 | Bacteria | 1760 |
| 606 | nmdc:mga0n895_38225_c1 | 3300050512 | Bacteria | 4649 |
| 607 | nmdc:mga0n895_4259_c1 | 3300050512 | Bacteria | 11704 |
| 608 | nmdc:mga0n895_456_c1 | 3300050512 | Bacteria | 27409 |
| 609 | nmdc:mga0rr50_16225_c1 | 3300050513 | Bacteria | 4940 |
| 610 | nmdc:mga0rr50_165651_c1 | 3300050513 | Bacteria | 1797 |
| 611 | nmdc:mga0rr50_25229_c1 | 3300050513 | Bacteria | 4130 |
| 612 | nmdc:mga0rr50_30285_c1 | 3300050513 | Bacteria | 3830 |
| 613 | nmdc:mga0rr50_382855_c1 | 3300050513 | Bacteria | 1186 |
| 614 | nmdc:mga0rr50_397861_c1 | 3300050513 | Bacteria | 1163 |
| 615 | nmdc:mga0rr50_949778_c1 | 3300050513 | Bacteria | 733 |
| 616 | nmdc:mga08x19_108272_c1 | 3300050514 | Bacteria | 1851 |
| 617 | nmdc:mga08x19_18431_c1 | 3300050514 | Bacteria | 4277 |
| 618 | nmdc:mga08x19_2829_c1 | 3300050514 | Bacteria | 10472 |
| 619 | nmdc:mga08x19_382528_c1 | 3300050514 | Bacteria | 986 |
| 620 | nmdc:mga08x19_55_c1 | 3300050514 | Bacteria | 120851 |
| 621 | nmdc:mga08x19_6047_c1 | 3300050514 | Bacteria | 7152 |
| 622 | nmdc:mga0a205_1791_c1 | 3300050515 | Bacteria | 18571 |
| 623 | nmdc:mga0a205_524739_c1 | 3300050515 | Bacteria | 1040 |
| 624 | nmdc:mga0a205_774829_c1 | 3300050515 | Bacteria | 807 |
| 625 | nmdc:mga0a205_783686_c1 | 3300050515 | Bacteria | 801 |
| 626 | nmdc:mga0a205_97943_c1 | 3300050515 | Bacteria | 2831 |
| 627 | Ga0495601_0020352 | 3300053077 | Bacteria | 4052 |
| 628 | Ga0495619_0212455 | 3300053085 | Bacteria | 1340 |
| 629 | Ga0500566_0149637 | 3300053094 | Bacteria | 1229 |
| 630 | Ga0501084_0015022 | 3300054114 | Bacteria | 6420 |
| 631 | Ga0501084_0021031 | 3300054114 | Bacteria | 5442 |
| 632 | Ga0501084_0115264 | 3300054114 | Bacteria | 2259 |
| 633 | Ga0590071_092498 | 3300059421 | Bacteria | 758 |
| 634 | Ga0501082_0005562 | 3300060353 | Bacteria | 10942 |
| 635 | Ga0501082_0100579 | 3300060353 | Bacteria | 2501 |
| 636 | Ga0501082_0105770 | 3300060353 | Bacteria | 2434 |
| 637 | Ga0501082_0129953 | 3300060353 | Bacteria | 2185 |
| 638 | Ga0501082_0531014 | 3300060353 | Bacteria | 1029 |
| 639 | Ga0530510_0005015 | 3300061734 | Bacteria | 9144 |
| 640 | Ga0530510_0053851 | 3300061734 | Bacteria | 2907 |
| 641 | Ga0530510_0217830 | 3300061734 | Bacteria | 1419 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035121 | Ga0373960_0012638 | Ga0373960_0012638_963_1478 | 155 |
| 2 | 3300035691 | Ga0373931_0001111 | Ga0373931_0001111_10195_10710 | 155 |
| 3 | 3300035112 | Ga0373932_0067033 | Ga0373932_0067033_383_901 | 156 |
| 4 | 3300035115 | Ga0373941_0067176 | Ga0373941_0067176_351_869 | 156 |
| 5 | 3300049585 | Ga0501069_0295799 | Ga0501069_0295799_266_748 | 160 |
| 6 | 3300045976 | Ga0466967_0942412 | Ga0466967_0942412_304_804 | 162 |
| 7 | 3300025938 | Ga0207704_10744078 | Ga0207704_107440782 | 163 |
| 8 | 3300049572 | Ga0501036_0319593 | Ga0501036_0319593_371_862 | 163 |
| 9 | 3300049573 | Ga0501037_0336610 | Ga0501037_0336610_221_712 | 163 |
| 10 | 3300049574 | Ga0501038_0083926 | Ga0501038_0083926_1321_1812 | 163 |
| 11 | 3300049575 | Ga0501039_0070258 | Ga0501039_0070258_1403_1894 | 163 |
| 12 | 3300049575 | Ga0501039_0338143 | Ga0501039_0338143_88_591 | 163 |
| 13 | 3300049576 | Ga0501040_0054020 | Ga0501040_0054020_2042_2533 | 163 |
| 14 | 3300049577 | Ga0501041_0013041 | Ga0501041_0013041_2384_2875 | 163 |
| 15 | 3300049578 | Ga0501042_0058453 | Ga0501042_0058453_969_1460 | 163 |
| 16 | 3300049580 | Ga0501046_0196918 | Ga0501046_0196918_28_519 | 163 |
| 17 | 3300049582 | Ga0501048_0258413 | Ga0501048_0258413_31_522 | 163 |
| 18 | 3300049584 | Ga0501068_0079115 | Ga0501068_0079115_424_915 | 163 |
| 19 | 3300049587 | Ga0501071_0027848 | Ga0501071_0027848_1584_2075 | 163 |
| 20 | 3300049590 | Ga0501074_0571481 | Ga0501074_0571481_252_743 | 163 |
| 21 | 3300049591 | Ga0501075_0005912 | Ga0501075_0005912_4216_4707 | 163 |
| 22 | 3300049591 | Ga0501075_0043280 | Ga0501075_0043280_2643_3134 | 163 |
| 23 | 3300049592 | Ga0501076_0000501 | Ga0501076_0000501_15283_15774 | 163 |
| 24 | 3300049592 | Ga0501076_0020296 | Ga0501076_0020296_388_879 | 163 |
| 25 | 3300049593 | Ga0501077_0034929 | Ga0501077_0034929_1386_1877 | 163 |
| 26 | 3300049741 | Ga0501079_0011071 | Ga0501079_0011071_4792_5283 | 163 |
| 27 | 3300049742 | Ga0501080_0004292 | Ga0501080_0004292_7482_7973 | 163 |
| 28 | 3300049742 | Ga0501080_0602480 | Ga0501080_0602480_124_615 | 163 |
| 29 | 3300049822 | Ga0501035_0204171 | Ga0501035_0204171_569_1060 | 163 |
| 30 | 3300049824 | Ga0501045_0002196 | Ga0501045_0002196_12385_12876 | 163 |
| 31 | 3300049824 | Ga0501045_0009426 | Ga0501045_0009426_5802_6293 | 163 |
| 32 | 3300054114 | Ga0501084_0021031 | Ga0501084_0021031_4910_5401 | 163 |
| 33 | 3300060353 | Ga0501082_0005562 | Ga0501082_0005562_3504_3995 | 163 |
| 34 | 3300060353 | Ga0501082_0100579 | Ga0501082_0100579_385_876 | 163 |
| 35 | 3300061734 | Ga0530510_0053851 | Ga0530510_0053851_700_1191 | 163 |
| 36 | 3300061734 | Ga0530510_0217830 | Ga0530510_0217830_830_1321 | 163 |
| 37 | 3300005334 | Ga0068869_101008834 | Ga0068869_1010088342 | 164 |
| 38 | 3300005345 | Ga0070692_10320122 | Ga0070692_103201221 | 164 |
| 39 | 3300005468 | Ga0070707_100495725 | Ga0070707_1004957251 | 164 |
| 40 | 3300005544 | Ga0070686_100185800 | Ga0070686_1001858001 | 164 |
| 41 | 3300005545 | Ga0070695_100774624 | Ga0070695_1007746241 | 164 |
| 42 | 3300005547 | Ga0070693_100116800 | Ga0070693_1001168003 | 164 |
| 43 | 3300005547 | Ga0070693_100157932 | Ga0070693_1001579321 | 164 |
| 44 | 3300005549 | Ga0070704_100012457 | Ga0070704_1000124575 | 164 |
| 45 | 3300005614 | Ga0068856_100574738 | Ga0068856_1005747382 | 164 |
| 46 | 3300009094 | Ga0111539_12309540 | Ga0111539_123095402 | 164 |
| 47 | 3300009098 | Ga0105245_10174584 | Ga0105245_101745842 | 164 |
| 48 | 3300009176 | Ga0105242_10001782 | Ga0105242_100017826 | 164 |
| 49 | 3300025922 | Ga0207646_10433105 | Ga0207646_104331052 | 164 |
| 50 | 3300025927 | Ga0207687_10118425 | Ga0207687_101184252 | 164 |
| 51 | 3300025934 | Ga0207686_10029433 | Ga0207686_100294332 | 164 |
| 52 | 3300035111 | Ga0373923_0239757 | Ga0373923_0239757_299_799 | 164 |
| 53 | 3300035410 | Ga0373924_0086321 | Ga0373924_0086321_567_1067 | 164 |
| 54 | 3300035691 | Ga0373931_0292207 | Ga0373931_0292207_13_513 | 164 |
| 55 | 3300035692 | Ga0373935_0661985 | Ga0373935_0661985_59_559 | 164 |
| 56 | 3300035695 | Ga0373927_0016434 | Ga0373927_0016434_2597_3097 | 164 |
| 57 | 3300036401 | Ga0373937_0138192 | Ga0373937_0138192_701_1204 | 164 |
| 58 | 3300037068 | Ga0373925_0117169 | Ga0373925_0117169_1108_1608 | 164 |
| 59 | 3300042001 | Ga0439441_056928 | Ga0439441_056928_61_561 | 164 |
| 60 | 3300046539 | Ga0495621_0206979 | Ga0495621_0206979_193_696 | 164 |
| 61 | 3300049742 | Ga0501080_0467953 | Ga0501080_0467953_515_1018 | 164 |
| 62 | 3300050491 | nmdc:mga00v17_814808_c1 | nmdc:mga00v17_814808_c1_57_560 | 164 |
| 63 | 3300050511 | nmdc:mga08y16_300477_c1 | nmdc:mga08y16_300477_c1_979_1482 | 164 |
| 64 | 3300050515 | nmdc:mga0a205_524739_c1 | nmdc:mga0a205_524739_c1_363_863 | 164 |
| 65 | 3300005330 | Ga0070690_100254176 | Ga0070690_1002541762 | 165 |
| 66 | 3300005340 | Ga0070689_100829217 | Ga0070689_1008292172 | 165 |
| 67 | 3300005343 | Ga0070687_100193904 | Ga0070687_1001939042 | 165 |
| 68 | 3300005365 | Ga0070688_100650146 | Ga0070688_1006501462 | 165 |
| 69 | 3300005437 | Ga0070710_10160420 | Ga0070710_101604202 | 165 |
| 70 | 3300005440 | Ga0070705_100009501 | Ga0070705_1000095015 | 165 |
| 71 | 3300005444 | Ga0070694_100017597 | Ga0070694_1000175972 | 165 |
| 72 | 3300005444 | Ga0070694_100023240 | Ga0070694_1000232403 | 165 |
| 73 | 3300005445 | Ga0070708_100557224 | Ga0070708_1005572242 | 165 |
| 74 | 3300005459 | Ga0068867_100674356 | Ga0068867_1006743562 | 165 |
| 75 | 3300005471 | Ga0070698_100012901 | Ga0070698_10001290111 | 165 |
| 76 | 3300005518 | Ga0070699_100272627 | Ga0070699_1002726272 | 165 |
| 77 | 3300005545 | Ga0070695_100183594 | Ga0070695_1001835942 | 165 |
| 78 | 3300005545 | Ga0070695_100839412 | Ga0070695_1008394122 | 165 |
| 79 | 3300005546 | Ga0070696_101412965 | Ga0070696_1014129651 | 165 |
| 80 | 3300005549 | Ga0070704_100001327 | Ga0070704_1000013278 | 165 |
| 81 | 3300005549 | Ga0070704_100041897 | Ga0070704_1000418972 | 165 |
| 82 | 3300005549 | Ga0070704_100643329 | Ga0070704_1006433292 | 165 |
| 83 | 3300005549 | Ga0070704_101014919 | Ga0070704_1010149192 | 165 |
| 84 | 3300005577 | Ga0068857_100480110 | Ga0068857_1004801102 | 165 |
| 85 | 3300005617 | Ga0068859_100089998 | Ga0068859_1000899985 | 165 |
| 86 | 3300005841 | Ga0068863_100252789 | Ga0068863_1002527893 | 165 |
| 87 | 3300005842 | Ga0068858_100340710 | Ga0068858_1003407103 | 165 |
| 88 | 3300005844 | Ga0068862_100574832 | Ga0068862_1005748322 | 165 |
| 89 | 3300006846 | Ga0075430_100008422 | Ga0075430_1000084225 | 165 |
| 90 | 3300006846 | Ga0075430_100057331 | Ga0075430_1000573314 | 165 |
| 91 | 3300006847 | Ga0075431_100005396 | Ga0075431_1000053968 | 165 |
| 92 | 3300006847 | Ga0075431_100043616 | Ga0075431_1000436163 | 165 |
| 93 | 3300006847 | Ga0075431_100066496 | Ga0075431_1000664965 | 165 |
| 94 | 3300006880 | Ga0075429_100000511 | Ga0075429_10000051127 | 165 |
| 95 | 3300006931 | Ga0097620_100089997 | Ga0097620_1000899975 | 165 |
| 96 | 3300007076 | Ga0075435_100088050 | Ga0075435_1000880502 | 165 |
| 97 | 3300009094 | Ga0111539_10013382 | Ga0111539_1001338211 | 165 |
| 98 | 3300009094 | Ga0111539_10480652 | Ga0111539_104806522 | 165 |
| 99 | 3300009147 | Ga0114129_10002670 | Ga0114129_100026706 | 165 |
| 100 | 3300009147 | Ga0114129_10754917 | Ga0114129_107549173 | 165 |
| 101 | 3300009553 | Ga0105249_10039524 | Ga0105249_100395242 | 165 |
| 102 | 3300013307 | Ga0157372_10260338 | Ga0157372_102603384 | 165 |
| 103 | 3300025885 | Ga0207653_10193672 | Ga0207653_101936722 | 165 |
| 104 | 3300025898 | Ga0207692_10036509 | Ga0207692_100365093 | 165 |
| 105 | 3300025917 | Ga0207660_10051463 | Ga0207660_100514633 | 165 |
| 106 | 3300025918 | Ga0207662_10039563 | Ga0207662_100395632 | 165 |
| 107 | 3300025961 | Ga0207712_10117131 | Ga0207712_101171312 | 165 |
| 108 | 3300026088 | Ga0207641_10173891 | Ga0207641_101738913 | 165 |
| 109 | 3300026116 | Ga0207674_10040257 | Ga0207674_100402572 | 165 |
| 110 | 3300026118 | Ga0207675_101152338 | Ga0207675_1011523381 | 165 |
| 111 | 3300027360 | Ga0209969_1014562 | Ga0209969_10145622 | 165 |
| 112 | 3300027907 | Ga0207428_10288770 | Ga0207428_102887702 | 165 |
| 113 | 3300027907 | Ga0207428_10306886 | Ga0207428_103068862 | 165 |
| 114 | 3300028380 | Ga0268265_10922099 | Ga0268265_109220992 | 165 |
| 115 | 3300031665 | Ga0316575_10009032 | Ga0316575_100090322 | 165 |
| 116 | 3300031728 | Ga0316578_10036076 | Ga0316578_100360764 | 165 |
| 117 | 3300031995 | Ga0307409_101146005 | Ga0307409_1011460051 | 165 |
| 118 | 3300032133 | Ga0316583_10028863 | Ga0316583_100288632 | 165 |
| 119 | 3300035111 | Ga0373923_0075639 | Ga0373923_0075639_815_1315 | 165 |
| 120 | 3300035116 | Ga0373945_0279006 | Ga0373945_0279006_27_527 | 165 |
| 121 | 3300035117 | Ga0373953_0029306 | Ga0373953_0029306_129_629 | 165 |
| 122 | 3300035118 | Ga0373954_0151457 | Ga0373954_0151457_67_567 | 165 |
| 123 | 3300035119 | Ga0373956_0039558 | Ga0373956_0039558_854_1354 | 165 |
| 124 | 3300035120 | Ga0373957_0010845 | Ga0373957_0010845_971_1471 | 165 |
| 125 | 3300035172 | Ga0373955_0006900 | Ga0373955_0006900_3505_4005 | 165 |
| 126 | 3300035398 | Ga0316574_0024779 | Ga0316574_0024779_273_773 | 165 |
| 127 | 3300035695 | Ga0373927_0122995 | Ga0373927_0122995_1003_1503 | 165 |
| 128 | 3300035724 | Ga0373933_0023470 | Ga0373933_0023470_1693_2193 | 165 |
| 129 | 3300036401 | Ga0373937_0024246 | Ga0373937_0024246_2041_2541 | 165 |
| 130 | 3300037588 | Ga0316581_0001558 | Ga0316581_0001558_533_1033 | 165 |
| 131 | 3300042435 | Ga0439434_0117730 | Ga0439434_0117730_351_851 | 165 |
| 132 | 3300045051 | Ga0451576_0008334 | Ga0451576_0008334_2430_2930 | 165 |
| 133 | 3300045051 | Ga0451576_0518803 | Ga0451576_0518803_493_993 | 165 |
| 134 | 3300045051 | Ga0451576_1244875 | Ga0451576_1244875_197_697 | 165 |
| 135 | 3300046499 | Ga0495594_0248849 | Ga0495594_0248849_351_851 | 165 |
| 136 | 3300046516 | Ga0495628_0641179 | Ga0495628_0641179_178_678 | 165 |
| 137 | 3300046539 | Ga0495621_0065391 | Ga0495621_0065391_366_866 | 165 |
| 138 | 3300046663 | Ga0495635_0095009 | Ga0495635_0095009_187_687 | 165 |
| 139 | 3300049572 | Ga0501036_0178308 | Ga0501036_0178308_510_1010 | 165 |
| 140 | 3300049572 | Ga0501036_0377957 | Ga0501036_0377957_466_969 | 165 |
| 141 | 3300049573 | Ga0501037_0568278 | Ga0501037_0568278_130_630 | 165 |
| 142 | 3300049575 | Ga0501039_0012877 | Ga0501039_0012877_3055_3555 | 165 |
| 143 | 3300049575 | Ga0501039_0129642 | Ga0501039_0129642_107_610 | 165 |
| 144 | 3300049576 | Ga0501040_0358871 | Ga0501040_0358871_89_592 | 165 |
| 145 | 3300049577 | Ga0501041_0102698 | Ga0501041_0102698_124_624 | 165 |
| 146 | 3300049578 | Ga0501042_1138440 | Ga0501042_1138440_43_543 | 165 |
| 147 | 3300049579 | Ga0501043_0188449 | Ga0501043_0188449_858_1361 | 165 |
| 148 | 3300049587 | Ga0501071_0002191 | Ga0501071_0002191_5651_6154 | 165 |
| 149 | 3300049587 | Ga0501071_0002663 | Ga0501071_0002663_482_982 | 165 |
| 150 | 3300049591 | Ga0501075_0005803 | Ga0501075_0005803_3440_3943 | 165 |
| 151 | 3300049591 | Ga0501075_0174935 | Ga0501075_0174935_260_760 | 165 |
| 152 | 3300049592 | Ga0501076_0009698 | Ga0501076_0009698_5655_6158 | 165 |
| 153 | 3300049742 | Ga0501080_0001459 | Ga0501080_0001459_11078_11581 | 165 |
| 154 | 3300049743 | Ga0501081_0075868 | Ga0501081_0075868_236_739 | 165 |
| 155 | 3300049744 | Ga0501083_0059221 | Ga0501083_0059221_1623_2126 | 165 |
| 156 | 3300049822 | Ga0501035_0352180 | Ga0501035_0352180_627_1127 | 165 |
| 157 | 3300049824 | Ga0501045_0537769 | Ga0501045_0537769_94_594 | 165 |
| 158 | 3300050507 | nmdc:mga05p37_209_c1 | nmdc:mga05p37_209_c1_40494_40994 | 165 |
| 159 | 3300050508 | nmdc:mga09592_150_c1 | nmdc:mga09592_150_c1_41415_41915 | 165 |
| 160 | 3300050509 | nmdc:mga0qj67_130662_c1 | nmdc:mga0qj67_130662_c1_798_1298 | 165 |
| 161 | 3300050509 | nmdc:mga0qj67_97647_c1 | nmdc:mga0qj67_97647_c1_1186_1686 | 165 |
| 162 | 3300050510 | nmdc:mga06r32_106616_c1 | nmdc:mga06r32_106616_c1_1290_1790 | 165 |
| 163 | 3300050510 | nmdc:mga06r32_5131_c1 | nmdc:mga06r32_5131_c1_6259_6759 | 165 |
| 164 | 3300050510 | nmdc:mga06r32_59226_c1 | nmdc:mga06r32_59226_c1_2995_3495 | 165 |
| 165 | 3300050511 | nmdc:mga08y16_158582_c1 | nmdc:mga08y16_158582_c1_1671_2171 | 165 |
| 166 | 3300050511 | nmdc:mga08y16_232983_c1 | nmdc:mga08y16_232983_c1_712_1212 | 165 |
| 167 | 3300050513 | nmdc:mga0rr50_382855_c1 | nmdc:mga0rr50_382855_c1_344_844 | 165 |
| 168 | 3300060353 | Ga0501082_0129953 | Ga0501082_0129953_757_1260 | 165 |
| 169 | 3300005367 | Ga0070667_100237976 | Ga0070667_1002379762 | 166 |
| 170 | 3300005438 | Ga0070701_10477794 | Ga0070701_104777942 | 166 |
| 171 | 3300005458 | Ga0070681_10000399 | Ga0070681_1000039912 | 166 |
| 172 | 3300005530 | Ga0070679_100030836 | Ga0070679_1000308366 | 166 |
| 173 | 3300005535 | Ga0070684_100013383 | Ga0070684_1000133833 | 166 |
| 174 | 3300005544 | Ga0070686_100178402 | Ga0070686_1001784022 | 166 |
| 175 | 3300005615 | Ga0070702_100298111 | Ga0070702_1002981112 | 166 |
| 176 | 3300005617 | Ga0068859_102348448 | Ga0068859_1023484481 | 166 |
| 177 | 3300006237 | Ga0097621_100002033 | Ga0097621_1000020333 | 166 |
| 178 | 3300006358 | Ga0068871_100003069 | Ga0068871_10000306911 | 166 |
| 179 | 3300006931 | Ga0097620_102347883 | Ga0097620_1023478831 | 166 |
| 180 | 3300009148 | Ga0105243_10719528 | Ga0105243_107195282 | 166 |
| 181 | 3300009177 | Ga0105248_10165967 | Ga0105248_101659673 | 166 |
| 182 | 3300014969 | Ga0157376_10143622 | Ga0157376_101436223 | 166 |
| 183 | 3300025912 | Ga0207707_10003163 | Ga0207707_1000316310 | 166 |
| 184 | 3300025917 | Ga0207660_10249364 | Ga0207660_102493643 | 166 |
| 185 | 3300025918 | Ga0207662_10282464 | Ga0207662_102824642 | 166 |
| 186 | 3300025921 | Ga0207652_10195092 | Ga0207652_101950922 | 166 |
| 187 | 3300025986 | Ga0207658_10226027 | Ga0207658_102260272 | 166 |
| 188 | 3300026023 | Ga0207677_10911426 | Ga0207677_109114262 | 166 |
| 189 | 3300026089 | Ga0207648_10789803 | Ga0207648_107898032 | 166 |
| 190 | 3300027695 | Ga0209966_1004025 | Ga0209966_10040253 | 166 |
| 191 | 3300032002 | Ga0307416_101045929 | Ga0307416_1010459292 | 166 |
| 192 | 3300032005 | Ga0307411_10613501 | Ga0307411_106135012 | 166 |
| 193 | 3300035207 | Ga0373942_0061243 | Ga0373942_0061243_297_797 | 166 |
| 194 | 3300035691 | Ga0373931_0210255 | Ga0373931_0210255_199_699 | 166 |
| 195 | 3300049522 | Ga0501299_026353 | Ga0501299_026353_379_879 | 166 |
| 196 | 3300049583 | Ga0501067_0060081 | Ga0501067_0060081_28_531 | 166 |
| 197 | 3300049585 | Ga0501069_0323174 | Ga0501069_0323174_221_724 | 166 |
| 198 | 3300002074 | JGI24748J21848_1021905 | JGI24748J21848_10219051 | 167 |
| 199 | 3300005330 | Ga0070690_100000197 | Ga0070690_10000019732 | 167 |
| 200 | 3300005330 | Ga0070690_100117645 | Ga0070690_1001176452 | 167 |
| 201 | 3300005333 | Ga0070677_10111340 | Ga0070677_101113403 | 167 |
| 202 | 3300005334 | Ga0068869_100000214 | Ga0068869_10000021432 | 167 |
| 203 | 3300005335 | Ga0070666_10090292 | Ga0070666_100902922 | 167 |
| 204 | 3300005336 | Ga0070680_100001218 | Ga0070680_10000121820 | 167 |
| 205 | 3300005336 | Ga0070680_100107816 | Ga0070680_1001078163 | 167 |
| 206 | 3300005336 | Ga0070680_100516319 | Ga0070680_1005163192 | 167 |
| 207 | 3300005337 | Ga0070682_100003738 | Ga0070682_1000037389 | 167 |
| 208 | 3300005338 | Ga0068868_100000458 | Ga0068868_1000004586 | 167 |
| 209 | 3300005340 | Ga0070689_100000107 | Ga0070689_10000010714 | 167 |
| 210 | 3300005341 | Ga0070691_10000220 | Ga0070691_100002207 | 167 |
| 211 | 3300005343 | Ga0070687_100000034 | Ga0070687_1000000342 | 167 |
| 212 | 3300005343 | Ga0070687_100861811 | Ga0070687_1008618111 | 167 |
| 213 | 3300005345 | Ga0070692_10010201 | Ga0070692_100102013 | 167 |
| 214 | 3300005347 | Ga0070668_100003178 | Ga0070668_10000317811 | 167 |
| 215 | 3300005353 | Ga0070669_100003861 | Ga0070669_1000038619 | 167 |
| 216 | 3300005353 | Ga0070669_100519539 | Ga0070669_1005195391 | 167 |
| 217 | 3300005353 | Ga0070669_100854172 | Ga0070669_1008541721 | 167 |
| 218 | 3300005356 | Ga0070674_100078762 | Ga0070674_1000787624 | 167 |
| 219 | 3300005356 | Ga0070674_100349867 | Ga0070674_1003498672 | 167 |
| 220 | 3300005365 | Ga0070688_100391486 | Ga0070688_1003914862 | 167 |
| 221 | 3300005406 | Ga0070703_10003454 | Ga0070703_100034542 | 167 |
| 222 | 3300005406 | Ga0070703_10222099 | Ga0070703_102220991 | 167 |
| 223 | 3300005434 | Ga0070709_10797513 | Ga0070709_107975132 | 167 |
| 224 | 3300005435 | Ga0070714_100691684 | Ga0070714_1006916842 | 167 |
| 225 | 3300005436 | Ga0070713_100205276 | Ga0070713_1002052763 | 167 |
| 226 | 3300005438 | Ga0070701_10000396 | Ga0070701_1000039610 | 167 |
| 227 | 3300005438 | Ga0070701_10492074 | Ga0070701_104920742 | 167 |
| 228 | 3300005439 | Ga0070711_100295613 | Ga0070711_1002956132 | 167 |
| 229 | 3300005440 | Ga0070705_100000582 | Ga0070705_10000058211 | 167 |
| 230 | 3300005440 | Ga0070705_100132366 | Ga0070705_1001323662 | 167 |
| 231 | 3300005440 | Ga0070705_100188517 | Ga0070705_1001885172 | 167 |
| 232 | 3300005440 | Ga0070705_100226806 | Ga0070705_1002268063 | 167 |
| 233 | 3300005441 | Ga0070700_100000344 | Ga0070700_10000034412 | 167 |
| 234 | 3300005441 | Ga0070700_100000633 | Ga0070700_10000063317 | 167 |
| 235 | 3300005441 | Ga0070700_100614442 | Ga0070700_1006144421 | 167 |
| 236 | 3300005444 | Ga0070694_100000126 | Ga0070694_1000001267 | 167 |
| 237 | 3300005444 | Ga0070694_100259542 | Ga0070694_1002595422 | 167 |
| 238 | 3300005444 | Ga0070694_100488916 | Ga0070694_1004889162 | 167 |
| 239 | 3300005444 | Ga0070694_100680795 | Ga0070694_1006807952 | 167 |
| 240 | 3300005445 | Ga0070708_100173223 | Ga0070708_1001732232 | 167 |
| 241 | 3300005458 | Ga0070681_10047332 | Ga0070681_100473324 | 167 |
| 242 | 3300005459 | Ga0068867_100000032 | Ga0068867_10000003256 | 167 |
| 243 | 3300005459 | Ga0068867_100001769 | Ga0068867_1000017693 | 167 |
| 244 | 3300005468 | Ga0070707_100357333 | Ga0070707_1003573332 | 167 |
| 245 | 3300005471 | Ga0070698_100378584 | Ga0070698_1003785842 | 167 |
| 246 | 3300005471 | Ga0070698_100549999 | Ga0070698_1005499992 | 167 |
| 247 | 3300005518 | Ga0070699_101223804 | Ga0070699_1012238041 | 167 |
| 248 | 3300005530 | Ga0070679_100017314 | Ga0070679_1000173145 | 167 |
| 249 | 3300005536 | Ga0070697_100000731 | Ga0070697_10000073119 | 167 |
| 250 | 3300005543 | Ga0070672_101009374 | Ga0070672_1010093742 | 167 |
| 251 | 3300005544 | Ga0070686_100000253 | Ga0070686_10000025311 | 167 |
| 252 | 3300005544 | Ga0070686_100203895 | Ga0070686_1002038952 | 167 |
| 253 | 3300005544 | Ga0070686_100426217 | Ga0070686_1004262171 | 167 |
| 254 | 3300005544 | Ga0070686_100499257 | Ga0070686_1004992571 | 167 |
| 255 | 3300005545 | Ga0070695_100000197 | Ga0070695_1000001973 | 167 |
| 256 | 3300005545 | Ga0070695_100094784 | Ga0070695_1000947842 | 167 |
| 257 | 3300005546 | Ga0070696_100000089 | Ga0070696_10000008936 | 167 |
| 258 | 3300005546 | Ga0070696_100000482 | Ga0070696_10000048214 | 167 |
| 259 | 3300005546 | Ga0070696_100090748 | Ga0070696_1000907484 | 167 |
| 260 | 3300005546 | Ga0070696_100277419 | Ga0070696_1002774193 | 167 |
| 261 | 3300005546 | Ga0070696_100572358 | Ga0070696_1005723582 | 167 |
| 262 | 3300005547 | Ga0070693_100000400 | Ga0070693_10000040014 | 167 |
| 263 | 3300005547 | Ga0070693_100287804 | Ga0070693_1002878041 | 167 |
| 264 | 3300005547 | Ga0070693_100613918 | Ga0070693_1006139181 | 167 |
| 265 | 3300005547 | Ga0070693_101172963 | Ga0070693_1011729631 | 167 |
| 266 | 3300005549 | Ga0070704_100000017 | Ga0070704_10000001754 | 167 |
| 267 | 3300005549 | Ga0070704_100468739 | Ga0070704_1004687392 | 167 |
| 268 | 3300005549 | Ga0070704_100618204 | Ga0070704_1006182041 | 167 |
| 269 | 3300005549 | Ga0070704_101052032 | Ga0070704_1010520322 | 167 |
| 270 | 3300005563 | Ga0068855_100002377 | Ga0068855_10000237720 | 167 |
| 271 | 3300005578 | Ga0068854_100004305 | Ga0068854_1000043053 | 167 |
| 272 | 3300005614 | Ga0068856_100020620 | Ga0068856_1000206203 | 167 |
| 273 | 3300005614 | Ga0068856_100699952 | Ga0068856_1006999521 | 167 |
| 274 | 3300005615 | Ga0070702_100000001 | Ga0070702_10000000134 | 167 |
| 275 | 3300005617 | Ga0068859_100000149 | Ga0068859_10000014939 | 167 |
| 276 | 3300005617 | Ga0068859_100185203 | Ga0068859_1001852032 | 167 |
| 277 | 3300005618 | Ga0068864_100009007 | Ga0068864_10000900710 | 167 |
| 278 | 3300005718 | Ga0068866_10000326 | Ga0068866_1000032618 | 167 |
| 279 | 3300005718 | Ga0068866_10593364 | Ga0068866_105933642 | 167 |
| 280 | 3300005719 | Ga0068861_100002365 | Ga0068861_1000023652 | 167 |
| 281 | 3300005719 | Ga0068861_100016010 | Ga0068861_1000160105 | 167 |
| 282 | 3300005840 | Ga0068870_10009444 | Ga0068870_100094442 | 167 |
| 283 | 3300005840 | Ga0068870_10102497 | Ga0068870_101024973 | 167 |
| 284 | 3300005840 | Ga0068870_10135645 | Ga0068870_101356452 | 167 |
| 285 | 3300005841 | Ga0068863_101417311 | Ga0068863_1014173112 | 167 |
| 286 | 3300005842 | Ga0068858_100002902 | Ga0068858_10000290218 | 167 |
| 287 | 3300005842 | Ga0068858_100195287 | Ga0068858_1001952872 | 167 |
| 288 | 3300005843 | Ga0068860_100001090 | Ga0068860_10000109011 | 167 |
| 289 | 3300005844 | Ga0068862_100000409 | Ga0068862_10000040925 | 167 |
| 290 | 3300005844 | Ga0068862_100001785 | Ga0068862_10000178514 | 167 |
| 291 | 3300005844 | Ga0068862_100493025 | Ga0068862_1004930253 | 167 |
| 292 | 3300005981 | Ga0081538_10081944 | Ga0081538_100819442 | 167 |
| 293 | 3300005985 | Ga0081539_10000686 | Ga0081539_1000068663 | 167 |
| 294 | 3300006173 | Ga0070716_100092106 | Ga0070716_1000921063 | 167 |
| 295 | 3300006237 | Ga0097621_100000928 | Ga0097621_1000009289 | 167 |
| 296 | 3300006358 | Ga0068871_100029846 | Ga0068871_1000298463 | 167 |
| 297 | 3300006844 | Ga0075428_100000083 | Ga0075428_10000008313 | 167 |
| 298 | 3300006844 | Ga0075428_100037796 | Ga0075428_1000377964 | 167 |
| 299 | 3300006844 | Ga0075428_100108390 | Ga0075428_1001083906 | 167 |
| 300 | 3300006844 | Ga0075428_100359340 | Ga0075428_1003593403 | 167 |
| 301 | 3300006844 | Ga0075428_100842720 | Ga0075428_1008427202 | 167 |
| 302 | 3300006846 | Ga0075430_100000550 | Ga0075430_10000055014 | 167 |
| 303 | 3300006846 | Ga0075430_100058656 | Ga0075430_1000586564 | 167 |
| 304 | 3300006846 | Ga0075430_100159593 | Ga0075430_1001595932 | 167 |
| 305 | 3300006847 | Ga0075431_100153977 | Ga0075431_1001539773 | 167 |
| 306 | 3300006847 | Ga0075431_100841843 | Ga0075431_1008418431 | 167 |
| 307 | 3300006852 | Ga0075433_10007789 | Ga0075433_100077898 | 167 |
| 308 | 3300006852 | Ga0075433_10921675 | Ga0075433_109216752 | 167 |
| 309 | 3300006852 | Ga0075433_10947210 | Ga0075433_109472102 | 167 |
| 310 | 3300006871 | Ga0075434_100007734 | Ga0075434_1000077344 | 167 |
| 311 | 3300006871 | Ga0075434_100115383 | Ga0075434_1001153833 | 167 |
| 312 | 3300006871 | Ga0075434_101348149 | Ga0075434_1013481492 | 167 |
| 313 | 3300006871 | Ga0075434_101696308 | Ga0075434_1016963082 | 167 |
| 314 | 3300006880 | Ga0075429_100000480 | Ga0075429_1000004809 | 167 |
| 315 | 3300006880 | Ga0075429_100097034 | Ga0075429_1000970342 | 167 |
| 316 | 3300006880 | Ga0075429_100142665 | Ga0075429_1001426652 | 167 |
| 317 | 3300006880 | Ga0075429_100547037 | Ga0075429_1005470372 | 167 |
| 318 | 3300006881 | Ga0068865_100000059 | Ga0068865_10000005932 | 167 |
| 319 | 3300006881 | Ga0068865_100243839 | Ga0068865_1002438393 | 167 |
| 320 | 3300006914 | Ga0075436_100003220 | Ga0075436_1000032206 | 167 |
| 321 | 3300006914 | Ga0075436_100015702 | Ga0075436_1000157026 | 167 |
| 322 | 3300006914 | Ga0075436_100064795 | Ga0075436_1000647951 | 167 |
| 323 | 3300006914 | Ga0075436_100072353 | Ga0075436_1000723533 | 167 |
| 324 | 3300006931 | Ga0097620_100000149 | Ga0097620_10000014936 | 167 |
| 325 | 3300006931 | Ga0097620_100185211 | Ga0097620_1001852112 | 167 |
| 326 | 3300007076 | Ga0075435_100000388 | Ga0075435_1000003888 | 167 |
| 327 | 3300007076 | Ga0075435_100002470 | Ga0075435_1000024702 | 167 |
| 328 | 3300007076 | Ga0075435_100003004 | Ga0075435_1000030043 | 167 |
| 329 | 3300007076 | Ga0075435_100095285 | Ga0075435_1000952852 | 167 |
| 330 | 3300007076 | Ga0075435_100371528 | Ga0075435_1003715282 | 167 |
| 331 | 3300007265 | Ga0099794_10003748 | Ga0099794_100037483 | 167 |
| 332 | 3300007265 | Ga0099794_10292604 | Ga0099794_102926042 | 167 |
| 333 | 3300009094 | Ga0111539_10022182 | Ga0111539_1002218211 | 167 |
| 334 | 3300009094 | Ga0111539_10053780 | Ga0111539_100537802 | 167 |
| 335 | 3300009094 | Ga0111539_10082706 | Ga0111539_100827062 | 167 |
| 336 | 3300009094 | Ga0111539_10369811 | Ga0111539_103698113 | 167 |
| 337 | 3300009094 | Ga0111539_10535706 | Ga0111539_105357063 | 167 |
| 338 | 3300009098 | Ga0105245_10000075 | Ga0105245_1000007557 | 167 |
| 339 | 3300009147 | Ga0114129_10000210 | Ga0114129_1000021039 | 167 |
| 340 | 3300009147 | Ga0114129_10990843 | Ga0114129_109908432 | 167 |
| 341 | 3300009148 | Ga0105243_10000622 | Ga0105243_1000062228 | 167 |
| 342 | 3300009174 | Ga0105241_10012163 | Ga0105241_100121635 | 167 |
| 343 | 3300009176 | Ga0105242_10000407 | Ga0105242_1000040728 | 167 |
| 344 | 3300009177 | Ga0105248_10255442 | Ga0105248_102554422 | 167 |
| 345 | 3300009177 | Ga0105248_10546246 | Ga0105248_105462462 | 167 |
| 346 | 3300009551 | Ga0105238_10842562 | Ga0105238_108425622 | 167 |
| 347 | 3300009553 | Ga0105249_10007167 | Ga0105249_1000716710 | 167 |
| 348 | 3300009553 | Ga0105249_11767283 | Ga0105249_117672831 | 167 |
| 349 | 3300010375 | Ga0105239_10157884 | Ga0105239_101578844 | 167 |
| 350 | 3300013297 | Ga0157378_10000074 | Ga0157378_1000007438 | 167 |
| 351 | 3300013306 | Ga0163162_10129351 | Ga0163162_101293512 | 167 |
| 352 | 3300013306 | Ga0163162_10285360 | Ga0163162_102853602 | 167 |
| 353 | 3300013308 | Ga0157375_10509511 | Ga0157375_105095112 | 167 |
| 354 | 3300013308 | Ga0157375_11811274 | Ga0157375_118112741 | 167 |
| 355 | 3300014745 | Ga0157377_10854859 | Ga0157377_108548591 | 167 |
| 356 | 3300014969 | Ga0157376_10059407 | Ga0157376_100594075 | 167 |
| 357 | 3300014969 | Ga0157376_11303303 | Ga0157376_113033032 | 167 |
| 358 | 3300025885 | Ga0207653_10022249 | Ga0207653_100222491 | 167 |
| 359 | 3300025893 | Ga0207682_10031631 | Ga0207682_100316312 | 167 |
| 360 | 3300025899 | Ga0207642_10001898 | Ga0207642_100018985 | 167 |
| 361 | 3300025903 | Ga0207680_10218904 | Ga0207680_102189042 | 167 |
| 362 | 3300025905 | Ga0207685_10267975 | Ga0207685_102679752 | 167 |
| 363 | 3300025907 | Ga0207645_10078625 | Ga0207645_100786253 | 167 |
| 364 | 3300025908 | Ga0207643_10407301 | Ga0207643_104073012 | 167 |
| 365 | 3300025908 | Ga0207643_10551299 | Ga0207643_105512992 | 167 |
| 366 | 3300025911 | Ga0207654_10010687 | Ga0207654_100106874 | 167 |
| 367 | 3300025912 | Ga0207707_10229933 | Ga0207707_102299332 | 167 |
| 368 | 3300025916 | Ga0207663_10105889 | Ga0207663_101058892 | 167 |
| 369 | 3300025916 | Ga0207663_10700876 | Ga0207663_107008762 | 167 |
| 370 | 3300025917 | Ga0207660_10003510 | Ga0207660_1000351010 | 167 |
| 371 | 3300025917 | Ga0207660_10141579 | Ga0207660_101415793 | 167 |
| 372 | 3300025917 | Ga0207660_10229094 | Ga0207660_102290942 | 167 |
| 373 | 3300025918 | Ga0207662_10000166 | Ga0207662_1000016636 | 167 |
| 374 | 3300025918 | Ga0207662_10018412 | Ga0207662_100184125 | 167 |
| 375 | 3300025918 | Ga0207662_10247552 | Ga0207662_102475523 | 167 |
| 376 | 3300025918 | Ga0207662_10468186 | Ga0207662_104681861 | 167 |
| 377 | 3300025918 | Ga0207662_10604257 | Ga0207662_106042571 | 167 |
| 378 | 3300025921 | Ga0207652_10010844 | Ga0207652_100108442 | 167 |
| 379 | 3300025921 | Ga0207652_10676459 | Ga0207652_106764592 | 167 |
| 380 | 3300025922 | Ga0207646_10228935 | Ga0207646_102289352 | 167 |
| 381 | 3300025922 | Ga0207646_10804596 | Ga0207646_108045962 | 167 |
| 382 | 3300025923 | Ga0207681_10000542 | Ga0207681_1000054216 | 167 |
| 383 | 3300025923 | Ga0207681_10418203 | Ga0207681_104182032 | 167 |
| 384 | 3300025925 | Ga0207650_10959241 | Ga0207650_109592412 | 167 |
| 385 | 3300025934 | Ga0207686_10000243 | Ga0207686_1000024322 | 167 |
| 386 | 3300025935 | Ga0207709_10001387 | Ga0207709_100013877 | 167 |
| 387 | 3300025935 | Ga0207709_10004987 | Ga0207709_100049874 | 167 |
| 388 | 3300025936 | Ga0207670_10006628 | Ga0207670_100066285 | 167 |
| 389 | 3300025936 | Ga0207670_10008142 | Ga0207670_100081426 | 167 |
| 390 | 3300025937 | Ga0207669_10041596 | Ga0207669_100415963 | 167 |
| 391 | 3300025937 | Ga0207669_10616964 | Ga0207669_106169642 | 167 |
| 392 | 3300025938 | Ga0207704_10000178 | Ga0207704_1000017836 | 167 |
| 393 | 3300025938 | Ga0207704_10001089 | Ga0207704_100010892 | 167 |
| 394 | 3300025938 | Ga0207704_10087833 | Ga0207704_100878335 | 167 |
| 395 | 3300025940 | Ga0207691_10479201 | Ga0207691_104792012 | 167 |
| 396 | 3300025941 | Ga0207711_10151250 | Ga0207711_101512502 | 167 |
| 397 | 3300025941 | Ga0207711_10277589 | Ga0207711_102775894 | 167 |
| 398 | 3300025942 | Ga0207689_10000007 | Ga0207689_1000000783 | 167 |
| 399 | 3300025942 | Ga0207689_10205501 | Ga0207689_102055013 | 167 |
| 400 | 3300025944 | Ga0207661_10242755 | Ga0207661_102427552 | 167 |
| 401 | 3300025949 | Ga0207667_10019325 | Ga0207667_100193255 | 167 |
| 402 | 3300025960 | Ga0207651_10229189 | Ga0207651_102291891 | 167 |
| 403 | 3300025961 | Ga0207712_10002821 | Ga0207712_100028213 | 167 |
| 404 | 3300025961 | Ga0207712_10020951 | Ga0207712_100209513 | 167 |
| 405 | 3300025972 | Ga0207668_10031833 | Ga0207668_100318337 | 167 |
| 406 | 3300025981 | Ga0207640_10014310 | Ga0207640_100143103 | 167 |
| 407 | 3300026023 | Ga0207677_10000823 | Ga0207677_1000082311 | 167 |
| 408 | 3300026035 | Ga0207703_10005057 | Ga0207703_100050572 | 167 |
| 409 | 3300026035 | Ga0207703_10015309 | Ga0207703_100153093 | 167 |
| 410 | 3300026075 | Ga0207708_10000086 | Ga0207708_1000008617 | 167 |
| 411 | 3300026075 | Ga0207708_10003576 | Ga0207708_1000357614 | 167 |
| 412 | 3300026075 | Ga0207708_10177507 | Ga0207708_101775073 | 167 |
| 413 | 3300026075 | Ga0207708_10940309 | Ga0207708_109403092 | 167 |
| 414 | 3300026078 | Ga0207702_10017742 | Ga0207702_100177426 | 167 |
| 415 | 3300026078 | Ga0207702_10073736 | Ga0207702_100737362 | 167 |
| 416 | 3300026078 | Ga0207702_10554990 | Ga0207702_105549901 | 167 |
| 417 | 3300026088 | Ga0207641_10202721 | Ga0207641_102027212 | 167 |
| 418 | 3300026088 | Ga0207641_10260338 | Ga0207641_102603383 | 167 |
| 419 | 3300026089 | Ga0207648_10000079 | Ga0207648_1000007956 | 167 |
| 420 | 3300026089 | Ga0207648_10000352 | Ga0207648_100003524 | 167 |
| 421 | 3300026089 | Ga0207648_11297609 | Ga0207648_112976092 | 167 |
| 422 | 3300026095 | Ga0207676_10036447 | Ga0207676_100364472 | 167 |
| 423 | 3300026118 | Ga0207675_100000093 | Ga0207675_10000009358 | 167 |
| 424 | 3300026118 | Ga0207675_100000802 | Ga0207675_10000080227 | 167 |
| 425 | 3300026142 | Ga0207698_10010533 | Ga0207698_100105335 | 167 |
| 426 | 3300027378 | Ga0209981_1005263 | Ga0209981_10052633 | 167 |
| 427 | 3300027378 | Ga0209981_1006180 | Ga0209981_10061802 | 167 |
| 428 | 3300027462 | Ga0210000_1006568 | Ga0210000_10065682 | 167 |
| 429 | 3300027462 | Ga0210000_1021175 | Ga0210000_10211752 | 167 |
| 430 | 3300027526 | Ga0209968_1004440 | Ga0209968_10044405 | 167 |
| 431 | 3300027543 | Ga0209999_1048087 | Ga0209999_10480872 | 167 |
| 432 | 3300027665 | Ga0209983_1004666 | Ga0209983_10046663 | 167 |
| 433 | 3300027671 | Ga0209588_1038360 | Ga0209588_10383602 | 167 |
| 434 | 3300027671 | Ga0209588_1059161 | Ga0209588_10591613 | 167 |
| 435 | 3300027682 | Ga0209971_1005009 | Ga0209971_10050096 | 167 |
| 436 | 3300027907 | Ga0207428_10000321 | Ga0207428_1000032115 | 167 |
| 437 | 3300027907 | Ga0207428_10143837 | Ga0207428_101438371 | 167 |
| 438 | 3300027907 | Ga0207428_10186995 | Ga0207428_101869952 | 167 |
| 439 | 3300027907 | Ga0207428_10227654 | Ga0207428_102276543 | 167 |
| 440 | 3300028380 | Ga0268265_10000606 | Ga0268265_1000060614 | 167 |
| 441 | 3300028380 | Ga0268265_10003346 | Ga0268265_1000334611 | 167 |
| 442 | 3300028381 | Ga0268264_10001077 | Ga0268264_1000107722 | 167 |
| 443 | 3300028563 | Ga0265319_1070689 | Ga0265319_10706893 | 167 |
| 444 | 3300031548 | Ga0307408_101052881 | Ga0307408_1010528812 | 167 |
| 445 | 3300031731 | Ga0307405_10099321 | Ga0307405_100993214 | 167 |
| 446 | 3300031852 | Ga0307410_10376878 | Ga0307410_103768782 | 167 |
| 447 | 3300031903 | Ga0307407_10084363 | Ga0307407_100843633 | 167 |
| 448 | 3300031911 | Ga0307412_10684850 | Ga0307412_106848502 | 167 |
| 449 | 3300031995 | Ga0307409_100132774 | Ga0307409_1001327743 | 167 |
| 450 | 3300031995 | Ga0307409_100568179 | Ga0307409_1005681792 | 167 |
| 451 | 3300032002 | Ga0307416_100071393 | Ga0307416_1000713933 | 167 |
| 452 | 3300032002 | Ga0307416_100280683 | Ga0307416_1002806832 | 167 |
| 453 | 3300032002 | Ga0307416_100383105 | Ga0307416_1003831053 | 167 |
| 454 | 3300032002 | Ga0307416_100503155 | Ga0307416_1005031552 | 167 |
| 455 | 3300032005 | Ga0307411_10101431 | Ga0307411_101014313 | 167 |
| 456 | 3300034816 | Ga0373930_0051690 | Ga0373930_0051690_361_864 | 167 |
| 457 | 3300035084 | Ga0373928_0148833 | Ga0373928_0148833_13_516 | 167 |
| 458 | 3300035085 | Ga0373929_0014999 | Ga0373929_0014999_789_1292 | 167 |
| 459 | 3300035088 | Ga0373940_0002873 | Ga0373940_0002873_2316_2819 | 167 |
| 460 | 3300035090 | Ga0373949_0003576 | Ga0373949_0003576_378_881 | 167 |
| 461 | 3300035090 | Ga0373949_0102184 | Ga0373949_0102184_189_692 | 167 |
| 462 | 3300035091 | Ga0373951_0016244 | Ga0373951_0016244_761_1264 | 167 |
| 463 | 3300035111 | Ga0373923_0028281 | Ga0373923_0028281_1114_1620 | 167 |
| 464 | 3300035112 | Ga0373932_0005138 | Ga0373932_0005138_1808_2311 | 167 |
| 465 | 3300035112 | Ga0373932_0097928 | Ga0373932_0097928_31_534 | 167 |
| 466 | 3300035112 | Ga0373932_0127600 | Ga0373932_0127600_263_766 | 167 |
| 467 | 3300035118 | Ga0373954_0000002 | Ga0373954_0000002_68396_68902 | 167 |
| 468 | 3300035207 | Ga0373942_0001165 | Ga0373942_0001165_4799_5302 | 167 |
| 469 | 3300035242 | Ga0373962_0010615 | Ga0373962_0010615_667_1170 | 167 |
| 470 | 3300035242 | Ga0373962_0254173 | Ga0373962_0254173_74_577 | 167 |
| 471 | 3300035691 | Ga0373931_0000265 | Ga0373931_0000265_12894_13397 | 167 |
| 472 | 3300035691 | Ga0373931_0094753 | Ga0373931_0094753_248_751 | 167 |
| 473 | 3300035691 | Ga0373931_0134293 | Ga0373931_0134293_860_1363 | 167 |
| 474 | 3300035691 | Ga0373931_0146662 | Ga0373931_0146662_93_596 | 167 |
| 475 | 3300035692 | Ga0373935_0380151 | Ga0373935_0380151_230_736 | 167 |
| 476 | 3300035695 | Ga0373927_0174223 | Ga0373927_0174223_550_1056 | 167 |
| 477 | 3300035724 | Ga0373933_0014193 | Ga0373933_0014193_54_560 | 167 |
| 478 | 3300036401 | Ga0373937_0000358 | Ga0373937_0000358_30950_31456 | 167 |
| 479 | 3300036401 | Ga0373937_0004969 | Ga0373937_0004969_4102_4608 | 167 |
| 480 | 3300036401 | Ga0373937_0390596 | Ga0373937_0390596_245_751 | 167 |
| 481 | 3300041406 | Ga0439439_0145438 | Ga0439439_0145438_18_521 | 167 |
| 482 | 3300041408 | Ga0439453_0153332 | Ga0439453_0153332_14_517 | 167 |
| 483 | 3300042001 | Ga0439441_004715 | Ga0439441_004715_227_730 | 167 |
| 484 | 3300042003 | Ga0439443_000966 | Ga0439443_000966_2327_2830 | 167 |
| 485 | 3300042003 | Ga0439443_002476 | Ga0439443_002476_769_1272 | 167 |
| 486 | 3300042009 | Ga0439451_013492 | Ga0439451_013492_858_1361 | 167 |
| 487 | 3300042013 | Ga0439456_017801 | Ga0439456_017801_550_1053 | 167 |
| 488 | 3300042156 | Ga0439446_0000176 | Ga0439446_0000176_1113_1616 | 167 |
| 489 | 3300042435 | Ga0439434_0007165 | Ga0439434_0007165_190_693 | 167 |
| 490 | 3300042436 | Ga0439435_0000026 | Ga0439435_0000026_5247_5750 | 167 |
| 491 | 3300042436 | Ga0439435_0016067 | Ga0439435_0016067_113_616 | 167 |
| 492 | 3300042436 | Ga0439435_0059349 | Ga0439435_0059349_430_933 | 167 |
| 493 | 3300042437 | Ga0439444_0002697 | Ga0439444_0002697_618_1121 | 167 |
| 494 | 3300042461 | Ga0439460_0034783 | Ga0439460_0034783_569_1072 | 167 |
| 495 | 3300044694 | Ga0466963_0316332 | Ga0466963_0316332_312_818 | 167 |
| 496 | 3300044706 | Ga0466964_0138518 | Ga0466964_0138518_359_865 | 167 |
| 497 | 3300045051 | Ga0451576_0001306 | Ga0451576_0001306_7335_7838 | 167 |
| 498 | 3300045051 | Ga0451576_0050564 | Ga0451576_0050564_1877_2380 | 167 |
| 499 | 3300045051 | Ga0451576_0083471 | Ga0451576_0083471_944_1447 | 167 |
| 500 | 3300045051 | Ga0451576_0154227 | Ga0451576_0154227_1585_2091 | 167 |
| 501 | 3300045051 | Ga0451576_0374264 | Ga0451576_0374264_134_640 | 167 |
| 502 | 3300045051 | Ga0451576_0499109 | Ga0451576_0499109_507_1013 | 167 |
| 503 | 3300045051 | Ga0451576_1248460 | Ga0451576_1248460_106_612 | 167 |
| 504 | 3300045976 | Ga0466967_0006007 | Ga0466967_0006007_5452_5958 | 167 |
| 505 | 3300046454 | Ga0495592_0052225 | Ga0495592_0052225_1996_2502 | 167 |
| 506 | 3300046459 | Ga0495629_0044253 | Ga0495629_0044253_2388_2894 | 167 |
| 507 | 3300046461 | Ga0495641_0056653 | Ga0495641_0056653_47_553 | 167 |
| 508 | 3300046461 | Ga0495641_0138487 | Ga0495641_0138487_118_624 | 167 |
| 509 | 3300046475 | Ga0495639_0214158 | Ga0495639_0214158_148_654 | 167 |
| 510 | 3300046476 | Ga0495662_0014869 | Ga0495662_0014869_2000_2506 | 167 |
| 511 | 3300046511 | Ga0495608_0002044 | Ga0495608_0002044_5611_6117 | 167 |
| 512 | 3300046514 | Ga0495618_0015263 | Ga0495618_0015263_1364_1870 | 167 |
| 513 | 3300046516 | Ga0495628_0016487 | Ga0495628_0016487_5128_5634 | 167 |
| 514 | 3300046517 | Ga0495630_0001185 | Ga0495630_0001185_13935_14441 | 167 |
| 515 | 3300046517 | Ga0495630_0514081 | Ga0495630_0514081_282_788 | 167 |
| 516 | 3300046523 | Ga0495644_0110707 | Ga0495644_0110707_311_817 | 167 |
| 517 | 3300046529 | Ga0495652_0048101 | Ga0495652_0048101_887_1393 | 167 |
| 518 | 3300046533 | Ga0495640_0000808 | Ga0495640_0000808_19227_19733 | 167 |
| 519 | 3300046533 | Ga0495640_0004665 | Ga0495640_0004665_3425_3931 | 167 |
| 520 | 3300046535 | Ga0495586_0000440 | Ga0495586_0000440_17994_18500 | 167 |
| 521 | 3300046536 | Ga0495587_0009122 | Ga0495587_0009122_1281_1787 | 167 |
| 522 | 3300046539 | Ga0495621_0009090 | Ga0495621_0009090_713_1219 | 167 |
| 523 | 3300046539 | Ga0495621_0142048 | Ga0495621_0142048_241_744 | 167 |
| 524 | 3300046543 | Ga0495645_0069462 | Ga0495645_0069462_1853_2359 | 167 |
| 525 | 3300046559 | Ga0495667_0012758 | Ga0495667_0012758_1992_2498 | 167 |
| 526 | 3300046615 | Ga0495656_0015676 | Ga0495656_0015676_1647_2150 | 167 |
| 527 | 3300046615 | Ga0495656_0670449 | Ga0495656_0670449_30_536 | 167 |
| 528 | 3300046642 | Ga0495634_0002587 | Ga0495634_0002587_5417_5923 | 167 |
| 529 | 3300046663 | Ga0495635_0032744 | Ga0495635_0032744_434_940 | 167 |
| 530 | 3300046664 | Ga0495659_0134567 | Ga0495659_0134567_86_589 | 167 |
| 531 | 3300046675 | Ga0495657_0421692 | Ga0495657_0421692_144_650 | 167 |
| 532 | 3300046678 | Ga0495599_0037696 | Ga0495599_0037696_528_1034 | 167 |
| 533 | 3300046681 | Ga0495647_0100975 | Ga0495647_0100975_158_664 | 167 |
| 534 | 3300046683 | Ga0495658_0042024 | Ga0495658_0042024_989_1495 | 167 |
| 535 | 3300046684 | Ga0495669_0010255 | Ga0495669_0010255_3148_3654 | 167 |
| 536 | 3300046684 | Ga0495669_0118686 | Ga0495669_0118686_196_699 | 167 |
| 537 | 3300046684 | Ga0495669_0511337 | Ga0495669_0511337_60_563 | 167 |
| 538 | 3300046689 | Ga0495613_0008010 | Ga0495613_0008010_6210_6716 | 167 |
| 539 | 3300046690 | Ga0495624_0041706 | Ga0495624_0041706_1660_2166 | 167 |
| 540 | 3300046690 | Ga0495624_0150373 | Ga0495624_0150373_887_1393 | 167 |
| 541 | 3300046809 | Ga0495600_0180472 | Ga0495600_0180472_412_918 | 167 |
| 542 | 3300047315 | Ga0495581_0032165 | Ga0495581_0032165_823_1329 | 167 |
| 543 | 3300047317 | Ga0495604_0020749 | Ga0495604_0020749_185_691 | 167 |
| 544 | 3300047322 | Ga0495680_0001572 | Ga0495680_0001572_17549_18055 | 167 |
| 545 | 3300047444 | Ga0495675_0160223 | Ga0495675_0160223_754_1260 | 167 |
| 546 | 3300047471 | Ga0495684_0325172 | Ga0495684_0325172_346_852 | 167 |
| 547 | 3300047673 | Ga0495593_0035630 | Ga0495593_0035630_2085_2591 | 167 |
| 548 | 3300047673 | Ga0495593_0291004 | Ga0495593_0291004_182_688 | 167 |
| 549 | 3300049568 | Ga0501031_0281142 | Ga0501031_0281142_369_872 | 167 |
| 550 | 3300049571 | Ga0501034_1313174 | Ga0501034_1313174_26_529 | 167 |
| 551 | 3300049572 | Ga0501036_0240028 | Ga0501036_0240028_197_700 | 167 |
| 552 | 3300049573 | Ga0501037_0434195 | Ga0501037_0434195_288_791 | 167 |
| 553 | 3300049574 | Ga0501038_0026052 | Ga0501038_0026052_1968_2471 | 167 |
| 554 | 3300049574 | Ga0501038_0163832 | Ga0501038_0163832_1134_1640 | 167 |
| 555 | 3300049574 | Ga0501038_0209304 | Ga0501038_0209304_63_566 | 167 |
| 556 | 3300049575 | Ga0501039_0033647 | Ga0501039_0033647_2540_3043 | 167 |
| 557 | 3300049575 | Ga0501039_0107755 | Ga0501039_0107755_911_1417 | 167 |
| 558 | 3300049576 | Ga0501040_0057334 | Ga0501040_0057334_1254_1757 | 167 |
| 559 | 3300049576 | Ga0501040_0169556 | Ga0501040_0169556_417_920 | 167 |
| 560 | 3300049576 | Ga0501040_0179156 | Ga0501040_0179156_209_715 | 167 |
| 561 | 3300049576 | Ga0501040_0207824 | Ga0501040_0207824_596_1099 | 167 |
| 562 | 3300049577 | Ga0501041_0089018 | Ga0501041_0089018_403_906 | 167 |
| 563 | 3300049578 | Ga0501042_0071336 | Ga0501042_0071336_104_607 | 167 |
| 564 | 3300049578 | Ga0501042_0333659 | Ga0501042_0333659_417_920 | 167 |
| 565 | 3300049580 | Ga0501046_0144016 | Ga0501046_0144016_106_612 | 167 |
| 566 | 3300049582 | Ga0501048_0033104 | Ga0501048_0033104_2255_2758 | 167 |
| 567 | 3300049582 | Ga0501048_0164154 | Ga0501048_0164154_914_1417 | 167 |
| 568 | 3300049583 | Ga0501067_0609724 | Ga0501067_0609724_85_591 | 167 |
| 569 | 3300049588 | Ga0501072_0000916 | Ga0501072_0000916_1183_1686 | 167 |
| 570 | 3300049588 | Ga0501072_0322035 | Ga0501072_0322035_618_1121 | 167 |
| 571 | 3300049588 | Ga0501072_0441118 | Ga0501072_0441118_431_934 | 167 |
| 572 | 3300049589 | Ga0501073_0390208 | Ga0501073_0390208_360_863 | 167 |
| 573 | 3300049590 | Ga0501074_0574959 | Ga0501074_0574959_39_542 | 167 |
| 574 | 3300049591 | Ga0501075_0032941 | Ga0501075_0032941_619_1122 | 167 |
| 575 | 3300049591 | Ga0501075_0052302 | Ga0501075_0052302_101_604 | 167 |
| 576 | 3300049591 | Ga0501075_0589920 | Ga0501075_0589920_43_549 | 167 |
| 577 | 3300049592 | Ga0501076_0002030 | Ga0501076_0002030_7829_8332 | 167 |
| 578 | 3300049592 | Ga0501076_0047154 | Ga0501076_0047154_2084_2587 | 167 |
| 579 | 3300049592 | Ga0501076_0572794 | Ga0501076_0572794_205_711 | 167 |
| 580 | 3300049593 | Ga0501077_0034711 | Ga0501077_0034711_410_913 | 167 |
| 581 | 3300049679 | Ga0501249_172826 | Ga0501249_172826_21_527 | 167 |
| 582 | 3300049741 | Ga0501079_0003830 | Ga0501079_0003830_4949_5452 | 167 |
| 583 | 3300049741 | Ga0501079_0644690 | Ga0501079_0644690_81_584 | 167 |
| 584 | 3300049741 | Ga0501079_1132980 | Ga0501079_1132980_37_540 | 167 |
| 585 | 3300049742 | Ga0501080_0022120 | Ga0501080_0022120_1777_2280 | 167 |
| 586 | 3300049743 | Ga0501081_0012653 | Ga0501081_0012653_4927_5430 | 167 |
| 587 | 3300049743 | Ga0501081_0359301 | Ga0501081_0359301_195_698 | 167 |
| 588 | 3300049824 | Ga0501045_0012092 | Ga0501045_0012092_3031_3534 | 167 |
| 589 | 3300050507 | nmdc:mga05p37_132_c1 | nmdc:mga05p37_132_c1_4878_5381 | 167 |
| 590 | 3300050507 | nmdc:mga05p37_434447_c1 | nmdc:mga05p37_434447_c1_669_1175 | 167 |
| 591 | 3300050507 | nmdc:mga05p37_99251_c1 | nmdc:mga05p37_99251_c1_2548_3054 | 167 |
| 592 | 3300050508 | nmdc:mga09592_129332_c1 | nmdc:mga09592_129332_c1_310_816 | 167 |
| 593 | 3300050508 | nmdc:mga09592_22875_c1 | nmdc:mga09592_22875_c1_3858_4361 | 167 |
| 594 | 3300050508 | nmdc:mga09592_418_c1 | nmdc:mga09592_418_c1_1087_1590 | 167 |
| 595 | 3300050508 | nmdc:mga09592_48397_c1 | nmdc:mga09592_48397_c1_305_811 | 167 |
| 596 | 3300050508 | nmdc:mga09592_489508_c1 | nmdc:mga09592_489508_c1_322_825 | 167 |
| 597 | 3300050509 | nmdc:mga0qj67_143086_c1 | nmdc:mga0qj67_143086_c1_1099_1602 | 167 |
| 598 | 3300050509 | nmdc:mga0qj67_54911_c1 | nmdc:mga0qj67_54911_c1_2289_2792 | 167 |
| 599 | 3300050509 | nmdc:mga0qj67_623_c1 | nmdc:mga0qj67_623_c1_16773_17276 | 167 |
| 600 | 3300050509 | nmdc:mga0qj67_68746_c1 | nmdc:mga0qj67_68746_c1_2145_2648 | 167 |
| 601 | 3300050510 | nmdc:mga06r32_146111_c1 | nmdc:mga06r32_146111_c1_1121_1624 | 167 |
| 602 | 3300050510 | nmdc:mga06r32_146596_c1 | nmdc:mga06r32_146596_c1_485_988 | 167 |
| 603 | 3300050510 | nmdc:mga06r32_242023_c1 | nmdc:mga06r32_242023_c1_678_1181 | 167 |
| 604 | 3300050510 | nmdc:mga06r32_260547_c1 | nmdc:mga06r32_260547_c1_442_945 | 167 |
| 605 | 3300050511 | nmdc:mga08y16_109514_c1 | nmdc:mga08y16_109514_c1_1523_2029 | 167 |
| 606 | 3300050511 | nmdc:mga08y16_2590_c1 | nmdc:mga08y16_2590_c1_17156_17659 | 167 |
| 607 | 3300050511 | nmdc:mga08y16_281371_c1 | nmdc:mga08y16_281371_c1_618_1124 | 167 |
| 608 | 3300050511 | nmdc:mga08y16_353000_c1 | nmdc:mga08y16_353000_c1_834_1340 | 167 |
| 609 | 3300050511 | nmdc:mga08y16_37817_c1 | nmdc:mga08y16_37817_c1_4379_4885 | 167 |
| 610 | 3300050511 | nmdc:mga08y16_382460_c1 | nmdc:mga08y16_382460_c1_24_527 | 167 |
| 611 | 3300050511 | nmdc:mga08y16_773622_c1 | nmdc:mga08y16_773622_c1_129_632 | 167 |
| 612 | 3300050512 | nmdc:mga0n895_1401573_c1 | nmdc:mga0n895_1401573_c1_33_539 | 167 |
| 613 | 3300050512 | nmdc:mga0n895_260541_c1 | nmdc:mga0n895_260541_c1_227_733 | 167 |
| 614 | 3300050512 | nmdc:mga0n895_38225_c1 | nmdc:mga0n895_38225_c1_2036_2542 | 167 |
| 615 | 3300050512 | nmdc:mga0n895_4259_c1 | nmdc:mga0n895_4259_c1_8040_8543 | 167 |
| 616 | 3300050512 | nmdc:mga0n895_456_c1 | nmdc:mga0n895_456_c1_25158_25664 | 167 |
| 617 | 3300050513 | nmdc:mga0rr50_16225_c1 | nmdc:mga0rr50_16225_c1_3414_3920 | 167 |
| 618 | 3300050513 | nmdc:mga0rr50_165651_c1 | nmdc:mga0rr50_165651_c1_851_1354 | 167 |
| 619 | 3300050513 | nmdc:mga0rr50_25229_c1 | nmdc:mga0rr50_25229_c1_1411_1917 | 167 |
| 620 | 3300050513 | nmdc:mga0rr50_30285_c1 | nmdc:mga0rr50_30285_c1_3162_3665 | 167 |
| 621 | 3300050513 | nmdc:mga0rr50_397861_c1 | nmdc:mga0rr50_397861_c1_429_932 | 167 |
| 622 | 3300050513 | nmdc:mga0rr50_949778_c1 | nmdc:mga0rr50_949778_c1_35_541 | 167 |
| 623 | 3300050514 | nmdc:mga08x19_108272_c1 | nmdc:mga08x19_108272_c1_282_788 | 167 |
| 624 | 3300050514 | nmdc:mga08x19_18431_c1 | nmdc:mga08x19_18431_c1_2051_2554 | 167 |
| 625 | 3300050514 | nmdc:mga08x19_2829_c1 | nmdc:mga08x19_2829_c1_2553_3056 | 167 |
| 626 | 3300050514 | nmdc:mga08x19_382528_c1 | nmdc:mga08x19_382528_c1_86_592 | 167 |
| 627 | 3300050514 | nmdc:mga08x19_55_c1 | nmdc:mga08x19_55_c1_78526_79032 | 167 |
| 628 | 3300050514 | nmdc:mga08x19_6047_c1 | nmdc:mga08x19_6047_c1_2341_2847 | 167 |
| 629 | 3300050515 | nmdc:mga0a205_1791_c1 | nmdc:mga0a205_1791_c1_2576_3079 | 167 |
| 630 | 3300050515 | nmdc:mga0a205_774829_c1 | nmdc:mga0a205_774829_c1_107_613 | 167 |
| 631 | 3300050515 | nmdc:mga0a205_783686_c1 | nmdc:mga0a205_783686_c1_246_749 | 167 |
| 632 | 3300050515 | nmdc:mga0a205_97943_c1 | nmdc:mga0a205_97943_c1_511_1014 | 167 |
| 633 | 3300053077 | Ga0495601_0020352 | Ga0495601_0020352_778_1284 | 167 |
| 634 | 3300053085 | Ga0495619_0212455 | Ga0495619_0212455_185_691 | 167 |
| 635 | 3300053094 | Ga0500566_0149637 | Ga0500566_0149637_374_880 | 167 |
| 636 | 3300054114 | Ga0501084_0015022 | Ga0501084_0015022_561_1064 | 167 |
| 637 | 3300054114 | Ga0501084_0115264 | Ga0501084_0115264_1587_2090 | 167 |
| 638 | 3300059421 | Ga0590071_092498 | Ga0590071_092498_116_619 | 167 |
| 639 | 3300060353 | Ga0501082_0105770 | Ga0501082_0105770_431_934 | 167 |
| 640 | 3300060353 | Ga0501082_0531014 | Ga0501082_0531014_278_781 | 167 |
| 641 | 3300061734 | Ga0530510_0005015 | Ga0530510_0005015_6945_7448 | 167 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vdm-assembly1.cif.gz_C | crystal structure of purine phosphoribosyltransferase from pyrococcus horikoshii ot3 | 0.8693 | 7 | 140 |
| 4qri-assembly1.cif.gz_B | 2.35 angstrom resolution crystal structure of hypoxanthine-guanine-xanthine phosphoribosyltransferase from leptospira interrogans serovar copenhageni str. fiocruz l1-130 | 0.856 | 6 | 139 |
| 4qri-assembly1.cif.gz_A | 2.35 angstrom resolution crystal structure of hypoxanthine-guanine-xanthine phosphoribosyltransferase from leptospira interrogans serovar copenhageni str. fiocruz l1-130 | 0.8518 | 6 | 139 |
| 1vdm-assembly1.cif.gz_K | crystal structure of purine phosphoribosyltransferase from pyrococcus horikoshii ot3 | 0.8508 | 7 | 139 |
| 4p81-assembly1.cif.gz_C | structure of ancestral pyrr protein (ancorangepyrr) | 0.8492 | 3 | 163 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4qriB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.856 | 6 | 139 | 3.40.50.2020 |
| af_P9WHK3_1_193_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8418 | 1 | 162 | 3.40.50.2020 |
| 3acdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8189 | 6 | 141 | 3.40.50.2020 |
| af_P9WHK3_1_193_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8142 | 1 | 162 | 3.40.50.2020 |
| 4p83D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8139 | 1 | 164 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A259DAR2-F1-model_v4 | Phosphoribosyltransferase domain-containing protein | 0.9668 | 75 | 164 |
|
| AF-A0A1H3JWM0-F1-model_v4 | Pyrimidine operon attenuation protein / uracil phosphoribosyltransferase | 0.9552 | 1 | 163 |
GO:0016757
|
| AF-A0A2R5EFG8-F1-model_v4 | Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase | 0.9403 | 2 | 167 |
GO:0016757
|
| AF-A0A1E7YRI3-F1-model_v4 | Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase | 0.9369 | 2 | 143 |
GO:0016757
|
| AF-A0A2R5EFG8-F1-model_v4 | Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase | 0.9295 | 2 | 167 |
GO:0016757
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar