F471790

General Info

Members Datasets Scaffolds Average Seq Length
641 280 641 167

Family's Representative Sequence

Representative Sequence 3300025923|Ga0207681_10418203|Ga0207681_104182032
Length 199
Sequence MRRTVLAGVLAVLSVAVMAQTQGAKPIDYETYCKLPDAEALCEQLAAELRPRIGPKSAMVGLYTGGAWLAERLHSTLGLSTPLALMDIAFYRDDYAARGLKHDPKRTKIPFDVNGAELLLVDDVLYSGRTVRAAMNELFDYGRPASIALVVLADRGGRQLPICAQHVGARVQVPAGMRLTLQRADSGKLALALESERAA

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
147 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
156 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
157 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
158 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
159 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
160 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
161 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
173 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
174 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
183 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
184 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
185 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
186 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
187 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
188 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
189 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
190 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
191 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
192 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
220 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
234 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
257 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 0
Rhizosphere 99.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1021905 3300002074 Bacteria 773
2 Ga0070690_100000197 3300005330 Bacteria 31360
3 Ga0070690_100117645 3300005330 Bacteria 1781
4 Ga0070690_100254176 3300005330 Bacteria 1244
5 Ga0070677_10111340 3300005333 Bacteria 1223
6 Ga0068869_100000214 3300005334 Bacteria 30165
7 Ga0068869_101008834 3300005334 Bacteria 725
8 Ga0070666_10090292 3300005335 Bacteria 2104
9 Ga0070680_100001218 3300005336 Bacteria 18539
10 Ga0070680_100107816 3300005336 Bacteria 2317
11 Ga0070680_100516319 3300005336 Bacteria 1023
12 Ga0070682_100003738 3300005337 Bacteria 8463
13 Ga0068868_100000458 3300005338 Bacteria 27113
14 Ga0070689_100000107 3300005340 Bacteria 48084
15 Ga0070689_100829217 3300005340 Bacteria 815
16 Ga0070691_10000220 3300005341 Bacteria 19309
17 Ga0070687_100000034 3300005343 Bacteria 43229
18 Ga0070687_100193904 3300005343 Bacteria 1226
19 Ga0070687_100861811 3300005343 Bacteria 646
20 Ga0070692_10010201 3300005345 Bacteria 4266
21 Ga0070692_10320122 3300005345 Bacteria 953
22 Ga0070668_100003178 3300005347 Bacteria 12109
23 Ga0070669_100003861 3300005353 Bacteria 10828
24 Ga0070669_100519539 3300005353 Bacteria 990
25 Ga0070669_100854172 3300005353 Bacteria 776
26 Ga0070674_100078762 3300005356 Bacteria 2349
27 Ga0070674_100349867 3300005356 Bacteria 1193
28 Ga0070688_100391486 3300005365 Bacteria 1027
29 Ga0070688_100650146 3300005365 Bacteria 812
30 Ga0070667_100237976 3300005367 Bacteria 1625
31 Ga0070703_10003454 3300005406 Bacteria 4505
32 Ga0070703_10222099 3300005406 Bacteria 753
33 Ga0070709_10797513 3300005434 Bacteria 741
34 Ga0070714_100691684 3300005435 Bacteria 983
35 Ga0070713_100205276 3300005436 Bacteria 1781
36 Ga0070710_10160420 3300005437 Bacteria 1394
37 Ga0070701_10000396 3300005438 Bacteria 14677
38 Ga0070701_10477794 3300005438 Bacteria 805
39 Ga0070701_10492074 3300005438 Bacteria 795
40 Ga0070711_100295613 3300005439 Bacteria 1286
41 Ga0070705_100000582 3300005440 Bacteria 21229
42 Ga0070705_100009501 3300005440 Bacteria 4836
43 Ga0070705_100132366 3300005440 Bacteria 1629
44 Ga0070705_100188517 3300005440 Bacteria 1403
45 Ga0070705_100226806 3300005440 Bacteria 1297
46 Ga0070700_100000344 3300005441 Bacteria 23968
47 Ga0070700_100000633 3300005441 Bacteria 17458
48 Ga0070700_100614442 3300005441 Bacteria 853
49 Ga0070694_100000126 3300005444 Bacteria 37932
50 Ga0070694_100017597 3300005444 Bacteria 4519
51 Ga0070694_100023240 3300005444 Bacteria 3984
52 Ga0070694_100259542 3300005444 Bacteria 1317
53 Ga0070694_100488916 3300005444 Bacteria 978
54 Ga0070694_100680795 3300005444 Bacteria 835
55 Ga0070708_100173223 3300005445 Bacteria 2016
56 Ga0070708_100557224 3300005445 Bacteria 1081
57 Ga0070681_10000399 3300005458 Bacteria 35221
58 Ga0070681_10047332 3300005458 Bacteria 4299
59 Ga0068867_100000032 3300005459 Bacteria 84727
60 Ga0068867_100001769 3300005459 Bacteria 15035
61 Ga0068867_100674356 3300005459 Bacteria 909
62 Ga0070707_100357333 3300005468 Bacteria 1419
63 Ga0070707_100495725 3300005468 Bacteria 1183
64 Ga0070698_100012901 3300005471 Bacteria 8849
65 Ga0070698_100378584 3300005471 Bacteria 1348
66 Ga0070698_100549999 3300005471 Bacteria 1094
67 Ga0070699_100272627 3300005518 Bacteria 1515
68 Ga0070699_101223804 3300005518 Bacteria 689
69 Ga0070679_100017314 3300005530 Bacteria 6975
70 Ga0070679_100030836 3300005530 Bacteria 5298
71 Ga0070684_100013383 3300005535 Bacteria 6613
72 Ga0070697_100000731 3300005536 Bacteria 24504
73 Ga0070672_101009374 3300005543 Bacteria 737
74 Ga0070686_100000253 3300005544 Bacteria 36736
75 Ga0070686_100178402 3300005544 Bacteria 1507
76 Ga0070686_100185800 3300005544 Bacteria 1480
77 Ga0070686_100203895 3300005544 Bacteria 1419
78 Ga0070686_100426217 3300005544 Bacteria 1015
79 Ga0070686_100499257 3300005544 Bacteria 944
80 Ga0070695_100000197 3300005545 Bacteria 29394
81 Ga0070695_100094784 3300005545 Bacteria 1999
82 Ga0070695_100183594 3300005545 Bacteria 1484
83 Ga0070695_100774624 3300005545 Bacteria 767
84 Ga0070695_100839412 3300005545 Bacteria 739
85 Ga0070696_100000089 3300005546 Bacteria 44686
86 Ga0070696_100000482 3300005546 Bacteria 25020
87 Ga0070696_100090748 3300005546 Bacteria 2174
88 Ga0070696_100277419 3300005546 Bacteria 1277
89 Ga0070696_100572358 3300005546 Bacteria 908
90 Ga0070696_101412965 3300005546 Bacteria 594
91 Ga0070693_100000400 3300005547 Bacteria 19703
92 Ga0070693_100116800 3300005547 Bacteria 1650
93 Ga0070693_100157932 3300005547 Bacteria 1442
94 Ga0070693_100287804 3300005547 Bacteria 1103
95 Ga0070693_100613918 3300005547 Bacteria 787
96 Ga0070693_101172963 3300005547 Bacteria 589
97 Ga0070704_100000017 3300005549 Bacteria 57626
98 Ga0070704_100001327 3300005549 Bacteria 13101
99 Ga0070704_100012457 3300005549 Bacteria 5255
100 Ga0070704_100041897 3300005549 Bacteria 3163
101 Ga0070704_100468739 3300005549 Bacteria 1088
102 Ga0070704_100618204 3300005549 Bacteria 954
103 Ga0070704_100643329 3300005549 Bacteria 935
104 Ga0070704_101014919 3300005549 Bacteria 751
105 Ga0070704_101052032 3300005549 Bacteria 738
106 Ga0068855_100002377 3300005563 Bacteria 23195
107 Ga0068857_100480110 3300005577 Bacteria 1165
108 Ga0068854_100004305 3300005578 Bacteria 8966
109 Ga0068856_100020620 3300005614 Bacteria 6404
110 Ga0068856_100574738 3300005614 Bacteria 1148
111 Ga0068856_100699952 3300005614 Bacteria 1034
112 Ga0070702_100000001 3300005615 Bacteria 87224
113 Ga0070702_100298111 3300005615 Bacteria 1114
114 Ga0068859_100000149 3300005617 Bacteria 66296
115 Ga0068859_100089998 3300005617 Bacteria 3119
116 Ga0068859_100185203 3300005617 Bacteria 2166
117 Ga0068859_102348448 3300005617 Bacteria 588
118 Ga0068864_100009007 3300005618 Bacteria 8230
119 Ga0068866_10000326 3300005718 Bacteria 22539
120 Ga0068866_10593364 3300005718 Bacteria 747
121 Ga0068861_100002365 3300005719 Bacteria 12274
122 Ga0068861_100016010 3300005719 Bacteria 5295
123 Ga0068870_10009444 3300005840 Bacteria 4437
124 Ga0068870_10102497 3300005840 Bacteria 1620
125 Ga0068870_10135645 3300005840 Bacteria 1435
126 Ga0068863_100252789 3300005841 Bacteria 1703
127 Ga0068863_101417311 3300005841 Bacteria 703
128 Ga0068858_100002902 3300005842 Bacteria 17243
129 Ga0068858_100195287 3300005842 Bacteria 1912
130 Ga0068858_100340710 3300005842 Bacteria 1435
131 Ga0068860_100001090 3300005843 Bacteria 29921
132 Ga0068862_100000409 3300005844 Bacteria 46422
133 Ga0068862_100001785 3300005844 Bacteria 19458
134 Ga0068862_100493025 3300005844 Bacteria 1161
135 Ga0068862_100574832 3300005844 Bacteria 1079
136 Ga0081538_10081944 3300005981 Bacteria 1714
137 Ga0081539_10000686 3300005985 Bacteria 67858
138 Ga0070716_100092106 3300006173 Bacteria 1837
139 Ga0097621_100000928 3300006237 Bacteria 20529
140 Ga0097621_100002033 3300006237 Bacteria 13846
141 Ga0068871_100003069 3300006358 Bacteria 11453
142 Ga0068871_100029846 3300006358 Bacteria 4287
143 Ga0075428_100000083 3300006844 Bacteria 78689
144 Ga0075428_100037796 3300006844 Bacteria 5312
145 Ga0075428_100108390 3300006844 Bacteria 3027
146 Ga0075428_100359340 3300006844 Bacteria 1562
147 Ga0075428_100842720 3300006844 Bacteria 974
148 Ga0075430_100000550 3300006846 Bacteria 28484
149 Ga0075430_100008422 3300006846 Bacteria 8711
150 Ga0075430_100057331 3300006846 Bacteria 3277
151 Ga0075430_100058656 3300006846 Bacteria 3236
152 Ga0075430_100159593 3300006846 Bacteria 1877
153 Ga0075431_100005396 3300006847 Bacteria 12626
154 Ga0075431_100043616 3300006847 Bacteria 4626
155 Ga0075431_100066496 3300006847 Bacteria 3722
156 Ga0075431_100153977 3300006847 Bacteria 2366
157 Ga0075431_100841843 3300006847 Bacteria 889
158 Ga0075433_10007789 3300006852 Bacteria 8513
159 Ga0075433_10921675 3300006852 Bacteria 762
160 Ga0075433_10947210 3300006852 Bacteria 751
161 Ga0075434_100007734 3300006871 Bacteria 9953
162 Ga0075434_100115383 3300006871 Bacteria 2698
163 Ga0075434_101348149 3300006871 Bacteria 724
164 Ga0075434_101696308 3300006871 Bacteria 640
165 Ga0075429_100000480 3300006880 Bacteria 29845
166 Ga0075429_100000511 3300006880 Bacteria 29379
167 Ga0075429_100097034 3300006880 Bacteria 2571
168 Ga0075429_100142665 3300006880 Bacteria 2097
169 Ga0075429_100547037 3300006880 Bacteria 1015
170 Ga0068865_100000059 3300006881 Bacteria 58856
171 Ga0068865_100243839 3300006881 Bacteria 1415
172 Ga0075436_100003220 3300006914 Bacteria 11194
173 Ga0075436_100015702 3300006914 Bacteria 5184
174 Ga0075436_100064795 3300006914 Bacteria 2526
175 Ga0075436_100072353 3300006914 Bacteria 2385
176 Ga0097620_100000149 3300006931 Bacteria 66296
177 Ga0097620_100089997 3300006931 Bacteria 3119
178 Ga0097620_100185211 3300006931 Bacteria 2166
179 Ga0097620_102347883 3300006931 Bacteria 588
180 Ga0075435_100000388 3300007076 Bacteria 26867
181 Ga0075435_100002470 3300007076 Bacteria 12289
182 Ga0075435_100003004 3300007076 Bacteria 11355
183 Ga0075435_100088050 3300007076 Bacteria 2559
184 Ga0075435_100095285 3300007076 Bacteria 2461
185 Ga0075435_100371528 3300007076 Bacteria 1228
186 Ga0099794_10003748 3300007265 Bacteria 5854
187 Ga0099794_10292604 3300007265 Bacteria 843
188 Ga0111539_10013382 3300009094 Bacteria 10256
189 Ga0111539_10022182 3300009094 Bacteria 7805
190 Ga0111539_10053780 3300009094 Bacteria 4793
191 Ga0111539_10082706 3300009094 Bacteria 3776
192 Ga0111539_10369811 3300009094 Bacteria 1669
193 Ga0111539_10480652 3300009094 Bacteria 1447
194 Ga0111539_10535706 3300009094 Bacteria 1364
195 Ga0111539_12309540 3300009094 Bacteria 624
196 Ga0105245_10000075 3300009098 Bacteria 103550
197 Ga0105245_10174584 3300009098 Bacteria 2049
198 Ga0114129_10000210 3300009147 Bacteria 65476
199 Ga0114129_10002670 3300009147 Bacteria 24825
200 Ga0114129_10754917 3300009147 Bacteria 1245
201 Ga0114129_10990843 3300009147 Bacteria 1059
202 Ga0105243_10000622 3300009148 Bacteria 35310
203 Ga0105243_10719528 3300009148 Bacteria 975
204 Ga0105241_10012163 3300009174 Bacteria 6318
205 Ga0105242_10000407 3300009176 Bacteria 34281
206 Ga0105242_10001782 3300009176 Bacteria 16996
207 Ga0105248_10165967 3300009177 Bacteria 2489
208 Ga0105248_10255442 3300009177 Bacteria 1973
209 Ga0105248_10546246 3300009177 Bacteria 1307
210 Ga0105238_10842562 3300009551 Bacteria 934
211 Ga0105249_10007167 3300009553 Bacteria 9737
212 Ga0105249_10039524 3300009553 Bacteria 4284
213 Ga0105249_11767283 3300009553 Bacteria 691
214 Ga0105239_10157884 3300010375 Bacteria 2534
215 Ga0157378_10000074 3300013297 Bacteria 90608
216 Ga0163162_10129351 3300013306 Bacteria 2633
217 Ga0163162_10285360 3300013306 Bacteria 1783
218 Ga0157372_10260338 3300013307 Bacteria 2014
219 Ga0157375_10509511 3300013308 Bacteria 1367
220 Ga0157375_11811274 3300013308 Bacteria 724
221 Ga0157377_10854859 3300014745 Bacteria 676
222 Ga0157376_10059407 3300014969 Bacteria 3206
223 Ga0157376_10143622 3300014969 Bacteria 2144
224 Ga0157376_11303303 3300014969 Bacteria 756
225 Ga0207653_10022249 3300025885 Bacteria 2014
226 Ga0207653_10193672 3300025885 Bacteria 764
227 Ga0207682_10031631 3300025893 Bacteria 2125
228 Ga0207692_10036509 3300025898 Bacteria 2397
229 Ga0207642_10001898 3300025899 Bacteria 6445
230 Ga0207680_10218904 3300025903 Bacteria 1304
231 Ga0207685_10267975 3300025905 Bacteria 833
232 Ga0207645_10078625 3300025907 Bacteria 2114
233 Ga0207643_10407301 3300025908 Bacteria 860
234 Ga0207643_10551299 3300025908 Bacteria 740
235 Ga0207654_10010687 3300025911 Bacteria 4675
236 Ga0207707_10003163 3300025912 Bacteria 14617
237 Ga0207707_10229933 3300025912 Bacteria 1614
238 Ga0207663_10105889 3300025916 Bacteria 1899
239 Ga0207663_10700876 3300025916 Bacteria 802
240 Ga0207660_10003510 3300025917 Bacteria 10214
241 Ga0207660_10051463 3300025917 Bacteria 2928
242 Ga0207660_10141579 3300025917 Bacteria 1839
243 Ga0207660_10229094 3300025917 Bacteria 1460
244 Ga0207660_10249364 3300025917 Bacteria 1401
245 Ga0207662_10000166 3300025918 Bacteria 31376
246 Ga0207662_10018412 3300025918 Bacteria 3963
247 Ga0207662_10039563 3300025918 Bacteria 2767
248 Ga0207662_10247552 3300025918 Bacteria 1169
249 Ga0207662_10282464 3300025918 Bacteria 1099
250 Ga0207662_10468186 3300025918 Bacteria 864
251 Ga0207662_10604257 3300025918 Bacteria 763
252 Ga0207652_10010844 3300025921 Bacteria 7344
253 Ga0207652_10195092 3300025921 Bacteria 1821
254 Ga0207652_10676459 3300025921 Bacteria 922
255 Ga0207646_10228935 3300025922 Bacteria 1679
256 Ga0207646_10433105 3300025922 Bacteria 1187
257 Ga0207646_10804596 3300025922 Bacteria 837
258 Ga0207681_10000542 3300025923 Bacteria 25991
259 Ga0207681_10418203 3300025923 Bacteria 1086
260 Ga0207650_10959241 3300025925 Bacteria 727
261 Ga0207687_10118425 3300025927 Bacteria 1977
262 Ga0207686_10000243 3300025934 Bacteria 41698
263 Ga0207686_10029433 3300025934 Bacteria 3239
264 Ga0207709_10001387 3300025935 Bacteria 16961
265 Ga0207709_10004987 3300025935 Bacteria 7592
266 Ga0207670_10006628 3300025936 Bacteria 6436
267 Ga0207670_10008142 3300025936 Bacteria 5900
268 Ga0207669_10041596 3300025937 Bacteria 2676
269 Ga0207669_10616964 3300025937 Bacteria 883
270 Ga0207704_10000178 3300025938 Bacteria 33463
271 Ga0207704_10001089 3300025938 Bacteria 12062
272 Ga0207704_10087833 3300025938 Bacteria 2032
273 Ga0207704_10744078 3300025938 Bacteria 815
274 Ga0207691_10479201 3300025940 Bacteria 1057
275 Ga0207711_10151250 3300025941 Bacteria 2094
276 Ga0207711_10277589 3300025941 Bacteria 1543
277 Ga0207689_10000007 3300025942 Bacteria 132362
278 Ga0207689_10205501 3300025942 Bacteria 1626
279 Ga0207661_10242755 3300025944 Bacteria 1599
280 Ga0207667_10019325 3300025949 Bacteria 7609
281 Ga0207651_10229189 3300025960 Bacteria 1507
282 Ga0207712_10002821 3300025961 Bacteria 11132
283 Ga0207712_10020951 3300025961 Bacteria 4288
284 Ga0207712_10117131 3300025961 Bacteria 2009
285 Ga0207668_10031833 3300025972 Bacteria 3479
286 Ga0207640_10014310 3300025981 Bacteria 4564
287 Ga0207658_10226027 3300025986 Bacteria 1577
288 Ga0207677_10000823 3300026023 Bacteria 17732
289 Ga0207677_10911426 3300026023 Bacteria 793
290 Ga0207703_10005057 3300026035 Bacteria 10678
291 Ga0207703_10015309 3300026035 Bacteria 5983
292 Ga0207708_10000086 3300026075 Bacteria 73314
293 Ga0207708_10003576 3300026075 Bacteria 11462
294 Ga0207708_10177507 3300026075 Bacteria 1690
295 Ga0207708_10940309 3300026075 Bacteria 749
296 Ga0207702_10017742 3300026078 Bacteria 5891
297 Ga0207702_10073736 3300026078 Bacteria 2944
298 Ga0207702_10554990 3300026078 Bacteria 1124
299 Ga0207641_10173891 3300026088 Bacteria 1968
300 Ga0207641_10202721 3300026088 Bacteria 1830
301 Ga0207641_10260338 3300026088 Bacteria 1624
302 Ga0207648_10000079 3300026089 Bacteria 92044
303 Ga0207648_10000352 3300026089 Bacteria 50550
304 Ga0207648_10789803 3300026089 Bacteria 883
305 Ga0207648_11297609 3300026089 Bacteria 684
306 Ga0207676_10036447 3300026095 Bacteria 3742
307 Ga0207674_10040257 3300026116 Bacteria 4842
308 Ga0207675_100000093 3300026118 Bacteria 70343
309 Ga0207675_100000802 3300026118 Bacteria 31217
310 Ga0207675_101152338 3300026118 Bacteria 795
311 Ga0207698_10010533 3300026142 Bacteria 5951
312 Ga0209969_1014562 3300027360 Bacteria 1146
313 Ga0209981_1005263 3300027378 Bacteria 1715
314 Ga0209981_1006180 3300027378 Bacteria 1599
315 Ga0210000_1006568 3300027462 Bacteria 1694
316 Ga0210000_1021175 3300027462 Bacteria 994
317 Ga0209968_1004440 3300027526 Bacteria 2107
318 Ga0209999_1048087 3300027543 Bacteria 804
319 Ga0209983_1004666 3300027665 Bacteria 2870
320 Ga0209588_1038360 3300027671 Bacteria 1543
321 Ga0209588_1059161 3300027671 Bacteria 1239
322 Ga0209971_1005009 3300027682 Bacteria 3147
323 Ga0209966_1004025 3300027695 Bacteria 2480
324 Ga0207428_10000321 3300027907 Bacteria 62664
325 Ga0207428_10143837 3300027907 Bacteria 1818
326 Ga0207428_10186995 3300027907 Bacteria 1562
327 Ga0207428_10227654 3300027907 Bacteria 1396
328 Ga0207428_10288770 3300027907 Bacteria 1216
329 Ga0207428_10306886 3300027907 Bacteria 1174
330 Ga0268265_10000606 3300028380 Bacteria 35982
331 Ga0268265_10003346 3300028380 Bacteria 11597
332 Ga0268265_10922099 3300028380 Bacteria 859
333 Ga0268264_10001077 3300028381 Bacteria 27026
334 Ga0265319_1070689 3300028563 Bacteria 1119
335 Ga0307408_101052881 3300031548 Bacteria 752
336 Ga0316575_10009032 3300031665 Bacteria 3643
337 Ga0316578_10036076 3300031728 Bacteria 2845
338 Ga0307405_10099321 3300031731 Bacteria 1948
339 Ga0307410_10376878 3300031852 Bacteria 1141
340 Ga0307407_10084363 3300031903 Bacteria 1930
341 Ga0307412_10684850 3300031911 Bacteria 878
342 Ga0307409_100132774 3300031995 Bacteria 2131
343 Ga0307409_100568179 3300031995 Bacteria 1116
344 Ga0307409_101146005 3300031995 Bacteria 800
345 Ga0307416_100071393 3300032002 Bacteria 2884
346 Ga0307416_100280683 3300032002 Bacteria 1642
347 Ga0307416_100383105 3300032002 Bacteria 1437
348 Ga0307416_100503155 3300032002 Bacteria 1276
349 Ga0307416_101045929 3300032002 Bacteria 920
350 Ga0307411_10101431 3300032005 Bacteria 2037
351 Ga0307411_10613501 3300032005 Bacteria 937
352 Ga0316583_10028863 3300032133 Bacteria 1978
353 Ga0373930_0051690 3300034816 Bacteria 899
354 Ga0373928_0148833 3300035084 Bacteria 647
355 Ga0373929_0014999 3300035085 Bacteria 1503
356 Ga0373940_0002873 3300035088 Bacteria 3428
357 Ga0373949_0003576 3300035090 Bacteria 3672
358 Ga0373949_0102184 3300035090 Bacteria 787
359 Ga0373951_0016244 3300035091 Bacteria 1679
360 Ga0373923_0028281 3300035111 Bacteria 2242
361 Ga0373923_0075639 3300035111 Bacteria 1453
362 Ga0373923_0239757 3300035111 Bacteria 847
363 Ga0373932_0005138 3300035112 Bacteria 3075
364 Ga0373932_0067033 3300035112 Bacteria 1104
365 Ga0373932_0097928 3300035112 Bacteria 950
366 Ga0373932_0127600 3300035112 Bacteria 854
367 Ga0373941_0067176 3300035115 Bacteria 1182
368 Ga0373945_0279006 3300035116 Bacteria 712
369 Ga0373953_0029306 3300035117 Bacteria 2128
370 Ga0373954_0000002 3300035118 Bacteria 147478
371 Ga0373954_0151457 3300035118 Bacteria 1133
372 Ga0373956_0039558 3300035119 Bacteria 2090
373 Ga0373957_0010845 3300035120 Bacteria 3025
374 Ga0373960_0012638 3300035121 Bacteria 2102
375 Ga0373955_0006900 3300035172 Bacteria 5192
376 Ga0373942_0001165 3300035207 Bacteria 6975
377 Ga0373942_0061243 3300035207 Bacteria 1079
378 Ga0373962_0010615 3300035242 Bacteria 2299
379 Ga0373962_0254173 3300035242 Bacteria 611
380 Ga0316574_0024779 3300035398 Bacteria 3594
381 Ga0373924_0086321 3300035410 Bacteria 1339
382 Ga0373931_0000265 3300035691 Bacteria 22203
383 Ga0373931_0001111 3300035691 Bacteria 11416
384 Ga0373931_0094753 3300035691 Bacteria 1669
385 Ga0373931_0134293 3300035691 Bacteria 1427
386 Ga0373931_0146662 3300035691 Bacteria 1372
387 Ga0373931_0210255 3300035691 Bacteria 1166
388 Ga0373931_0292207 3300035691 Bacteria 1004
389 Ga0373935_0380151 3300035692 Bacteria 1011
390 Ga0373935_0661985 3300035692 Bacteria 766
391 Ga0373927_0016434 3300035695 Bacteria 4881
392 Ga0373927_0122995 3300035695 Bacteria 1694
393 Ga0373927_0174223 3300035695 Bacteria 1411
394 Ga0373933_0014193 3300035724 Bacteria 4425
395 Ga0373933_0023470 3300035724 Bacteria 3524
396 Ga0373937_0000358 3300036401 Bacteria 42468
397 Ga0373937_0004969 3300036401 Bacteria 11307
398 Ga0373937_0024246 3300036401 Bacteria 5469
399 Ga0373937_0138192 3300036401 Bacteria 2279
400 Ga0373937_0390596 3300036401 Bacteria 1320
401 Ga0373925_0117169 3300037068 Bacteria 2064
402 Ga0316581_0001558 3300037588 Bacteria 5207
403 Ga0439439_0145438 3300041406 Bacteria 671
404 Ga0439453_0153332 3300041408 Bacteria 548
405 Ga0439441_004715 3300042001 Bacteria 2081
406 Ga0439441_056928 3300042001 Bacteria 816
407 Ga0439443_000966 3300042003 Bacteria 2946
408 Ga0439443_002476 3300042003 Bacteria 2214
409 Ga0439451_013492 3300042009 Bacteria 1652
410 Ga0439456_017801 3300042013 Bacteria 1490
411 Ga0439446_0000176 3300042156 Bacteria 11244
412 Ga0439434_0007165 3300042435 Bacteria 3264
413 Ga0439434_0117730 3300042435 Bacteria 864
414 Ga0439435_0000026 3300042436 Bacteria 16073
415 Ga0439435_0016067 3300042436 Bacteria 1871
416 Ga0439435_0059349 3300042436 Bacteria 1112
417 Ga0439444_0002697 3300042437 Bacteria 2450
418 Ga0439460_0034783 3300042461 Bacteria 1454
419 Ga0466963_0316332 3300044694 Bacteria 1098
420 Ga0466964_0138518 3300044706 Bacteria 1116
421 Ga0451576_0001306 3300045051 Bacteria 43171
422 Ga0451576_0008334 3300045051 Bacteria 12184
423 Ga0451576_0050564 3300045051 Bacteria 4358
424 Ga0451576_0083471 3300045051 Bacteria 3323
425 Ga0451576_0154227 3300045051 Bacteria 2396
426 Ga0451576_0374264 3300045051 Bacteria 1492
427 Ga0451576_0499109 3300045051 Bacteria 1278
428 Ga0451576_0518803 3300045051 Bacteria 1252
429 Ga0451576_1244875 3300045051 Bacteria 777
430 Ga0451576_1248460 3300045051 Bacteria 775
431 Ga0466967_0006007 3300045976 Bacteria 8531
432 Ga0466967_0942412 3300045976 Bacteria 859
433 Ga0495592_0052225 3300046454 Bacteria 3035
434 Ga0495629_0044253 3300046459 Bacteria 3125
435 Ga0495641_0056653 3300046461 Bacteria 1776
436 Ga0495641_0138487 3300046461 Bacteria 1087
437 Ga0495639_0214158 3300046475 Bacteria 946
438 Ga0495662_0014869 3300046476 Bacteria 3782
439 Ga0495594_0248849 3300046499 Bacteria 1013
440 Ga0495608_0002044 3300046511 Bacteria 14501
441 Ga0495618_0015263 3300046514 Bacteria 4687
442 Ga0495628_0016487 3300046516 Bacteria 6161
443 Ga0495628_0641179 3300046516 Bacteria 755
444 Ga0495630_0001185 3300046517 Bacteria 17975
445 Ga0495630_0514081 3300046517 Bacteria 918
446 Ga0495644_0110707 3300046523 Bacteria 1042
447 Ga0495652_0048101 3300046529 Bacteria 3657
448 Ga0495640_0000808 3300046533 Bacteria 23777
449 Ga0495640_0004665 3300046533 Bacteria 10928
450 Ga0495586_0000440 3300046535 Bacteria 24985
451 Ga0495587_0009122 3300046536 Bacteria 6366
452 Ga0495621_0009090 3300046539 Bacteria 3005
453 Ga0495621_0065391 3300046539 Bacteria 1329
454 Ga0495621_0142048 3300046539 Bacteria 940
455 Ga0495621_0206979 3300046539 Bacteria 791
456 Ga0495645_0069462 3300046543 Bacteria 2543
457 Ga0495667_0012758 3300046559 Bacteria 5693
458 Ga0495656_0015676 3300046615 Bacteria 2866
459 Ga0495656_0670449 3300046615 Bacteria 557
460 Ga0495634_0002587 3300046642 Bacteria 14917
461 Ga0495635_0032744 3300046663 Bacteria 3605
462 Ga0495635_0095009 3300046663 Bacteria 2038
463 Ga0495659_0134567 3300046664 Bacteria 982
464 Ga0495657_0421692 3300046675 Bacteria 783
465 Ga0495599_0037696 3300046678 Bacteria 3037
466 Ga0495647_0100975 3300046681 Bacteria 1195
467 Ga0495658_0042024 3300046683 Bacteria 2550
468 Ga0495669_0010255 3300046684 Bacteria 3958
469 Ga0495669_0118686 3300046684 Bacteria 1239
470 Ga0495669_0511337 3300046684 Bacteria 584
471 Ga0495613_0008010 3300046689 Bacteria 7861
472 Ga0495624_0041706 3300046690 Bacteria 2935
473 Ga0495624_0150373 3300046690 Bacteria 1424
474 Ga0495600_0180472 3300046809 Bacteria 1360
475 Ga0495581_0032165 3300047315 Bacteria 3038
476 Ga0495604_0020749 3300047317 Bacteria 5246
477 Ga0495680_0001572 3300047322 Bacteria 24459
478 Ga0495675_0160223 3300047444 Bacteria 1386
479 Ga0495684_0325172 3300047471 Bacteria 1098
480 Ga0495593_0035630 3300047673 Bacteria 2701
481 Ga0495593_0291004 3300047673 Bacteria 817
482 Ga0501299_026353 3300049522 Bacteria 1097
483 Ga0501031_0281142 3300049568 Bacteria 1079
484 Ga0501034_1313174 3300049571 Bacteria 600
485 Ga0501036_0178308 3300049572 Bacteria 1789
486 Ga0501036_0240028 3300049572 Bacteria 1520
487 Ga0501036_0319593 3300049572 Bacteria 1297
488 Ga0501036_0377957 3300049572 Bacteria 1182
489 Ga0501037_0336610 3300049573 Bacteria 1043
490 Ga0501037_0434195 3300049573 Bacteria 898
491 Ga0501037_0568278 3300049573 Bacteria 764
492 Ga0501038_0026052 3300049574 Bacteria 5208
493 Ga0501038_0083926 3300049574 Bacteria 2681
494 Ga0501038_0163832 3300049574 Bacteria 1805
495 Ga0501038_0209304 3300049574 Bacteria 1561
496 Ga0501039_0012877 3300049575 Bacteria 6396
497 Ga0501039_0033647 3300049575 Bacteria 3953
498 Ga0501039_0070258 3300049575 Bacteria 2720
499 Ga0501039_0107755 3300049575 Bacteria 2177
500 Ga0501039_0129642 3300049575 Bacteria 1979
501 Ga0501039_0338143 3300049575 Bacteria 1183
502 Ga0501040_0054020 3300049576 Bacteria 2753
503 Ga0501040_0057334 3300049576 Bacteria 2674
504 Ga0501040_0169556 3300049576 Bacteria 1545
505 Ga0501040_0179156 3300049576 Bacteria 1502
506 Ga0501040_0207824 3300049576 Bacteria 1391
507 Ga0501040_0358871 3300049576 Bacteria 1044
508 Ga0501041_0013041 3300049577 Bacteria 4925
509 Ga0501041_0089018 3300049577 Bacteria 1905
510 Ga0501041_0102698 3300049577 Bacteria 1770
511 Ga0501042_0058453 3300049578 Bacteria 2752
512 Ga0501042_0071336 3300049578 Bacteria 2485
513 Ga0501042_0333659 3300049578 Bacteria 1096
514 Ga0501042_1138440 3300049578 Bacteria 569
515 Ga0501043_0188449 3300049579 Bacteria 1605
516 Ga0501046_0144016 3300049580 Bacteria 1801
517 Ga0501046_0196918 3300049580 Bacteria 1500
518 Ga0501048_0033104 3300049582 Bacteria 3736
519 Ga0501048_0164154 3300049582 Bacteria 1572
520 Ga0501048_0258413 3300049582 Bacteria 1237
521 Ga0501067_0060081 3300049583 Bacteria 2104
522 Ga0501067_0609724 3300049583 Bacteria 612
523 Ga0501068_0079115 3300049584 Bacteria 2016
524 Ga0501069_0295799 3300049585 Bacteria 949
525 Ga0501069_0323174 3300049585 Bacteria 907
526 Ga0501071_0002191 3300049587 Bacteria 11757
527 Ga0501071_0002663 3300049587 Bacteria 10935
528 Ga0501071_0027848 3300049587 Bacteria 3979
529 Ga0501072_0000916 3300049588 Bacteria 21646
530 Ga0501072_0322035 3300049588 Bacteria 1228
531 Ga0501072_0441118 3300049588 Bacteria 1031
532 Ga0501073_0390208 3300049589 Bacteria 962
533 Ga0501074_0571481 3300049590 Bacteria 800
534 Ga0501074_0574959 3300049590 Bacteria 797
535 Ga0501075_0005803 3300049591 Bacteria 8446
536 Ga0501075_0005912 3300049591 Bacteria 8371
537 Ga0501075_0032941 3300049591 Bacteria 3854
538 Ga0501075_0043280 3300049591 Bacteria 3377
539 Ga0501075_0052302 3300049591 Bacteria 3071
540 Ga0501075_0174935 3300049591 Bacteria 1638
541 Ga0501075_0589920 3300049591 Bacteria 848
542 Ga0501076_0000501 3300049592 Bacteria 24802
543 Ga0501076_0002030 3300049592 Bacteria 13854
544 Ga0501076_0009698 3300049592 Bacteria 7113
545 Ga0501076_0020296 3300049592 Bacteria 5086
546 Ga0501076_0047154 3300049592 Bacteria 3406
547 Ga0501076_0572794 3300049592 Bacteria 931
548 Ga0501077_0034711 3300049593 Bacteria 3210
549 Ga0501077_0034929 3300049593 Bacteria 3200
550 Ga0501249_172826 3300049679 Bacteria 555
551 Ga0501079_0003830 3300049741 Bacteria 11116
552 Ga0501079_0011071 3300049741 Bacteria 6879
553 Ga0501079_0644690 3300049741 Bacteria 834
554 Ga0501079_1132980 3300049741 Bacteria 616
555 Ga0501080_0001459 3300049742 Bacteria 19904
556 Ga0501080_0004292 3300049742 Bacteria 12654
557 Ga0501080_0022120 3300049742 Bacteria 5891
558 Ga0501080_0467953 3300049742 Bacteria 1129
559 Ga0501080_0602480 3300049742 Bacteria 975
560 Ga0501081_0012653 3300049743 Bacteria 5547
561 Ga0501081_0075868 3300049743 Bacteria 2347
562 Ga0501081_0359301 3300049743 Bacteria 1074
563 Ga0501083_0059221 3300049744 Bacteria 2562
564 Ga0501035_0204171 3300049822 Bacteria 1693
565 Ga0501035_0352180 3300049822 Bacteria 1232
566 Ga0501045_0002196 3300049824 Bacteria 13237
567 Ga0501045_0009426 3300049824 Bacteria 6830
568 Ga0501045_0012092 3300049824 Bacteria 6073
569 Ga0501045_0537769 3300049824 Bacteria 867
570 nmdc:mga00v17_814808_c1 3300050491 Bacteria 594
571 nmdc:mga05p37_132_c1 3300050507 Bacteria 68371
572 nmdc:mga05p37_209_c1 3300050507 Bacteria 59030
573 nmdc:mga05p37_434447_c1 3300050507 Bacteria 1524
574 nmdc:mga05p37_99251_c1 3300050507 Bacteria 3586
575 nmdc:mga09592_129332_c1 3300050508 Bacteria 2172
576 nmdc:mga09592_150_c1 3300050508 Bacteria 47613
577 nmdc:mga09592_22875_c1 3300050508 Bacteria 5157
578 nmdc:mga09592_418_c1 3300050508 Bacteria 31192
579 nmdc:mga09592_48397_c1 3300050508 Bacteria 3584
580 nmdc:mga09592_489508_c1 3300050508 Bacteria 1059
581 nmdc:mga0qj67_130662_c1 3300050509 Bacteria 2034
582 nmdc:mga0qj67_143086_c1 3300050509 Bacteria 1939
583 nmdc:mga0qj67_54911_c1 3300050509 Bacteria 3155
584 nmdc:mga0qj67_623_c1 3300050509 Bacteria 24285
585 nmdc:mga0qj67_68746_c1 3300050509 Bacteria 2824
586 nmdc:mga0qj67_97647_c1 3300050509 Bacteria 2366
587 nmdc:mga06r32_106616_c1 3300050510 Bacteria 2753
588 nmdc:mga06r32_146111_c1 3300050510 Bacteria 2342
589 nmdc:mga06r32_146596_c1 3300050510 Bacteria 2338
590 nmdc:mga06r32_242023_c1 3300050510 Bacteria 1792
591 nmdc:mga06r32_260547_c1 3300050510 Bacteria 1721
592 nmdc:mga06r32_5131_c1 3300050510 Bacteria 11778
593 nmdc:mga06r32_59226_c1 3300050510 Bacteria 3682
594 nmdc:mga08y16_109514_c1 3300050511 Bacteria 2876
595 nmdc:mga08y16_158582_c1 3300050511 Bacteria 2351
596 nmdc:mga08y16_232983_c1 3300050511 Bacteria 1904
597 nmdc:mga08y16_2590_c1 3300050511 Bacteria 18584
598 nmdc:mga08y16_281371_c1 3300050511 Bacteria 1716
599 nmdc:mga08y16_300477_c1 3300050511 Bacteria 1654
600 nmdc:mga08y16_353000_c1 3300050511 Bacteria 1510
601 nmdc:mga08y16_37817_c1 3300050511 Bacteria 5067
602 nmdc:mga08y16_382460_c1 3300050511 Bacteria 1443
603 nmdc:mga08y16_773622_c1 3300050511 Bacteria 955
604 nmdc:mga0n895_1401573_c1 3300050512 Bacteria 667
605 nmdc:mga0n895_260541_c1 3300050512 Bacteria 1760
606 nmdc:mga0n895_38225_c1 3300050512 Bacteria 4649
607 nmdc:mga0n895_4259_c1 3300050512 Bacteria 11704
608 nmdc:mga0n895_456_c1 3300050512 Bacteria 27409
609 nmdc:mga0rr50_16225_c1 3300050513 Bacteria 4940
610 nmdc:mga0rr50_165651_c1 3300050513 Bacteria 1797
611 nmdc:mga0rr50_25229_c1 3300050513 Bacteria 4130
612 nmdc:mga0rr50_30285_c1 3300050513 Bacteria 3830
613 nmdc:mga0rr50_382855_c1 3300050513 Bacteria 1186
614 nmdc:mga0rr50_397861_c1 3300050513 Bacteria 1163
615 nmdc:mga0rr50_949778_c1 3300050513 Bacteria 733
616 nmdc:mga08x19_108272_c1 3300050514 Bacteria 1851
617 nmdc:mga08x19_18431_c1 3300050514 Bacteria 4277
618 nmdc:mga08x19_2829_c1 3300050514 Bacteria 10472
619 nmdc:mga08x19_382528_c1 3300050514 Bacteria 986
620 nmdc:mga08x19_55_c1 3300050514 Bacteria 120851
621 nmdc:mga08x19_6047_c1 3300050514 Bacteria 7152
622 nmdc:mga0a205_1791_c1 3300050515 Bacteria 18571
623 nmdc:mga0a205_524739_c1 3300050515 Bacteria 1040
624 nmdc:mga0a205_774829_c1 3300050515 Bacteria 807
625 nmdc:mga0a205_783686_c1 3300050515 Bacteria 801
626 nmdc:mga0a205_97943_c1 3300050515 Bacteria 2831
627 Ga0495601_0020352 3300053077 Bacteria 4052
628 Ga0495619_0212455 3300053085 Bacteria 1340
629 Ga0500566_0149637 3300053094 Bacteria 1229
630 Ga0501084_0015022 3300054114 Bacteria 6420
631 Ga0501084_0021031 3300054114 Bacteria 5442
632 Ga0501084_0115264 3300054114 Bacteria 2259
633 Ga0590071_092498 3300059421 Bacteria 758
634 Ga0501082_0005562 3300060353 Bacteria 10942
635 Ga0501082_0100579 3300060353 Bacteria 2501
636 Ga0501082_0105770 3300060353 Bacteria 2434
637 Ga0501082_0129953 3300060353 Bacteria 2185
638 Ga0501082_0531014 3300060353 Bacteria 1029
639 Ga0530510_0005015 3300061734 Bacteria 9144
640 Ga0530510_0053851 3300061734 Bacteria 2907
641 Ga0530510_0217830 3300061734 Bacteria 1419

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035121 Ga0373960_0012638 Ga0373960_0012638_963_1478 155
2 3300035691 Ga0373931_0001111 Ga0373931_0001111_10195_10710 155
3 3300035112 Ga0373932_0067033 Ga0373932_0067033_383_901 156
4 3300035115 Ga0373941_0067176 Ga0373941_0067176_351_869 156
5 3300049585 Ga0501069_0295799 Ga0501069_0295799_266_748 160
6 3300045976 Ga0466967_0942412 Ga0466967_0942412_304_804 162
7 3300025938 Ga0207704_10744078 Ga0207704_107440782 163
8 3300049572 Ga0501036_0319593 Ga0501036_0319593_371_862 163
9 3300049573 Ga0501037_0336610 Ga0501037_0336610_221_712 163
10 3300049574 Ga0501038_0083926 Ga0501038_0083926_1321_1812 163
11 3300049575 Ga0501039_0070258 Ga0501039_0070258_1403_1894 163
12 3300049575 Ga0501039_0338143 Ga0501039_0338143_88_591 163
13 3300049576 Ga0501040_0054020 Ga0501040_0054020_2042_2533 163
14 3300049577 Ga0501041_0013041 Ga0501041_0013041_2384_2875 163
15 3300049578 Ga0501042_0058453 Ga0501042_0058453_969_1460 163
16 3300049580 Ga0501046_0196918 Ga0501046_0196918_28_519 163
17 3300049582 Ga0501048_0258413 Ga0501048_0258413_31_522 163
18 3300049584 Ga0501068_0079115 Ga0501068_0079115_424_915 163
19 3300049587 Ga0501071_0027848 Ga0501071_0027848_1584_2075 163
20 3300049590 Ga0501074_0571481 Ga0501074_0571481_252_743 163
21 3300049591 Ga0501075_0005912 Ga0501075_0005912_4216_4707 163
22 3300049591 Ga0501075_0043280 Ga0501075_0043280_2643_3134 163
23 3300049592 Ga0501076_0000501 Ga0501076_0000501_15283_15774 163
24 3300049592 Ga0501076_0020296 Ga0501076_0020296_388_879 163
25 3300049593 Ga0501077_0034929 Ga0501077_0034929_1386_1877 163
26 3300049741 Ga0501079_0011071 Ga0501079_0011071_4792_5283 163
27 3300049742 Ga0501080_0004292 Ga0501080_0004292_7482_7973 163
28 3300049742 Ga0501080_0602480 Ga0501080_0602480_124_615 163
29 3300049822 Ga0501035_0204171 Ga0501035_0204171_569_1060 163
30 3300049824 Ga0501045_0002196 Ga0501045_0002196_12385_12876 163
31 3300049824 Ga0501045_0009426 Ga0501045_0009426_5802_6293 163
32 3300054114 Ga0501084_0021031 Ga0501084_0021031_4910_5401 163
33 3300060353 Ga0501082_0005562 Ga0501082_0005562_3504_3995 163
34 3300060353 Ga0501082_0100579 Ga0501082_0100579_385_876 163
35 3300061734 Ga0530510_0053851 Ga0530510_0053851_700_1191 163
36 3300061734 Ga0530510_0217830 Ga0530510_0217830_830_1321 163
37 3300005334 Ga0068869_101008834 Ga0068869_1010088342 164
38 3300005345 Ga0070692_10320122 Ga0070692_103201221 164
39 3300005468 Ga0070707_100495725 Ga0070707_1004957251 164
40 3300005544 Ga0070686_100185800 Ga0070686_1001858001 164
41 3300005545 Ga0070695_100774624 Ga0070695_1007746241 164
42 3300005547 Ga0070693_100116800 Ga0070693_1001168003 164
43 3300005547 Ga0070693_100157932 Ga0070693_1001579321 164
44 3300005549 Ga0070704_100012457 Ga0070704_1000124575 164
45 3300005614 Ga0068856_100574738 Ga0068856_1005747382 164
46 3300009094 Ga0111539_12309540 Ga0111539_123095402 164
47 3300009098 Ga0105245_10174584 Ga0105245_101745842 164
48 3300009176 Ga0105242_10001782 Ga0105242_100017826 164
49 3300025922 Ga0207646_10433105 Ga0207646_104331052 164
50 3300025927 Ga0207687_10118425 Ga0207687_101184252 164
51 3300025934 Ga0207686_10029433 Ga0207686_100294332 164
52 3300035111 Ga0373923_0239757 Ga0373923_0239757_299_799 164
53 3300035410 Ga0373924_0086321 Ga0373924_0086321_567_1067 164
54 3300035691 Ga0373931_0292207 Ga0373931_0292207_13_513 164
55 3300035692 Ga0373935_0661985 Ga0373935_0661985_59_559 164
56 3300035695 Ga0373927_0016434 Ga0373927_0016434_2597_3097 164
57 3300036401 Ga0373937_0138192 Ga0373937_0138192_701_1204 164
58 3300037068 Ga0373925_0117169 Ga0373925_0117169_1108_1608 164
59 3300042001 Ga0439441_056928 Ga0439441_056928_61_561 164
60 3300046539 Ga0495621_0206979 Ga0495621_0206979_193_696 164
61 3300049742 Ga0501080_0467953 Ga0501080_0467953_515_1018 164
62 3300050491 nmdc:mga00v17_814808_c1 nmdc:mga00v17_814808_c1_57_560 164
63 3300050511 nmdc:mga08y16_300477_c1 nmdc:mga08y16_300477_c1_979_1482 164
64 3300050515 nmdc:mga0a205_524739_c1 nmdc:mga0a205_524739_c1_363_863 164
65 3300005330 Ga0070690_100254176 Ga0070690_1002541762 165
66 3300005340 Ga0070689_100829217 Ga0070689_1008292172 165
67 3300005343 Ga0070687_100193904 Ga0070687_1001939042 165
68 3300005365 Ga0070688_100650146 Ga0070688_1006501462 165
69 3300005437 Ga0070710_10160420 Ga0070710_101604202 165
70 3300005440 Ga0070705_100009501 Ga0070705_1000095015 165
71 3300005444 Ga0070694_100017597 Ga0070694_1000175972 165
72 3300005444 Ga0070694_100023240 Ga0070694_1000232403 165
73 3300005445 Ga0070708_100557224 Ga0070708_1005572242 165
74 3300005459 Ga0068867_100674356 Ga0068867_1006743562 165
75 3300005471 Ga0070698_100012901 Ga0070698_10001290111 165
76 3300005518 Ga0070699_100272627 Ga0070699_1002726272 165
77 3300005545 Ga0070695_100183594 Ga0070695_1001835942 165
78 3300005545 Ga0070695_100839412 Ga0070695_1008394122 165
79 3300005546 Ga0070696_101412965 Ga0070696_1014129651 165
80 3300005549 Ga0070704_100001327 Ga0070704_1000013278 165
81 3300005549 Ga0070704_100041897 Ga0070704_1000418972 165
82 3300005549 Ga0070704_100643329 Ga0070704_1006433292 165
83 3300005549 Ga0070704_101014919 Ga0070704_1010149192 165
84 3300005577 Ga0068857_100480110 Ga0068857_1004801102 165
85 3300005617 Ga0068859_100089998 Ga0068859_1000899985 165
86 3300005841 Ga0068863_100252789 Ga0068863_1002527893 165
87 3300005842 Ga0068858_100340710 Ga0068858_1003407103 165
88 3300005844 Ga0068862_100574832 Ga0068862_1005748322 165
89 3300006846 Ga0075430_100008422 Ga0075430_1000084225 165
90 3300006846 Ga0075430_100057331 Ga0075430_1000573314 165
91 3300006847 Ga0075431_100005396 Ga0075431_1000053968 165
92 3300006847 Ga0075431_100043616 Ga0075431_1000436163 165
93 3300006847 Ga0075431_100066496 Ga0075431_1000664965 165
94 3300006880 Ga0075429_100000511 Ga0075429_10000051127 165
95 3300006931 Ga0097620_100089997 Ga0097620_1000899975 165
96 3300007076 Ga0075435_100088050 Ga0075435_1000880502 165
97 3300009094 Ga0111539_10013382 Ga0111539_1001338211 165
98 3300009094 Ga0111539_10480652 Ga0111539_104806522 165
99 3300009147 Ga0114129_10002670 Ga0114129_100026706 165
100 3300009147 Ga0114129_10754917 Ga0114129_107549173 165
101 3300009553 Ga0105249_10039524 Ga0105249_100395242 165
102 3300013307 Ga0157372_10260338 Ga0157372_102603384 165
103 3300025885 Ga0207653_10193672 Ga0207653_101936722 165
104 3300025898 Ga0207692_10036509 Ga0207692_100365093 165
105 3300025917 Ga0207660_10051463 Ga0207660_100514633 165
106 3300025918 Ga0207662_10039563 Ga0207662_100395632 165
107 3300025961 Ga0207712_10117131 Ga0207712_101171312 165
108 3300026088 Ga0207641_10173891 Ga0207641_101738913 165
109 3300026116 Ga0207674_10040257 Ga0207674_100402572 165
110 3300026118 Ga0207675_101152338 Ga0207675_1011523381 165
111 3300027360 Ga0209969_1014562 Ga0209969_10145622 165
112 3300027907 Ga0207428_10288770 Ga0207428_102887702 165
113 3300027907 Ga0207428_10306886 Ga0207428_103068862 165
114 3300028380 Ga0268265_10922099 Ga0268265_109220992 165
115 3300031665 Ga0316575_10009032 Ga0316575_100090322 165
116 3300031728 Ga0316578_10036076 Ga0316578_100360764 165
117 3300031995 Ga0307409_101146005 Ga0307409_1011460051 165
118 3300032133 Ga0316583_10028863 Ga0316583_100288632 165
119 3300035111 Ga0373923_0075639 Ga0373923_0075639_815_1315 165
120 3300035116 Ga0373945_0279006 Ga0373945_0279006_27_527 165
121 3300035117 Ga0373953_0029306 Ga0373953_0029306_129_629 165
122 3300035118 Ga0373954_0151457 Ga0373954_0151457_67_567 165
123 3300035119 Ga0373956_0039558 Ga0373956_0039558_854_1354 165
124 3300035120 Ga0373957_0010845 Ga0373957_0010845_971_1471 165
125 3300035172 Ga0373955_0006900 Ga0373955_0006900_3505_4005 165
126 3300035398 Ga0316574_0024779 Ga0316574_0024779_273_773 165
127 3300035695 Ga0373927_0122995 Ga0373927_0122995_1003_1503 165
128 3300035724 Ga0373933_0023470 Ga0373933_0023470_1693_2193 165
129 3300036401 Ga0373937_0024246 Ga0373937_0024246_2041_2541 165
130 3300037588 Ga0316581_0001558 Ga0316581_0001558_533_1033 165
131 3300042435 Ga0439434_0117730 Ga0439434_0117730_351_851 165
132 3300045051 Ga0451576_0008334 Ga0451576_0008334_2430_2930 165
133 3300045051 Ga0451576_0518803 Ga0451576_0518803_493_993 165
134 3300045051 Ga0451576_1244875 Ga0451576_1244875_197_697 165
135 3300046499 Ga0495594_0248849 Ga0495594_0248849_351_851 165
136 3300046516 Ga0495628_0641179 Ga0495628_0641179_178_678 165
137 3300046539 Ga0495621_0065391 Ga0495621_0065391_366_866 165
138 3300046663 Ga0495635_0095009 Ga0495635_0095009_187_687 165
139 3300049572 Ga0501036_0178308 Ga0501036_0178308_510_1010 165
140 3300049572 Ga0501036_0377957 Ga0501036_0377957_466_969 165
141 3300049573 Ga0501037_0568278 Ga0501037_0568278_130_630 165
142 3300049575 Ga0501039_0012877 Ga0501039_0012877_3055_3555 165
143 3300049575 Ga0501039_0129642 Ga0501039_0129642_107_610 165
144 3300049576 Ga0501040_0358871 Ga0501040_0358871_89_592 165
145 3300049577 Ga0501041_0102698 Ga0501041_0102698_124_624 165
146 3300049578 Ga0501042_1138440 Ga0501042_1138440_43_543 165
147 3300049579 Ga0501043_0188449 Ga0501043_0188449_858_1361 165
148 3300049587 Ga0501071_0002191 Ga0501071_0002191_5651_6154 165
149 3300049587 Ga0501071_0002663 Ga0501071_0002663_482_982 165
150 3300049591 Ga0501075_0005803 Ga0501075_0005803_3440_3943 165
151 3300049591 Ga0501075_0174935 Ga0501075_0174935_260_760 165
152 3300049592 Ga0501076_0009698 Ga0501076_0009698_5655_6158 165
153 3300049742 Ga0501080_0001459 Ga0501080_0001459_11078_11581 165
154 3300049743 Ga0501081_0075868 Ga0501081_0075868_236_739 165
155 3300049744 Ga0501083_0059221 Ga0501083_0059221_1623_2126 165
156 3300049822 Ga0501035_0352180 Ga0501035_0352180_627_1127 165
157 3300049824 Ga0501045_0537769 Ga0501045_0537769_94_594 165
158 3300050507 nmdc:mga05p37_209_c1 nmdc:mga05p37_209_c1_40494_40994 165
159 3300050508 nmdc:mga09592_150_c1 nmdc:mga09592_150_c1_41415_41915 165
160 3300050509 nmdc:mga0qj67_130662_c1 nmdc:mga0qj67_130662_c1_798_1298 165
161 3300050509 nmdc:mga0qj67_97647_c1 nmdc:mga0qj67_97647_c1_1186_1686 165
162 3300050510 nmdc:mga06r32_106616_c1 nmdc:mga06r32_106616_c1_1290_1790 165
163 3300050510 nmdc:mga06r32_5131_c1 nmdc:mga06r32_5131_c1_6259_6759 165
164 3300050510 nmdc:mga06r32_59226_c1 nmdc:mga06r32_59226_c1_2995_3495 165
165 3300050511 nmdc:mga08y16_158582_c1 nmdc:mga08y16_158582_c1_1671_2171 165
166 3300050511 nmdc:mga08y16_232983_c1 nmdc:mga08y16_232983_c1_712_1212 165
167 3300050513 nmdc:mga0rr50_382855_c1 nmdc:mga0rr50_382855_c1_344_844 165
168 3300060353 Ga0501082_0129953 Ga0501082_0129953_757_1260 165
169 3300005367 Ga0070667_100237976 Ga0070667_1002379762 166
170 3300005438 Ga0070701_10477794 Ga0070701_104777942 166
171 3300005458 Ga0070681_10000399 Ga0070681_1000039912 166
172 3300005530 Ga0070679_100030836 Ga0070679_1000308366 166
173 3300005535 Ga0070684_100013383 Ga0070684_1000133833 166
174 3300005544 Ga0070686_100178402 Ga0070686_1001784022 166
175 3300005615 Ga0070702_100298111 Ga0070702_1002981112 166
176 3300005617 Ga0068859_102348448 Ga0068859_1023484481 166
177 3300006237 Ga0097621_100002033 Ga0097621_1000020333 166
178 3300006358 Ga0068871_100003069 Ga0068871_10000306911 166
179 3300006931 Ga0097620_102347883 Ga0097620_1023478831 166
180 3300009148 Ga0105243_10719528 Ga0105243_107195282 166
181 3300009177 Ga0105248_10165967 Ga0105248_101659673 166
182 3300014969 Ga0157376_10143622 Ga0157376_101436223 166
183 3300025912 Ga0207707_10003163 Ga0207707_1000316310 166
184 3300025917 Ga0207660_10249364 Ga0207660_102493643 166
185 3300025918 Ga0207662_10282464 Ga0207662_102824642 166
186 3300025921 Ga0207652_10195092 Ga0207652_101950922 166
187 3300025986 Ga0207658_10226027 Ga0207658_102260272 166
188 3300026023 Ga0207677_10911426 Ga0207677_109114262 166
189 3300026089 Ga0207648_10789803 Ga0207648_107898032 166
190 3300027695 Ga0209966_1004025 Ga0209966_10040253 166
191 3300032002 Ga0307416_101045929 Ga0307416_1010459292 166
192 3300032005 Ga0307411_10613501 Ga0307411_106135012 166
193 3300035207 Ga0373942_0061243 Ga0373942_0061243_297_797 166
194 3300035691 Ga0373931_0210255 Ga0373931_0210255_199_699 166
195 3300049522 Ga0501299_026353 Ga0501299_026353_379_879 166
196 3300049583 Ga0501067_0060081 Ga0501067_0060081_28_531 166
197 3300049585 Ga0501069_0323174 Ga0501069_0323174_221_724 166
198 3300002074 JGI24748J21848_1021905 JGI24748J21848_10219051 167
199 3300005330 Ga0070690_100000197 Ga0070690_10000019732 167
200 3300005330 Ga0070690_100117645 Ga0070690_1001176452 167
201 3300005333 Ga0070677_10111340 Ga0070677_101113403 167
202 3300005334 Ga0068869_100000214 Ga0068869_10000021432 167
203 3300005335 Ga0070666_10090292 Ga0070666_100902922 167
204 3300005336 Ga0070680_100001218 Ga0070680_10000121820 167
205 3300005336 Ga0070680_100107816 Ga0070680_1001078163 167
206 3300005336 Ga0070680_100516319 Ga0070680_1005163192 167
207 3300005337 Ga0070682_100003738 Ga0070682_1000037389 167
208 3300005338 Ga0068868_100000458 Ga0068868_1000004586 167
209 3300005340 Ga0070689_100000107 Ga0070689_10000010714 167
210 3300005341 Ga0070691_10000220 Ga0070691_100002207 167
211 3300005343 Ga0070687_100000034 Ga0070687_1000000342 167
212 3300005343 Ga0070687_100861811 Ga0070687_1008618111 167
213 3300005345 Ga0070692_10010201 Ga0070692_100102013 167
214 3300005347 Ga0070668_100003178 Ga0070668_10000317811 167
215 3300005353 Ga0070669_100003861 Ga0070669_1000038619 167
216 3300005353 Ga0070669_100519539 Ga0070669_1005195391 167
217 3300005353 Ga0070669_100854172 Ga0070669_1008541721 167
218 3300005356 Ga0070674_100078762 Ga0070674_1000787624 167
219 3300005356 Ga0070674_100349867 Ga0070674_1003498672 167
220 3300005365 Ga0070688_100391486 Ga0070688_1003914862 167
221 3300005406 Ga0070703_10003454 Ga0070703_100034542 167
222 3300005406 Ga0070703_10222099 Ga0070703_102220991 167
223 3300005434 Ga0070709_10797513 Ga0070709_107975132 167
224 3300005435 Ga0070714_100691684 Ga0070714_1006916842 167
225 3300005436 Ga0070713_100205276 Ga0070713_1002052763 167
226 3300005438 Ga0070701_10000396 Ga0070701_1000039610 167
227 3300005438 Ga0070701_10492074 Ga0070701_104920742 167
228 3300005439 Ga0070711_100295613 Ga0070711_1002956132 167
229 3300005440 Ga0070705_100000582 Ga0070705_10000058211 167
230 3300005440 Ga0070705_100132366 Ga0070705_1001323662 167
231 3300005440 Ga0070705_100188517 Ga0070705_1001885172 167
232 3300005440 Ga0070705_100226806 Ga0070705_1002268063 167
233 3300005441 Ga0070700_100000344 Ga0070700_10000034412 167
234 3300005441 Ga0070700_100000633 Ga0070700_10000063317 167
235 3300005441 Ga0070700_100614442 Ga0070700_1006144421 167
236 3300005444 Ga0070694_100000126 Ga0070694_1000001267 167
237 3300005444 Ga0070694_100259542 Ga0070694_1002595422 167
238 3300005444 Ga0070694_100488916 Ga0070694_1004889162 167
239 3300005444 Ga0070694_100680795 Ga0070694_1006807952 167
240 3300005445 Ga0070708_100173223 Ga0070708_1001732232 167
241 3300005458 Ga0070681_10047332 Ga0070681_100473324 167
242 3300005459 Ga0068867_100000032 Ga0068867_10000003256 167
243 3300005459 Ga0068867_100001769 Ga0068867_1000017693 167
244 3300005468 Ga0070707_100357333 Ga0070707_1003573332 167
245 3300005471 Ga0070698_100378584 Ga0070698_1003785842 167
246 3300005471 Ga0070698_100549999 Ga0070698_1005499992 167
247 3300005518 Ga0070699_101223804 Ga0070699_1012238041 167
248 3300005530 Ga0070679_100017314 Ga0070679_1000173145 167
249 3300005536 Ga0070697_100000731 Ga0070697_10000073119 167
250 3300005543 Ga0070672_101009374 Ga0070672_1010093742 167
251 3300005544 Ga0070686_100000253 Ga0070686_10000025311 167
252 3300005544 Ga0070686_100203895 Ga0070686_1002038952 167
253 3300005544 Ga0070686_100426217 Ga0070686_1004262171 167
254 3300005544 Ga0070686_100499257 Ga0070686_1004992571 167
255 3300005545 Ga0070695_100000197 Ga0070695_1000001973 167
256 3300005545 Ga0070695_100094784 Ga0070695_1000947842 167
257 3300005546 Ga0070696_100000089 Ga0070696_10000008936 167
258 3300005546 Ga0070696_100000482 Ga0070696_10000048214 167
259 3300005546 Ga0070696_100090748 Ga0070696_1000907484 167
260 3300005546 Ga0070696_100277419 Ga0070696_1002774193 167
261 3300005546 Ga0070696_100572358 Ga0070696_1005723582 167
262 3300005547 Ga0070693_100000400 Ga0070693_10000040014 167
263 3300005547 Ga0070693_100287804 Ga0070693_1002878041 167
264 3300005547 Ga0070693_100613918 Ga0070693_1006139181 167
265 3300005547 Ga0070693_101172963 Ga0070693_1011729631 167
266 3300005549 Ga0070704_100000017 Ga0070704_10000001754 167
267 3300005549 Ga0070704_100468739 Ga0070704_1004687392 167
268 3300005549 Ga0070704_100618204 Ga0070704_1006182041 167
269 3300005549 Ga0070704_101052032 Ga0070704_1010520322 167
270 3300005563 Ga0068855_100002377 Ga0068855_10000237720 167
271 3300005578 Ga0068854_100004305 Ga0068854_1000043053 167
272 3300005614 Ga0068856_100020620 Ga0068856_1000206203 167
273 3300005614 Ga0068856_100699952 Ga0068856_1006999521 167
274 3300005615 Ga0070702_100000001 Ga0070702_10000000134 167
275 3300005617 Ga0068859_100000149 Ga0068859_10000014939 167
276 3300005617 Ga0068859_100185203 Ga0068859_1001852032 167
277 3300005618 Ga0068864_100009007 Ga0068864_10000900710 167
278 3300005718 Ga0068866_10000326 Ga0068866_1000032618 167
279 3300005718 Ga0068866_10593364 Ga0068866_105933642 167
280 3300005719 Ga0068861_100002365 Ga0068861_1000023652 167
281 3300005719 Ga0068861_100016010 Ga0068861_1000160105 167
282 3300005840 Ga0068870_10009444 Ga0068870_100094442 167
283 3300005840 Ga0068870_10102497 Ga0068870_101024973 167
284 3300005840 Ga0068870_10135645 Ga0068870_101356452 167
285 3300005841 Ga0068863_101417311 Ga0068863_1014173112 167
286 3300005842 Ga0068858_100002902 Ga0068858_10000290218 167
287 3300005842 Ga0068858_100195287 Ga0068858_1001952872 167
288 3300005843 Ga0068860_100001090 Ga0068860_10000109011 167
289 3300005844 Ga0068862_100000409 Ga0068862_10000040925 167
290 3300005844 Ga0068862_100001785 Ga0068862_10000178514 167
291 3300005844 Ga0068862_100493025 Ga0068862_1004930253 167
292 3300005981 Ga0081538_10081944 Ga0081538_100819442 167
293 3300005985 Ga0081539_10000686 Ga0081539_1000068663 167
294 3300006173 Ga0070716_100092106 Ga0070716_1000921063 167
295 3300006237 Ga0097621_100000928 Ga0097621_1000009289 167
296 3300006358 Ga0068871_100029846 Ga0068871_1000298463 167
297 3300006844 Ga0075428_100000083 Ga0075428_10000008313 167
298 3300006844 Ga0075428_100037796 Ga0075428_1000377964 167
299 3300006844 Ga0075428_100108390 Ga0075428_1001083906 167
300 3300006844 Ga0075428_100359340 Ga0075428_1003593403 167
301 3300006844 Ga0075428_100842720 Ga0075428_1008427202 167
302 3300006846 Ga0075430_100000550 Ga0075430_10000055014 167
303 3300006846 Ga0075430_100058656 Ga0075430_1000586564 167
304 3300006846 Ga0075430_100159593 Ga0075430_1001595932 167
305 3300006847 Ga0075431_100153977 Ga0075431_1001539773 167
306 3300006847 Ga0075431_100841843 Ga0075431_1008418431 167
307 3300006852 Ga0075433_10007789 Ga0075433_100077898 167
308 3300006852 Ga0075433_10921675 Ga0075433_109216752 167
309 3300006852 Ga0075433_10947210 Ga0075433_109472102 167
310 3300006871 Ga0075434_100007734 Ga0075434_1000077344 167
311 3300006871 Ga0075434_100115383 Ga0075434_1001153833 167
312 3300006871 Ga0075434_101348149 Ga0075434_1013481492 167
313 3300006871 Ga0075434_101696308 Ga0075434_1016963082 167
314 3300006880 Ga0075429_100000480 Ga0075429_1000004809 167
315 3300006880 Ga0075429_100097034 Ga0075429_1000970342 167
316 3300006880 Ga0075429_100142665 Ga0075429_1001426652 167
317 3300006880 Ga0075429_100547037 Ga0075429_1005470372 167
318 3300006881 Ga0068865_100000059 Ga0068865_10000005932 167
319 3300006881 Ga0068865_100243839 Ga0068865_1002438393 167
320 3300006914 Ga0075436_100003220 Ga0075436_1000032206 167
321 3300006914 Ga0075436_100015702 Ga0075436_1000157026 167
322 3300006914 Ga0075436_100064795 Ga0075436_1000647951 167
323 3300006914 Ga0075436_100072353 Ga0075436_1000723533 167
324 3300006931 Ga0097620_100000149 Ga0097620_10000014936 167
325 3300006931 Ga0097620_100185211 Ga0097620_1001852112 167
326 3300007076 Ga0075435_100000388 Ga0075435_1000003888 167
327 3300007076 Ga0075435_100002470 Ga0075435_1000024702 167
328 3300007076 Ga0075435_100003004 Ga0075435_1000030043 167
329 3300007076 Ga0075435_100095285 Ga0075435_1000952852 167
330 3300007076 Ga0075435_100371528 Ga0075435_1003715282 167
331 3300007265 Ga0099794_10003748 Ga0099794_100037483 167
332 3300007265 Ga0099794_10292604 Ga0099794_102926042 167
333 3300009094 Ga0111539_10022182 Ga0111539_1002218211 167
334 3300009094 Ga0111539_10053780 Ga0111539_100537802 167
335 3300009094 Ga0111539_10082706 Ga0111539_100827062 167
336 3300009094 Ga0111539_10369811 Ga0111539_103698113 167
337 3300009094 Ga0111539_10535706 Ga0111539_105357063 167
338 3300009098 Ga0105245_10000075 Ga0105245_1000007557 167
339 3300009147 Ga0114129_10000210 Ga0114129_1000021039 167
340 3300009147 Ga0114129_10990843 Ga0114129_109908432 167
341 3300009148 Ga0105243_10000622 Ga0105243_1000062228 167
342 3300009174 Ga0105241_10012163 Ga0105241_100121635 167
343 3300009176 Ga0105242_10000407 Ga0105242_1000040728 167
344 3300009177 Ga0105248_10255442 Ga0105248_102554422 167
345 3300009177 Ga0105248_10546246 Ga0105248_105462462 167
346 3300009551 Ga0105238_10842562 Ga0105238_108425622 167
347 3300009553 Ga0105249_10007167 Ga0105249_1000716710 167
348 3300009553 Ga0105249_11767283 Ga0105249_117672831 167
349 3300010375 Ga0105239_10157884 Ga0105239_101578844 167
350 3300013297 Ga0157378_10000074 Ga0157378_1000007438 167
351 3300013306 Ga0163162_10129351 Ga0163162_101293512 167
352 3300013306 Ga0163162_10285360 Ga0163162_102853602 167
353 3300013308 Ga0157375_10509511 Ga0157375_105095112 167
354 3300013308 Ga0157375_11811274 Ga0157375_118112741 167
355 3300014745 Ga0157377_10854859 Ga0157377_108548591 167
356 3300014969 Ga0157376_10059407 Ga0157376_100594075 167
357 3300014969 Ga0157376_11303303 Ga0157376_113033032 167
358 3300025885 Ga0207653_10022249 Ga0207653_100222491 167
359 3300025893 Ga0207682_10031631 Ga0207682_100316312 167
360 3300025899 Ga0207642_10001898 Ga0207642_100018985 167
361 3300025903 Ga0207680_10218904 Ga0207680_102189042 167
362 3300025905 Ga0207685_10267975 Ga0207685_102679752 167
363 3300025907 Ga0207645_10078625 Ga0207645_100786253 167
364 3300025908 Ga0207643_10407301 Ga0207643_104073012 167
365 3300025908 Ga0207643_10551299 Ga0207643_105512992 167
366 3300025911 Ga0207654_10010687 Ga0207654_100106874 167
367 3300025912 Ga0207707_10229933 Ga0207707_102299332 167
368 3300025916 Ga0207663_10105889 Ga0207663_101058892 167
369 3300025916 Ga0207663_10700876 Ga0207663_107008762 167
370 3300025917 Ga0207660_10003510 Ga0207660_1000351010 167
371 3300025917 Ga0207660_10141579 Ga0207660_101415793 167
372 3300025917 Ga0207660_10229094 Ga0207660_102290942 167
373 3300025918 Ga0207662_10000166 Ga0207662_1000016636 167
374 3300025918 Ga0207662_10018412 Ga0207662_100184125 167
375 3300025918 Ga0207662_10247552 Ga0207662_102475523 167
376 3300025918 Ga0207662_10468186 Ga0207662_104681861 167
377 3300025918 Ga0207662_10604257 Ga0207662_106042571 167
378 3300025921 Ga0207652_10010844 Ga0207652_100108442 167
379 3300025921 Ga0207652_10676459 Ga0207652_106764592 167
380 3300025922 Ga0207646_10228935 Ga0207646_102289352 167
381 3300025922 Ga0207646_10804596 Ga0207646_108045962 167
382 3300025923 Ga0207681_10000542 Ga0207681_1000054216 167
383 3300025923 Ga0207681_10418203 Ga0207681_104182032 167
384 3300025925 Ga0207650_10959241 Ga0207650_109592412 167
385 3300025934 Ga0207686_10000243 Ga0207686_1000024322 167
386 3300025935 Ga0207709_10001387 Ga0207709_100013877 167
387 3300025935 Ga0207709_10004987 Ga0207709_100049874 167
388 3300025936 Ga0207670_10006628 Ga0207670_100066285 167
389 3300025936 Ga0207670_10008142 Ga0207670_100081426 167
390 3300025937 Ga0207669_10041596 Ga0207669_100415963 167
391 3300025937 Ga0207669_10616964 Ga0207669_106169642 167
392 3300025938 Ga0207704_10000178 Ga0207704_1000017836 167
393 3300025938 Ga0207704_10001089 Ga0207704_100010892 167
394 3300025938 Ga0207704_10087833 Ga0207704_100878335 167
395 3300025940 Ga0207691_10479201 Ga0207691_104792012 167
396 3300025941 Ga0207711_10151250 Ga0207711_101512502 167
397 3300025941 Ga0207711_10277589 Ga0207711_102775894 167
398 3300025942 Ga0207689_10000007 Ga0207689_1000000783 167
399 3300025942 Ga0207689_10205501 Ga0207689_102055013 167
400 3300025944 Ga0207661_10242755 Ga0207661_102427552 167
401 3300025949 Ga0207667_10019325 Ga0207667_100193255 167
402 3300025960 Ga0207651_10229189 Ga0207651_102291891 167
403 3300025961 Ga0207712_10002821 Ga0207712_100028213 167
404 3300025961 Ga0207712_10020951 Ga0207712_100209513 167
405 3300025972 Ga0207668_10031833 Ga0207668_100318337 167
406 3300025981 Ga0207640_10014310 Ga0207640_100143103 167
407 3300026023 Ga0207677_10000823 Ga0207677_1000082311 167
408 3300026035 Ga0207703_10005057 Ga0207703_100050572 167
409 3300026035 Ga0207703_10015309 Ga0207703_100153093 167
410 3300026075 Ga0207708_10000086 Ga0207708_1000008617 167
411 3300026075 Ga0207708_10003576 Ga0207708_1000357614 167
412 3300026075 Ga0207708_10177507 Ga0207708_101775073 167
413 3300026075 Ga0207708_10940309 Ga0207708_109403092 167
414 3300026078 Ga0207702_10017742 Ga0207702_100177426 167
415 3300026078 Ga0207702_10073736 Ga0207702_100737362 167
416 3300026078 Ga0207702_10554990 Ga0207702_105549901 167
417 3300026088 Ga0207641_10202721 Ga0207641_102027212 167
418 3300026088 Ga0207641_10260338 Ga0207641_102603383 167
419 3300026089 Ga0207648_10000079 Ga0207648_1000007956 167
420 3300026089 Ga0207648_10000352 Ga0207648_100003524 167
421 3300026089 Ga0207648_11297609 Ga0207648_112976092 167
422 3300026095 Ga0207676_10036447 Ga0207676_100364472 167
423 3300026118 Ga0207675_100000093 Ga0207675_10000009358 167
424 3300026118 Ga0207675_100000802 Ga0207675_10000080227 167
425 3300026142 Ga0207698_10010533 Ga0207698_100105335 167
426 3300027378 Ga0209981_1005263 Ga0209981_10052633 167
427 3300027378 Ga0209981_1006180 Ga0209981_10061802 167
428 3300027462 Ga0210000_1006568 Ga0210000_10065682 167
429 3300027462 Ga0210000_1021175 Ga0210000_10211752 167
430 3300027526 Ga0209968_1004440 Ga0209968_10044405 167
431 3300027543 Ga0209999_1048087 Ga0209999_10480872 167
432 3300027665 Ga0209983_1004666 Ga0209983_10046663 167
433 3300027671 Ga0209588_1038360 Ga0209588_10383602 167
434 3300027671 Ga0209588_1059161 Ga0209588_10591613 167
435 3300027682 Ga0209971_1005009 Ga0209971_10050096 167
436 3300027907 Ga0207428_10000321 Ga0207428_1000032115 167
437 3300027907 Ga0207428_10143837 Ga0207428_101438371 167
438 3300027907 Ga0207428_10186995 Ga0207428_101869952 167
439 3300027907 Ga0207428_10227654 Ga0207428_102276543 167
440 3300028380 Ga0268265_10000606 Ga0268265_1000060614 167
441 3300028380 Ga0268265_10003346 Ga0268265_1000334611 167
442 3300028381 Ga0268264_10001077 Ga0268264_1000107722 167
443 3300028563 Ga0265319_1070689 Ga0265319_10706893 167
444 3300031548 Ga0307408_101052881 Ga0307408_1010528812 167
445 3300031731 Ga0307405_10099321 Ga0307405_100993214 167
446 3300031852 Ga0307410_10376878 Ga0307410_103768782 167
447 3300031903 Ga0307407_10084363 Ga0307407_100843633 167
448 3300031911 Ga0307412_10684850 Ga0307412_106848502 167
449 3300031995 Ga0307409_100132774 Ga0307409_1001327743 167
450 3300031995 Ga0307409_100568179 Ga0307409_1005681792 167
451 3300032002 Ga0307416_100071393 Ga0307416_1000713933 167
452 3300032002 Ga0307416_100280683 Ga0307416_1002806832 167
453 3300032002 Ga0307416_100383105 Ga0307416_1003831053 167
454 3300032002 Ga0307416_100503155 Ga0307416_1005031552 167
455 3300032005 Ga0307411_10101431 Ga0307411_101014313 167
456 3300034816 Ga0373930_0051690 Ga0373930_0051690_361_864 167
457 3300035084 Ga0373928_0148833 Ga0373928_0148833_13_516 167
458 3300035085 Ga0373929_0014999 Ga0373929_0014999_789_1292 167
459 3300035088 Ga0373940_0002873 Ga0373940_0002873_2316_2819 167
460 3300035090 Ga0373949_0003576 Ga0373949_0003576_378_881 167
461 3300035090 Ga0373949_0102184 Ga0373949_0102184_189_692 167
462 3300035091 Ga0373951_0016244 Ga0373951_0016244_761_1264 167
463 3300035111 Ga0373923_0028281 Ga0373923_0028281_1114_1620 167
464 3300035112 Ga0373932_0005138 Ga0373932_0005138_1808_2311 167
465 3300035112 Ga0373932_0097928 Ga0373932_0097928_31_534 167
466 3300035112 Ga0373932_0127600 Ga0373932_0127600_263_766 167
467 3300035118 Ga0373954_0000002 Ga0373954_0000002_68396_68902 167
468 3300035207 Ga0373942_0001165 Ga0373942_0001165_4799_5302 167
469 3300035242 Ga0373962_0010615 Ga0373962_0010615_667_1170 167
470 3300035242 Ga0373962_0254173 Ga0373962_0254173_74_577 167
471 3300035691 Ga0373931_0000265 Ga0373931_0000265_12894_13397 167
472 3300035691 Ga0373931_0094753 Ga0373931_0094753_248_751 167
473 3300035691 Ga0373931_0134293 Ga0373931_0134293_860_1363 167
474 3300035691 Ga0373931_0146662 Ga0373931_0146662_93_596 167
475 3300035692 Ga0373935_0380151 Ga0373935_0380151_230_736 167
476 3300035695 Ga0373927_0174223 Ga0373927_0174223_550_1056 167
477 3300035724 Ga0373933_0014193 Ga0373933_0014193_54_560 167
478 3300036401 Ga0373937_0000358 Ga0373937_0000358_30950_31456 167
479 3300036401 Ga0373937_0004969 Ga0373937_0004969_4102_4608 167
480 3300036401 Ga0373937_0390596 Ga0373937_0390596_245_751 167
481 3300041406 Ga0439439_0145438 Ga0439439_0145438_18_521 167
482 3300041408 Ga0439453_0153332 Ga0439453_0153332_14_517 167
483 3300042001 Ga0439441_004715 Ga0439441_004715_227_730 167
484 3300042003 Ga0439443_000966 Ga0439443_000966_2327_2830 167
485 3300042003 Ga0439443_002476 Ga0439443_002476_769_1272 167
486 3300042009 Ga0439451_013492 Ga0439451_013492_858_1361 167
487 3300042013 Ga0439456_017801 Ga0439456_017801_550_1053 167
488 3300042156 Ga0439446_0000176 Ga0439446_0000176_1113_1616 167
489 3300042435 Ga0439434_0007165 Ga0439434_0007165_190_693 167
490 3300042436 Ga0439435_0000026 Ga0439435_0000026_5247_5750 167
491 3300042436 Ga0439435_0016067 Ga0439435_0016067_113_616 167
492 3300042436 Ga0439435_0059349 Ga0439435_0059349_430_933 167
493 3300042437 Ga0439444_0002697 Ga0439444_0002697_618_1121 167
494 3300042461 Ga0439460_0034783 Ga0439460_0034783_569_1072 167
495 3300044694 Ga0466963_0316332 Ga0466963_0316332_312_818 167
496 3300044706 Ga0466964_0138518 Ga0466964_0138518_359_865 167
497 3300045051 Ga0451576_0001306 Ga0451576_0001306_7335_7838 167
498 3300045051 Ga0451576_0050564 Ga0451576_0050564_1877_2380 167
499 3300045051 Ga0451576_0083471 Ga0451576_0083471_944_1447 167
500 3300045051 Ga0451576_0154227 Ga0451576_0154227_1585_2091 167
501 3300045051 Ga0451576_0374264 Ga0451576_0374264_134_640 167
502 3300045051 Ga0451576_0499109 Ga0451576_0499109_507_1013 167
503 3300045051 Ga0451576_1248460 Ga0451576_1248460_106_612 167
504 3300045976 Ga0466967_0006007 Ga0466967_0006007_5452_5958 167
505 3300046454 Ga0495592_0052225 Ga0495592_0052225_1996_2502 167
506 3300046459 Ga0495629_0044253 Ga0495629_0044253_2388_2894 167
507 3300046461 Ga0495641_0056653 Ga0495641_0056653_47_553 167
508 3300046461 Ga0495641_0138487 Ga0495641_0138487_118_624 167
509 3300046475 Ga0495639_0214158 Ga0495639_0214158_148_654 167
510 3300046476 Ga0495662_0014869 Ga0495662_0014869_2000_2506 167
511 3300046511 Ga0495608_0002044 Ga0495608_0002044_5611_6117 167
512 3300046514 Ga0495618_0015263 Ga0495618_0015263_1364_1870 167
513 3300046516 Ga0495628_0016487 Ga0495628_0016487_5128_5634 167
514 3300046517 Ga0495630_0001185 Ga0495630_0001185_13935_14441 167
515 3300046517 Ga0495630_0514081 Ga0495630_0514081_282_788 167
516 3300046523 Ga0495644_0110707 Ga0495644_0110707_311_817 167
517 3300046529 Ga0495652_0048101 Ga0495652_0048101_887_1393 167
518 3300046533 Ga0495640_0000808 Ga0495640_0000808_19227_19733 167
519 3300046533 Ga0495640_0004665 Ga0495640_0004665_3425_3931 167
520 3300046535 Ga0495586_0000440 Ga0495586_0000440_17994_18500 167
521 3300046536 Ga0495587_0009122 Ga0495587_0009122_1281_1787 167
522 3300046539 Ga0495621_0009090 Ga0495621_0009090_713_1219 167
523 3300046539 Ga0495621_0142048 Ga0495621_0142048_241_744 167
524 3300046543 Ga0495645_0069462 Ga0495645_0069462_1853_2359 167
525 3300046559 Ga0495667_0012758 Ga0495667_0012758_1992_2498 167
526 3300046615 Ga0495656_0015676 Ga0495656_0015676_1647_2150 167
527 3300046615 Ga0495656_0670449 Ga0495656_0670449_30_536 167
528 3300046642 Ga0495634_0002587 Ga0495634_0002587_5417_5923 167
529 3300046663 Ga0495635_0032744 Ga0495635_0032744_434_940 167
530 3300046664 Ga0495659_0134567 Ga0495659_0134567_86_589 167
531 3300046675 Ga0495657_0421692 Ga0495657_0421692_144_650 167
532 3300046678 Ga0495599_0037696 Ga0495599_0037696_528_1034 167
533 3300046681 Ga0495647_0100975 Ga0495647_0100975_158_664 167
534 3300046683 Ga0495658_0042024 Ga0495658_0042024_989_1495 167
535 3300046684 Ga0495669_0010255 Ga0495669_0010255_3148_3654 167
536 3300046684 Ga0495669_0118686 Ga0495669_0118686_196_699 167
537 3300046684 Ga0495669_0511337 Ga0495669_0511337_60_563 167
538 3300046689 Ga0495613_0008010 Ga0495613_0008010_6210_6716 167
539 3300046690 Ga0495624_0041706 Ga0495624_0041706_1660_2166 167
540 3300046690 Ga0495624_0150373 Ga0495624_0150373_887_1393 167
541 3300046809 Ga0495600_0180472 Ga0495600_0180472_412_918 167
542 3300047315 Ga0495581_0032165 Ga0495581_0032165_823_1329 167
543 3300047317 Ga0495604_0020749 Ga0495604_0020749_185_691 167
544 3300047322 Ga0495680_0001572 Ga0495680_0001572_17549_18055 167
545 3300047444 Ga0495675_0160223 Ga0495675_0160223_754_1260 167
546 3300047471 Ga0495684_0325172 Ga0495684_0325172_346_852 167
547 3300047673 Ga0495593_0035630 Ga0495593_0035630_2085_2591 167
548 3300047673 Ga0495593_0291004 Ga0495593_0291004_182_688 167
549 3300049568 Ga0501031_0281142 Ga0501031_0281142_369_872 167
550 3300049571 Ga0501034_1313174 Ga0501034_1313174_26_529 167
551 3300049572 Ga0501036_0240028 Ga0501036_0240028_197_700 167
552 3300049573 Ga0501037_0434195 Ga0501037_0434195_288_791 167
553 3300049574 Ga0501038_0026052 Ga0501038_0026052_1968_2471 167
554 3300049574 Ga0501038_0163832 Ga0501038_0163832_1134_1640 167
555 3300049574 Ga0501038_0209304 Ga0501038_0209304_63_566 167
556 3300049575 Ga0501039_0033647 Ga0501039_0033647_2540_3043 167
557 3300049575 Ga0501039_0107755 Ga0501039_0107755_911_1417 167
558 3300049576 Ga0501040_0057334 Ga0501040_0057334_1254_1757 167
559 3300049576 Ga0501040_0169556 Ga0501040_0169556_417_920 167
560 3300049576 Ga0501040_0179156 Ga0501040_0179156_209_715 167
561 3300049576 Ga0501040_0207824 Ga0501040_0207824_596_1099 167
562 3300049577 Ga0501041_0089018 Ga0501041_0089018_403_906 167
563 3300049578 Ga0501042_0071336 Ga0501042_0071336_104_607 167
564 3300049578 Ga0501042_0333659 Ga0501042_0333659_417_920 167
565 3300049580 Ga0501046_0144016 Ga0501046_0144016_106_612 167
566 3300049582 Ga0501048_0033104 Ga0501048_0033104_2255_2758 167
567 3300049582 Ga0501048_0164154 Ga0501048_0164154_914_1417 167
568 3300049583 Ga0501067_0609724 Ga0501067_0609724_85_591 167
569 3300049588 Ga0501072_0000916 Ga0501072_0000916_1183_1686 167
570 3300049588 Ga0501072_0322035 Ga0501072_0322035_618_1121 167
571 3300049588 Ga0501072_0441118 Ga0501072_0441118_431_934 167
572 3300049589 Ga0501073_0390208 Ga0501073_0390208_360_863 167
573 3300049590 Ga0501074_0574959 Ga0501074_0574959_39_542 167
574 3300049591 Ga0501075_0032941 Ga0501075_0032941_619_1122 167
575 3300049591 Ga0501075_0052302 Ga0501075_0052302_101_604 167
576 3300049591 Ga0501075_0589920 Ga0501075_0589920_43_549 167
577 3300049592 Ga0501076_0002030 Ga0501076_0002030_7829_8332 167
578 3300049592 Ga0501076_0047154 Ga0501076_0047154_2084_2587 167
579 3300049592 Ga0501076_0572794 Ga0501076_0572794_205_711 167
580 3300049593 Ga0501077_0034711 Ga0501077_0034711_410_913 167
581 3300049679 Ga0501249_172826 Ga0501249_172826_21_527 167
582 3300049741 Ga0501079_0003830 Ga0501079_0003830_4949_5452 167
583 3300049741 Ga0501079_0644690 Ga0501079_0644690_81_584 167
584 3300049741 Ga0501079_1132980 Ga0501079_1132980_37_540 167
585 3300049742 Ga0501080_0022120 Ga0501080_0022120_1777_2280 167
586 3300049743 Ga0501081_0012653 Ga0501081_0012653_4927_5430 167
587 3300049743 Ga0501081_0359301 Ga0501081_0359301_195_698 167
588 3300049824 Ga0501045_0012092 Ga0501045_0012092_3031_3534 167
589 3300050507 nmdc:mga05p37_132_c1 nmdc:mga05p37_132_c1_4878_5381 167
590 3300050507 nmdc:mga05p37_434447_c1 nmdc:mga05p37_434447_c1_669_1175 167
591 3300050507 nmdc:mga05p37_99251_c1 nmdc:mga05p37_99251_c1_2548_3054 167
592 3300050508 nmdc:mga09592_129332_c1 nmdc:mga09592_129332_c1_310_816 167
593 3300050508 nmdc:mga09592_22875_c1 nmdc:mga09592_22875_c1_3858_4361 167
594 3300050508 nmdc:mga09592_418_c1 nmdc:mga09592_418_c1_1087_1590 167
595 3300050508 nmdc:mga09592_48397_c1 nmdc:mga09592_48397_c1_305_811 167
596 3300050508 nmdc:mga09592_489508_c1 nmdc:mga09592_489508_c1_322_825 167
597 3300050509 nmdc:mga0qj67_143086_c1 nmdc:mga0qj67_143086_c1_1099_1602 167
598 3300050509 nmdc:mga0qj67_54911_c1 nmdc:mga0qj67_54911_c1_2289_2792 167
599 3300050509 nmdc:mga0qj67_623_c1 nmdc:mga0qj67_623_c1_16773_17276 167
600 3300050509 nmdc:mga0qj67_68746_c1 nmdc:mga0qj67_68746_c1_2145_2648 167
601 3300050510 nmdc:mga06r32_146111_c1 nmdc:mga06r32_146111_c1_1121_1624 167
602 3300050510 nmdc:mga06r32_146596_c1 nmdc:mga06r32_146596_c1_485_988 167
603 3300050510 nmdc:mga06r32_242023_c1 nmdc:mga06r32_242023_c1_678_1181 167
604 3300050510 nmdc:mga06r32_260547_c1 nmdc:mga06r32_260547_c1_442_945 167
605 3300050511 nmdc:mga08y16_109514_c1 nmdc:mga08y16_109514_c1_1523_2029 167
606 3300050511 nmdc:mga08y16_2590_c1 nmdc:mga08y16_2590_c1_17156_17659 167
607 3300050511 nmdc:mga08y16_281371_c1 nmdc:mga08y16_281371_c1_618_1124 167
608 3300050511 nmdc:mga08y16_353000_c1 nmdc:mga08y16_353000_c1_834_1340 167
609 3300050511 nmdc:mga08y16_37817_c1 nmdc:mga08y16_37817_c1_4379_4885 167
610 3300050511 nmdc:mga08y16_382460_c1 nmdc:mga08y16_382460_c1_24_527 167
611 3300050511 nmdc:mga08y16_773622_c1 nmdc:mga08y16_773622_c1_129_632 167
612 3300050512 nmdc:mga0n895_1401573_c1 nmdc:mga0n895_1401573_c1_33_539 167
613 3300050512 nmdc:mga0n895_260541_c1 nmdc:mga0n895_260541_c1_227_733 167
614 3300050512 nmdc:mga0n895_38225_c1 nmdc:mga0n895_38225_c1_2036_2542 167
615 3300050512 nmdc:mga0n895_4259_c1 nmdc:mga0n895_4259_c1_8040_8543 167
616 3300050512 nmdc:mga0n895_456_c1 nmdc:mga0n895_456_c1_25158_25664 167
617 3300050513 nmdc:mga0rr50_16225_c1 nmdc:mga0rr50_16225_c1_3414_3920 167
618 3300050513 nmdc:mga0rr50_165651_c1 nmdc:mga0rr50_165651_c1_851_1354 167
619 3300050513 nmdc:mga0rr50_25229_c1 nmdc:mga0rr50_25229_c1_1411_1917 167
620 3300050513 nmdc:mga0rr50_30285_c1 nmdc:mga0rr50_30285_c1_3162_3665 167
621 3300050513 nmdc:mga0rr50_397861_c1 nmdc:mga0rr50_397861_c1_429_932 167
622 3300050513 nmdc:mga0rr50_949778_c1 nmdc:mga0rr50_949778_c1_35_541 167
623 3300050514 nmdc:mga08x19_108272_c1 nmdc:mga08x19_108272_c1_282_788 167
624 3300050514 nmdc:mga08x19_18431_c1 nmdc:mga08x19_18431_c1_2051_2554 167
625 3300050514 nmdc:mga08x19_2829_c1 nmdc:mga08x19_2829_c1_2553_3056 167
626 3300050514 nmdc:mga08x19_382528_c1 nmdc:mga08x19_382528_c1_86_592 167
627 3300050514 nmdc:mga08x19_55_c1 nmdc:mga08x19_55_c1_78526_79032 167
628 3300050514 nmdc:mga08x19_6047_c1 nmdc:mga08x19_6047_c1_2341_2847 167
629 3300050515 nmdc:mga0a205_1791_c1 nmdc:mga0a205_1791_c1_2576_3079 167
630 3300050515 nmdc:mga0a205_774829_c1 nmdc:mga0a205_774829_c1_107_613 167
631 3300050515 nmdc:mga0a205_783686_c1 nmdc:mga0a205_783686_c1_246_749 167
632 3300050515 nmdc:mga0a205_97943_c1 nmdc:mga0a205_97943_c1_511_1014 167
633 3300053077 Ga0495601_0020352 Ga0495601_0020352_778_1284 167
634 3300053085 Ga0495619_0212455 Ga0495619_0212455_185_691 167
635 3300053094 Ga0500566_0149637 Ga0500566_0149637_374_880 167
636 3300054114 Ga0501084_0015022 Ga0501084_0015022_561_1064 167
637 3300054114 Ga0501084_0115264 Ga0501084_0115264_1587_2090 167
638 3300059421 Ga0590071_092498 Ga0590071_092498_116_619 167
639 3300060353 Ga0501082_0105770 Ga0501082_0105770_431_934 167
640 3300060353 Ga0501082_0531014 Ga0501082_0531014_278_781 167
641 3300061734 Ga0530510_0005015 Ga0530510_0005015_6945_7448 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

28

173

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vdm-assembly1.cif.gz_C crystal structure of purine phosphoribosyltransferase from pyrococcus horikoshii ot3 0.8693 7 140
4qri-assembly1.cif.gz_B 2.35 angstrom resolution crystal structure of hypoxanthine-guanine-xanthine phosphoribosyltransferase from leptospira interrogans serovar copenhageni str. fiocruz l1-130 0.856 6 139
4qri-assembly1.cif.gz_A 2.35 angstrom resolution crystal structure of hypoxanthine-guanine-xanthine phosphoribosyltransferase from leptospira interrogans serovar copenhageni str. fiocruz l1-130 0.8518 6 139
1vdm-assembly1.cif.gz_K crystal structure of purine phosphoribosyltransferase from pyrococcus horikoshii ot3 0.8508 7 139
4p81-assembly1.cif.gz_C structure of ancestral pyrr protein (ancorangepyrr) 0.8492 3 163
ID Description Score Start End Superfamily
4qriB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.856 6 139 3.40.50.2020
af_P9WHK3_1_193_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8418 1 162 3.40.50.2020
3acdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8189 6 141 3.40.50.2020
af_P9WHK3_1_193_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8142 1 162 3.40.50.2020
4p83D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8139 1 164 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A259DAR2-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9668 75 164
AF-A0A1H3JWM0-F1-model_v4 Pyrimidine operon attenuation protein / uracil phosphoribosyltransferase 0.9552 1 163 GO:0016757
AF-A0A2R5EFG8-F1-model_v4 Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase 0.9403 2 167 GO:0016757
AF-A0A1E7YRI3-F1-model_v4 Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase 0.9369 2 143 GO:0016757
AF-A0A2R5EFG8-F1-model_v4 Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase 0.9295 2 167 GO:0016757

Feature Viewer

pLDDT pTM Quality
86.87 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map